F465845

General Info

Members Datasets Scaffolds Average Seq Length
579 322 1158 380

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10008246|Ga0307414_100082463
Length 418
Sequence MAKDRCADWAPQCFTGGQWSRRRPGPYSVKNAIPLPGRRPTVLKSGARARLFSGFAGSRIRRIGXVKYLQALLLSLAVILAPAGVRSNPLTGYGLVVGLDGTGDQTTQAPFTGQSLQAMLQQFGVILPQGVTMQPRNIAAVMVTASLPPFAQPGQQLDINVSSIGNAKSLRGGTLIATPLRGADGQVYAIAQGNLVVGGAGASAGGSKVQINHLSAGRIPAGALVERSVPTPLAQGDSIQLDLNSSDFATARAVAQAINKAKGAGVAQAMDGRVVRVRAPVTPDERVGFLADVENLAIDMAMPAARVVINARTGSVVMNQAVTLSACAVAHGSLSVTISSTPVISQPNALSGGQTTVAEKADISIRQEPGSLIQLAAGARLSDVVKALNSLGATPQDLLAILQAMKSAGALNAELEVI

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
218 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
219 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
220 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
221 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
222 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
223 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
224 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
265 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
266 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
272 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
273 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
274 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
275 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
276 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
277 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
278 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
279 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
298 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
299 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
300 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
301 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 2547132374 Acidovorax radicis N35 Isolate Unclassified
304 2547132512 Azospira oryzae 6a3 Isolate Unclassified
305 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
306 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
307 2643221570 Acidovorax sp. Root568 Isolate Unclassified
308 2643221585 Pelomonas sp. Root662 Isolate Unclassified
309 2643221596 Acidovorax sp. Root70 Isolate Unclassified
310 2643221609 Acidovorax sp. Root217 Isolate Unclassified
311 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
312 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
313 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
314 2643221652 Acidovorax sp. Root402 Isolate Unclassified
315 2643221656 Pelomonas sp. Root405 Isolate Unclassified
316 2643221717 Acidovorax sp. Root267 Isolate Unclassified
317 2738541337 Pelomonas sp. BT06 Isolate Unclassified
318 2831864461 Roseateles noduli HZ7 Isolate Nodule
319 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
320 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
321 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
322 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 0.35
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.2
Nodule 0.86
Rhizoplane 1.21
Rhizosphere 72.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10008246 3300032004 Bacteria 5896
2 JGI24740J21852_10020646 3300001979 Bacteria 2294
3 JGI25156J39149_1000563 3300002705 Bacteria 21172
4 JGI25154J39366_1000824 3300002738 Bacteria 13459
5 JGI25157J39369_1000027 3300002741 Bacteria 147448
6 rootH1_10009659 3300003316 Bacteria 18768
7 rootL2_10003861 3300003322 Bacteria 52646
8 rootL2_10009273 3300003322 Bacteria 31971
9 rootH1_10007051 3300003323 Bacteria 14639
10 rootH1_10019349 3300003323 Bacteria 13289
11 Ga0055533_1000073 3300003756 Bacteria 142476
12 Ga0055525_1000038 3300003759 Bacteria 297540
13 Ga0055525_1000687 3300003759 Bacteria 12627
14 Ga0055535_1000229 3300003761 Bacteria 58945
15 Ga0055529_1000064 3300003763 Bacteria 178831
16 Ga0055526_1002388 3300003771 Bacteria 12716
17 Ga0055524_1000811 3300003775 Bacteria 20714
18 Ga0055524_1003733 3300003775 Bacteria 7281
19 Ga0055524_1013243 3300003775 Bacteria 3119
20 Ga0055530_10001410 3300003791 Bacteria 17677
21 Ga0055540_1000014 3300003792 Bacteria 234171
22 Ga0055531_10000043 3300003794 Bacteria 133906
23 Ga0055531_10005944 3300003794 Bacteria 7015
24 Ga0055543_1002234 3300004625 Bacteria 6575
25 Ga0065165_1000283 3300005262 Bacteria 86141
26 Ga0065165_1000732 3300005262 Bacteria 45731
27 Ga0070676_10018129 3300005328 Bacteria 3898
28 Ga0070676_10047868 3300005328 Bacteria 2498
29 Ga0070683_100070724 3300005329 Bacteria 3255
30 Ga0070670_100000850 3300005331 Bacteria 23893
31 Ga0070670_100075432 3300005331 Bacteria 2897
32 Ga0070670_100103546 3300005331 Bacteria 2452
33 Ga0070677_10006469 3300005333 Bacteria 3893
34 Ga0068869_100001930 3300005334 Bacteria 12450
35 Ga0068869_100005265 3300005334 Bacteria 8125
36 Ga0068869_100007786 3300005334 Bacteria 6873
37 Ga0068869_100040612 3300005334 Bacteria 3327
38 Ga0068869_100286523 3300005334 Bacteria 1326
39 Ga0070666_10001417 3300005335 Bacteria 14515
40 Ga0070680_100125842 3300005336 Bacteria 2141
41 Ga0068868_100005488 3300005338 Bacteria 8921
42 Ga0068868_100007503 3300005338 Bacteria 7770
43 Ga0068868_100018596 3300005338 Bacteria 5198
44 Ga0068868_100137821 3300005338 Bacteria 2001
45 Ga0070689_100007461 3300005340 Bacteria 7648
46 Ga0070661_100000220 3300005344 Bacteria 47213
47 Ga0070661_100004395 3300005344 Bacteria 9720
48 Ga0070661_100108429 3300005344 Bacteria 2072
49 Ga0070668_100114886 3300005347 Bacteria 2145
50 Ga0070669_100004026 3300005353 Bacteria 10628
51 Ga0070669_100266408 3300005353 Bacteria 1368
52 Ga0070675_100002378 3300005354 Bacteria 14007
53 Ga0070675_100005838 3300005354 Bacteria 9428
54 Ga0070675_100010712 3300005354 Bacteria 7171
55 Ga0070675_100074646 3300005354 Bacteria 2817
56 Ga0070671_100001602 3300005355 Bacteria 17027
57 Ga0070671_100048779 3300005355 Bacteria 3522
58 Ga0070671_100066546 3300005355 Bacteria 3003
59 Ga0070671_100249551 3300005355 Bacteria 1507
60 Ga0070674_100023104 3300005356 Bacteria 4019
61 Ga0070674_100160670 3300005356 Bacteria 1704
62 Ga0070673_100005543 3300005364 Bacteria 8091
63 Ga0070673_100031127 3300005364 Bacteria 4001
64 Ga0070673_100094350 3300005364 Bacteria 2452
65 Ga0070673_100121359 3300005364 Bacteria 2180
66 Ga0070688_100068611 3300005365 Bacteria 2261
67 Ga0070688_100106521 3300005365 Bacteria 1857
68 Ga0070659_100011721 3300005366 Bacteria 6490
69 Ga0070659_100025954 3300005366 Bacteria 4507
70 Ga0070659_100040856 3300005366 Bacteria 3625
71 Ga0070667_100000700 3300005367 Bacteria 32341
72 Ga0070667_100009105 3300005367 Bacteria 8216
73 Ga0070667_100047152 3300005367 Bacteria 3625
74 Ga0070667_100133250 3300005367 Bacteria 2170
75 Ga0070667_100341366 3300005367 Bacteria 1354
76 Ga0070663_100000511 3300005455 Bacteria 20575
77 Ga0070678_100000433 3300005456 Bacteria 19789
78 Ga0070678_100007186 3300005456 Bacteria 6589
79 Ga0070662_100003680 3300005457 Bacteria 9583
80 Ga0070662_100006117 3300005457 Bacteria 7737
81 Ga0070662_100021310 3300005457 Bacteria 4424
82 Ga0070662_100190549 3300005457 Bacteria 1621
83 Ga0068867_100000790 3300005459 Bacteria 21397
84 Ga0068867_100018436 3300005459 Bacteria 4961
85 Ga0068867_100130503 3300005459 Bacteria 1952
86 Ga0070706_100005275 3300005467 Bacteria 12329
87 Ga0070706_100272100 3300005467 Bacteria 1581
88 Ga0070684_100047218 3300005535 Bacteria 3731
89 Ga0068853_100115148 3300005539 Bacteria 2392
90 Ga0070672_100009309 3300005543 Bacteria 6767
91 Ga0070672_100032098 3300005543 Bacteria 3961
92 Ga0070672_100153876 3300005543 Bacteria 1904
93 Ga0070672_100177767 3300005543 Bacteria 1772
94 Ga0070672_100239859 3300005543 Bacteria 1524
95 Ga0070686_100065311 3300005544 Bacteria 2363
96 Ga0070693_100061269 3300005547 Bacteria 2186
97 Ga0070665_100009189 3300005548 Bacteria 10010
98 Ga0070665_100010362 3300005548 Bacteria 9432
99 Ga0070665_100094661 3300005548 Bacteria 2992
100 Ga0070664_100000267 3300005564 Bacteria 37668
101 Ga0070664_100014574 3300005564 Bacteria 6413
102 Ga0070664_100295237 3300005564 Bacteria 1463
103 Ga0068857_100050441 3300005577 Bacteria 3692
104 Ga0068857_100089978 3300005577 Bacteria 2746
105 Ga0068857_100175497 3300005577 Bacteria 1949
106 Ga0068854_100024301 3300005578 Bacteria 4146
107 Ga0068854_100294446 3300005578 Bacteria 1311
108 Ga0068856_100002053 3300005614 Bacteria 20877
109 Ga0068856_100053763 3300005614 Bacteria 3971
110 Ga0068856_100097786 3300005614 Bacteria 2925
111 Ga0068856_100173849 3300005614 Bacteria 2166
112 Ga0070702_100070293 3300005615 Bacteria 2066
113 Ga0068852_100029460 3300005616 Bacteria 4510
114 Ga0068852_100034194 3300005616 Bacteria 4227
115 Ga0068852_100083629 3300005616 Bacteria 2838
116 Ga0068852_100087670 3300005616 Bacteria 2778
117 Ga0068852_100175936 3300005616 Bacteria 2009
118 Ga0068852_100222056 3300005616 Bacteria 1797
119 Ga0068859_100003363 3300005617 Bacteria 16266
120 Ga0068859_100025954 3300005617 Bacteria 5877
121 Ga0068864_100001169 3300005618 Bacteria 21827
122 Ga0068864_100009554 3300005618 Bacteria 8000
123 Ga0068866_10004218 3300005718 Bacteria 5904
124 Ga0068861_100002761 3300005719 Bacteria 11515
125 Ga0068861_100012081 3300005719 Bacteria 6019
126 Ga0068851_10016166 3300005834 Bacteria 3566
127 Ga0068863_100003087 3300005841 Bacteria 16458
128 Ga0068863_100017354 3300005841 Bacteria 6902
129 Ga0068863_100127723 3300005841 Bacteria 2426
130 Ga0068863_100241801 3300005841 Bacteria 1742
131 Ga0068858_100001403 3300005842 Bacteria 24769
132 Ga0068858_100016272 3300005842 Bacteria 6987
133 Ga0068858_100026308 3300005842 Bacteria 5408
134 Ga0068858_100041047 3300005842 Bacteria 4291
135 Ga0068858_100089488 3300005842 Bacteria 2864
136 Ga0068860_100003047 3300005843 Bacteria 17299
137 Ga0068860_100040000 3300005843 Bacteria 4483
138 Ga0068860_100107276 3300005843 Bacteria 2669
139 Ga0068862_100006386 3300005844 Bacteria 9800
140 Ga0068862_100050001 3300005844 Bacteria 3572
141 Ga0075365_10064112 3300006038 Bacteria 2461
142 Ga0075368_10012650 3300006042 Bacteria 3091
143 Ga0075363_100058403 3300006048 Bacteria 2072
144 Ga0075364_10062334 3300006051 Bacteria 2447
145 Ga0075362_10039634 3300006177 Bacteria 2072
146 Ga0075362_10072100 3300006177 Bacteria 1579
147 Ga0075367_10010627 3300006178 Bacteria 4842
148 Ga0075369_10073347 3300006186 Bacteria 1509
149 Ga0075366_10000057 3300006195 Bacteria 40849
150 Ga0075366_10006397 3300006195 Bacteria 6453
151 Ga0075366_10008679 3300006195 Bacteria 5658
152 Ga0075366_10022149 3300006195 Bacteria 3695
153 Ga0075366_10023870 3300006195 Bacteria 3564
154 Ga0075366_10074715 3300006195 Bacteria 2021
155 Ga0097621_100010488 3300006237 Bacteria 6784
156 Ga0075370_10001735 3300006353 Bacteria 9703
157 Ga0075370_10011833 3300006353 Bacteria 4594
158 Ga0075370_10086420 3300006353 Bacteria 1806
159 Ga0068871_100020919 3300006358 Bacteria 5018
160 Ga0068871_100023965 3300006358 Bacteria 4728
161 Ga0068871_100054655 3300006358 Bacteria 3240
162 Ga0068865_100055161 3300006881 Bacteria 2764
163 Ga0068865_100102466 3300006881 Bacteria 2098
164 Ga0097620_100003363 3300006931 Bacteria 16266
165 Ga0097620_100025956 3300006931 Bacteria 5877
166 Ga0099823_1000083 3300006944 Bacteria 44975
167 Ga0079104_1000013 3300006946 Bacteria 349477
168 Ga0105240_10015301 3300009093 Bacteria 10439
169 Ga0105243_10002845 3300009148 Bacteria 14364
170 Ga0105243_10031064 3300009148 Bacteria 4118
171 Ga0105243_10072980 3300009148 Bacteria 2779
172 Ga0105243_10297918 3300009148 Bacteria 1460
173 Ga0105243_10317003 3300009148 Bacteria 1419
174 Ga0105241_10140065 3300009174 Bacteria 1968
175 Ga0105248_10009574 3300009177 Bacteria 10665
176 Ga0105248_10260997 3300009177 Bacteria 1950
177 Ga0105248_10339165 3300009177 Bacteria 1692
178 Ga0105248_10351456 3300009177 Bacteria 1660
179 Ga0105248_10378446 3300009177 Bacteria 1594
180 Ga0105237_10000441 3300009545 Bacteria 59156
181 Ga0105237_10014405 3300009545 Bacteria 8270
182 Ga0105237_10091316 3300009545 Bacteria 3035
183 Ga0105238_10009732 3300009551 Bacteria 9625
184 Ga0105249_10004602 3300009553 Bacteria 11919
185 Ga0105249_10110718 3300009553 Bacteria 2595
186 Ga0105239_10000417 3300010375 Bacteria 62040
187 Ga0105239_10037326 3300010375 Bacteria 5327
188 Ga0105239_10404132 3300010375 Bacteria 1546
189 Ga0105246_10015911 3300011119 Bacteria 4757
190 Ga0157319_1000037 3300012497 Bacteria 39883
191 Ga0157371_10215441 3300013102 Bacteria 1378
192 Ga0157369_10016240 3300013105 Bacteria 8378
193 Ga0157374_10027953 3300013296 Bacteria 5092
194 Ga0157374_10039209 3300013296 Bacteria 4360
195 Ga0157374_10060407 3300013296 Bacteria 3547
196 Ga0157374_10190929 3300013296 Bacteria 2004
197 Ga0157378_10433601 3300013297 Bacteria 1301
198 Ga0157372_10012500 3300013307 Bacteria 9047
199 Ga0157372_10075980 3300013307 Bacteria 3792
200 Ga0157375_10014622 3300013308 Bacteria 7010
201 Ga0157375_10068827 3300013308 Bacteria 3543
202 Ga0157375_10074029 3300013308 Bacteria 3426
203 Ga0157380_10096418 3300014326 Bacteria 2452
204 Ga0157377_10000091 3300014745 Bacteria 66087
205 Ga0157379_10014441 3300014968 Bacteria 6930
206 Ga0157379_10045749 3300014968 Bacteria 3907
207 Ga0157379_10073834 3300014968 Bacteria 3053
208 Ga0157379_10166132 3300014968 Bacteria 1992
209 Ga0157376_10130254 3300014969 Bacteria 2244
210 Ga0163161_10053626 3300017792 Bacteria 2925
211 Ga0163161_10076498 3300017792 Bacteria 2457
212 Ga0163161_10158902 3300017792 Bacteria 1723
213 Ga0163161_10198636 3300017792 Bacteria 1545
214 Ga0213872_10005532 3300021361 Bacteria 6476
215 Ga0209674_100039 3300025226 Bacteria 402292
216 Ga0209563_100005 3300025230 Bacteria 1774893
217 Ga0209563_100110 3300025230 Bacteria 142518
218 Ga0207427_101215 3300025231 Bacteria 9962
219 Ga0209258_100124 3300025242 Bacteria 178883
220 Ga0209646_1000196 3300025246 Bacteria 72959
221 Ga0209026_1000011 3300025250 Bacteria 507291
222 Ga0209677_100151 3300025253 Bacteria 63642
223 Ga0209677_100488 3300025253 Bacteria 22414
224 Ga0209759_1000107 3300025256 Bacteria 147025
225 Ga0209759_1000652 3300025256 Bacteria 32306
226 Ga0209759_1000898 3300025256 Bacteria 22252
227 Ga0209759_1002444 3300025256 Bacteria 8146
228 Ga0209455_1000114 3300025272 Bacteria 178883
229 Ga0209673_1004315 3300025273 Bacteria 7675
230 Ga0209675_1018130 3300025291 Bacteria 1979
231 Ga0209025_1000073 3300025294 Bacteria 282133
232 Ga0209564_1000003 3300025295 Bacteria 1585848
233 Ga0209050_1000142 3300025298 Bacteria 172356
234 Ga0209050_1002548 3300025298 Bacteria 15231
235 Ga0209256_1000130 3300025299 Bacteria 163227
236 Ga0209256_1000471 3300025299 Bacteria 60530
237 Ga0209256_1000967 3300025299 Bacteria 34624
238 Ga0209051_1000035 3300025303 Bacteria 346999
239 Ga0209051_1006920 3300025303 Bacteria 6297
240 Ga0209051_1045439 3300025303 Bacteria 1520
241 Ga0209257_1000049 3300025304 Bacteria 441224
242 Ga0209257_1000346 3300025304 Bacteria 95662
243 Ga0209257_1001013 3300025304 Bacteria 37837
244 Ga0209257_1001664 3300025304 Bacteria 25177
245 Ga0207697_10005656 3300025315 Bacteria 5771
246 Ga0207697_10025489 3300025315 Bacteria 2417
247 Ga0207656_10051584 3300025321 Bacteria 1779
248 Ga0207682_10012069 3300025893 Bacteria 3375
249 Ga0207682_10069737 3300025893 Bacteria 1487
250 Ga0207642_10005296 3300025899 Bacteria 4201
251 Ga0207688_10039783 3300025901 Bacteria 2611
252 Ga0207680_10002275 3300025903 Bacteria 8950
253 Ga0207645_10022078 3300025907 Bacteria 4146
254 Ga0207643_10103874 3300025908 Bacteria 1668
255 Ga0207705_10161489 3300025909 Bacteria 1684
256 Ga0207684_10002424 3300025910 Bacteria 18808
257 Ga0207684_10225612 3300025910 Bacteria 1617
258 Ga0207695_10023628 3300025913 Bacteria 6937
259 Ga0207695_10024383 3300025913 Bacteria 6809
260 Ga0207695_10041056 3300025913 Bacteria 4953
261 Ga0207671_10010439 3300025914 Bacteria 7663
262 Ga0207662_10009825 3300025918 Bacteria 5280
263 Ga0207657_10067987 3300025919 Bacteria 3028
264 Ga0207657_10069336 3300025919 Bacteria 2993
265 Ga0207649_10004236 3300025920 Bacteria 7815
266 Ga0207649_10023503 3300025920 Bacteria 3570
267 Ga0207649_10078383 3300025920 Bacteria 2132
268 Ga0207646_10038725 3300025922 Bacteria 4292
269 Ga0207694_10022050 3300025924 Bacteria 4830
270 Ga0207694_10047792 3300025924 Bacteria 3309
271 Ga0207650_10001495 3300025925 Bacteria 16717
272 Ga0207650_10002662 3300025925 Bacteria 12361
273 Ga0207650_10009201 3300025925 Bacteria 6751
274 Ga0207650_10088991 3300025925 Bacteria 2356
275 Ga0207659_10000197 3300025926 Bacteria 35939
276 Ga0207659_10002339 3300025926 Bacteria 11286
277 Ga0207659_10063764 3300025926 Bacteria 2665
278 Ga0207659_10096641 3300025926 Bacteria 2217
279 Ga0207687_10091982 3300025927 Bacteria 2214
280 Ga0207687_10100803 3300025927 Bacteria 2125
281 Ga0207687_10181671 3300025927 Bacteria 1630
282 Ga0207644_10003455 3300025931 Bacteria 10217
283 Ga0207644_10035491 3300025931 Bacteria 3494
284 Ga0207644_10051476 3300025931 Bacteria 2956
285 Ga0207644_10053618 3300025931 Bacteria 2902
286 Ga0207644_10054586 3300025931 Bacteria 2878
287 Ga0207690_10034111 3300025932 Bacteria 3277
288 Ga0207690_10040139 3300025932 Bacteria 3058
289 Ga0207706_10000993 3300025933 Bacteria 28866
290 Ga0207706_10001576 3300025933 Bacteria 22614
291 Ga0207706_10032969 3300025933 Bacteria 4609
292 Ga0207706_10094816 3300025933 Bacteria 2625
293 Ga0207686_10235319 3300025934 Bacteria 1330
294 Ga0207709_10004566 3300025935 Bacteria 7972
295 Ga0207670_10022716 3300025936 Bacteria 3893
296 Ga0207670_10070544 3300025936 Bacteria 2414
297 Ga0207669_10022258 3300025937 Bacteria 3363
298 Ga0207669_10105420 3300025937 Bacteria 1875
299 Ga0207669_10141322 3300025937 Bacteria 1671
300 Ga0207704_10040992 3300025938 Bacteria 2711
301 Ga0207704_10151029 3300025938 Bacteria 1639
302 Ga0207704_10156901 3300025938 Bacteria 1614
303 Ga0207665_10132413 3300025939 Bacteria 1771
304 Ga0207691_10004989 3300025940 Bacteria 12802
305 Ga0207691_10020851 3300025940 Bacteria 6193
306 Ga0207691_10021708 3300025940 Bacteria 6059
307 Ga0207691_10087692 3300025940 Bacteria 2792
308 Ga0207691_10142238 3300025940 Bacteria 2114
309 Ga0207691_10201285 3300025940 Bacteria 1733
310 Ga0207691_10240515 3300025940 Bacteria 1565
311 Ga0207711_10027239 3300025941 Bacteria 4800
312 Ga0207711_10402120 3300025941 Bacteria 1273
313 Ga0207689_10000855 3300025942 Bacteria 29354
314 Ga0207689_10003648 3300025942 Bacteria 14048
315 Ga0207689_10009091 3300025942 Bacteria 8601
316 Ga0207689_10037021 3300025942 Bacteria 4049
317 Ga0207661_10074747 3300025944 Bacteria 2778
318 Ga0207679_10000486 3300025945 Bacteria 27449
319 Ga0207679_10150701 3300025945 Bacteria 1892
320 Ga0207667_10022793 3300025949 Bacteria 6907
321 Ga0207651_10001363 3300025960 Bacteria 11065
322 Ga0207651_10040929 3300025960 Bacteria 3071
323 Ga0207651_10045110 3300025960 Bacteria 2955
324 Ga0207712_10056510 3300025961 Bacteria 2765
325 Ga0207668_10096253 3300025972 Bacteria 2187
326 Ga0207640_10050526 3300025981 Bacteria 2698
327 Ga0207640_10124031 3300025981 Bacteria 1856
328 Ga0207658_10000584 3300025986 Bacteria 32681
329 Ga0207658_10003965 3300025986 Bacteria 10396
330 Ga0207658_10005437 3300025986 Bacteria 8735
331 Ga0207677_10000523 3300026023 Bacteria 24613
332 Ga0207677_10005674 3300026023 Bacteria 6791
333 Ga0207703_10000325 3300026035 Bacteria 51876
334 Ga0207703_10040823 3300026035 Bacteria 3715
335 Ga0207639_10136479 3300026041 Bacteria 2038
336 Ga0207678_10005512 3300026067 Bacteria 11313
337 Ga0207678_10013887 3300026067 Bacteria 7076
338 Ga0207678_10057494 3300026067 Bacteria 3347
339 Ga0207708_10113761 3300026075 Bacteria 2103
340 Ga0207702_10000356 3300026078 Bacteria 52498
341 Ga0207702_10057280 3300026078 Bacteria 3312
342 Ga0207641_10001571 3300026088 Bacteria 22312
343 Ga0207641_10011281 3300026088 Bacteria 7331
344 Ga0207641_10025455 3300026088 Bacteria 4879
345 Ga0207641_10039655 3300026088 Bacteria 3940
346 Ga0207641_10114321 3300026088 Bacteria 2398
347 Ga0207648_10000264 3300026089 Bacteria 56766
348 Ga0207648_10001338 3300026089 Bacteria 27369
349 Ga0207648_10002162 3300026089 Bacteria 21355
350 Ga0207648_10251273 3300026089 Bacteria 1576
351 Ga0207648_10297248 3300026089 Bacteria 1447
352 Ga0207676_10000490 3300026095 Bacteria 33231
353 Ga0207676_10005347 3300026095 Bacteria 9093
354 Ga0207676_10013103 3300026095 Bacteria 5952
355 Ga0207674_10029541 3300026116 Bacteria 5771
356 Ga0207674_10071817 3300026116 Bacteria 3477
357 Ga0207674_10093960 3300026116 Bacteria 2986
358 Ga0207674_10414113 3300026116 Bacteria 1302
359 Ga0207675_100000911 3300026118 Bacteria 29492
360 Ga0207675_100008377 3300026118 Bacteria 9744
361 Ga0207675_100023015 3300026118 Bacteria 5795
362 Ga0207683_10008423 3300026121 Bacteria 8824
363 Ga0207683_10095657 3300026121 Bacteria 2648
364 Ga0207683_10125186 3300026121 Bacteria 2309
365 Ga0207683_10173044 3300026121 Bacteria 1956
366 Ga0207683_10382777 3300026121 Bacteria 1293
367 Ga0207698_10064480 3300026142 Bacteria 2872
368 Ga0207698_10225598 3300026142 Bacteria 1697
369 Ga0207698_10345914 3300026142 Bacteria 1402
370 Ga0209281_1000076 3300027111 Bacteria 263350
371 Ga0209389_1005358 3300027296 Bacteria 10908
372 Ga0209970_1000205 3300027614 Bacteria 9425
373 Ga0209974_10019225 3300027876 Bacteria 2264
374 Ga0209974_10021631 3300027876 Bacteria 2131
375 Ga0268266_10004766 3300028379 Bacteria 12893
376 Ga0268266_10108331 3300028379 Bacteria 2458
377 Ga0268265_10123854 3300028380 Bacteria 2135
378 Ga0268264_10002108 3300028381 Bacteria 17734
379 Ga0268264_10067248 3300028381 Bacteria 3024
380 Ga0268264_10088476 3300028381 Bacteria 2666
381 Ga0268264_10270055 3300028381 Bacteria 1588
382 Ga0265336_10000022 3300028666 Bacteria 192716
383 Ga0307515_10000232 3300028794 Bacteria 137778
384 Ga0307515_10000626 3300028794 Bacteria 82165
385 Ga0307515_10003007 3300028794 Bacteria 35804
386 Ga0307515_10027050 3300028794 Bacteria 9832
387 Ga0307515_10031847 3300028794 Bacteria 8762
388 Ga0307515_10087591 3300028794 Bacteria 3949
389 Ga0307515_10121617 3300028794 Bacteria 2952
390 Ga0307512_10037626 3300030522 Bacteria 4083
391 Ga0265330_10000045 3300031235 Bacteria 109977
392 Ga0265332_10000010 3300031238 Bacteria 289041
393 Ga0265332_10000031 3300031238 Bacteria 162330
394 Ga0265332_10000220 3300031238 Bacteria 45756
395 Ga0265325_10000849 3300031241 Bacteria 22093
396 Ga0265331_10005247 3300031250 Bacteria 7851
397 Ga0265331_10010489 3300031250 Bacteria 5125
398 Ga0265327_10000028 3300031251 Bacteria 361066
399 Ga0265327_10000065 3300031251 Bacteria 225004
400 Ga0307513_10001541 3300031456 Bacteria 33038
401 Ga0307509_10002982 3300031507 Bacteria 26501
402 Ga0307509_10018801 3300031507 Bacteria 7910
403 Ga0307408_100000160 3300031548 Bacteria 74342
404 Ga0307408_100174270 3300031548 Bacteria 1720
405 Ga0307508_10001328 3300031616 Bacteria 27985
406 Ga0307508_10094116 3300031616 Bacteria 2587
407 Ga0307514_10000965 3300031649 Bacteria 43069
408 Ga0307514_10006184 3300031649 Bacteria 10502
409 Ga0307514_10047979 3300031649 Bacteria 3330
410 Ga0265314_10000095 3300031711 Bacteria 134372
411 Ga0307516_10000705 3300031730 Bacteria 45448
412 Ga0307516_10001481 3300031730 Bacteria 32359
413 Ga0307516_10172539 3300031730 Bacteria 1902
414 Ga0307406_10021649 3300031901 Bacteria 3806
415 Ga0307412_10305626 3300031911 Bacteria 1259
416 Ga0307409_100002804 3300031995 Bacteria 9214
417 Ga0307409_100044192 3300031995 Bacteria 3353
418 Ga0307416_100001904 3300032002 Bacteria 11656
419 Ga0307411_10098498 3300032005 Bacteria 2061
420 Ga0307415_100002488 3300032126 Bacteria 9200
421 Ga0307415_100025039 3300032126 Bacteria 3738
422 Ga0307510_10007541 3300033180 Bacteria 12959
423 Ga0307510_10010166 3300033180 Bacteria 11189
424 Ga0307510_10123859 3300033180 Bacteria 2280
425 Ga0373950_0000951 3300034818 Bacteria 3660
426 Ga0373932_0003452 3300035112 Bacteria 3797
427 Ga0373939_0000327 3300035114 Bacteria 12282
428 Ga0373939_0007608 3300035114 Bacteria 2634
429 Ga0373945_0047048 3300035116 Bacteria 1576
430 Ga0373960_0011647 3300035121 Bacteria 2170
431 Ga0373931_0000429 3300035691 Bacteria 17104
432 Ga0373931_0001365 3300035691 Bacteria 10433
433 Ga0373931_0035651 3300035691 Bacteria 2588
434 Ga0373937_0011428 3300036401 Bacteria 7792
435 Ga0373937_0107300 3300036401 Bacteria 2596
436 Ga0373925_0007028 3300037068 Bacteria 8223
437 Ga0395900_0000025 3300037418 Bacteria 321217
438 Ga0395898_0001478 3300037466 Bacteria 32803
439 Ga0395905_0000460 3300037471 Bacteria 56900
440 Ga0395905_0022908 3300037471 Bacteria 5902
441 Ga0395905_0028216 3300037471 Bacteria 5291
442 Ga0395901_0004869 3300038443 Bacteria 13555
443 Ga0436365_1928031 3300039437 Bacteria 6436
444 Ga0436361_0237090 3300039447 Bacteria 27848
445 Ga0436361_0677882 3300039447 Bacteria 228834
446 Ga0436363_0109176 3300039450 Bacteria 1915
447 Ga0451789_0025616 3300041443 Bacteria 2685
448 Ga0450911_000124 3300042115 Bacteria 30673
449 Ga0450919_000447 3300042121 Bacteria 5110
450 Ga0450923_001314 3300042125 Bacteria 3250
451 Ga0450891_000198 3300042129 Bacteria 5951
452 Ga0450892_002384 3300042130 Bacteria 1609
453 Ga0450889_000024 3300042144 Bacteria 13076
454 Ga0439459_0001598 3300042438 Bacteria 3373
455 Ga0450918_000044 3300042531 Bacteria 25679
456 Ga0466969_0026992 3300044656 Bacteria 2942
457 Ga0466972_0000265 3300044658 Bacteria 33659
458 Ga0466965_0033940 3300044683 Bacteria 2495
459 Ga0466961_0078111 3300044693 Bacteria 2096
460 Ga0466963_0141919 3300044694 Bacteria 1664
461 Ga0466964_0034414 3300044706 Bacteria 2022
462 Ga0453684_0026989 3300044712 Bacteria 8265
463 Ga0453684_0064995 3300044712 Bacteria 4655
464 Ga0453684_0112233 3300044712 Bacteria 3309
465 Ga0451576_0138829 3300045051 Bacteria 2535
466 Ga0451576_0183069 3300045051 Bacteria 2187
467 Ga0495592_0000264 3300046454 Bacteria 44823
468 Ga0495590_0010873 3300046457 Bacteria 3411
469 Ga0495629_0209215 3300046459 Bacteria 1347
470 Ga0495650_0003658 3300046471 Bacteria 11034
471 Ga0495580_0026613 3300046472 Bacteria 4217
472 Ga0495610_0029434 3300046512 Bacteria 2892
473 Ga0495628_0092880 3300046516 Bacteria 2334
474 Ga0495630_0060395 3300046517 Bacteria 2845
475 Ga0495632_0016647 3300046519 Bacteria 4082
476 Ga0495643_0032666 3300046522 Bacteria 2886
477 Ga0495654_0000516 3300046530 Bacteria 31438
478 Ga0495586_0019238 3300046535 Bacteria 3632
479 Ga0495597_0002730 3300046542 Bacteria 10887
480 Ga0495645_0022876 3300046543 Bacteria 4524
481 Ga0495625_0001732 3300046660 Bacteria 25240
482 Ga0495625_0015914 3300046660 Bacteria 5935
483 Ga0495646_0062030 3300046680 Bacteria 2224
484 Ga0495658_0010196 3300046683 Bacteria 4697
485 Ga0495613_0138638 3300046689 Bacteria 1739
486 Ga0495624_0071105 3300046690 Bacteria 2165
487 Ga0495672_0000050 3300047320 Bacteria 240336
488 Ga0495687_000212 3300047443 Bacteria 83406
489 Ga0495687_003075 3300047443 Bacteria 12505
490 Ga0495687_003785 3300047443 Bacteria 10682
491 Ga0495684_0050709 3300047471 Bacteria 3168
492 Ga0495686_0000641 3300047472 Bacteria 48207
493 Ga0495686_0058528 3300047472 Bacteria 2402
494 Ga0496102_0078226 3300048905 Bacteria 3045
495 Ga0496105_0091185 3300048908 Bacteria 2517
496 Ga0496106_0010687 3300048909 Bacteria 6784
497 Ga0496106_0076197 3300048909 Bacteria 2571
498 Ga0496110_0008007 3300048913 Bacteria 8469
499 Ga0496115_0078134 3300048918 Bacteria 2692
500 Ga0496121_0008194 3300048924 Bacteria 12405
501 Ga0496124_0000344 3300048927 Bacteria 85082
502 Ga0496124_0012761 3300048927 Bacteria 8260
503 Ga0496124_0015117 3300048927 Bacteria 7419
504 Ga0501305_000068 3300049161 Bacteria 5911
505 Ga0501292_004968 3300049515 Bacteria 1839
506 Ga0501298_003312 3300049521 Bacteria 2495
507 Ga0501300_001358 3300049523 Bacteria 3681
508 Ga0501043_0000004 3300049579 Bacteria 291085
509 Ga0501046_0000016 3300049580 Bacteria 234374
510 Ga0501047_0000012 3300049581 Bacteria 368824
511 Ga0501048_0000091 3300049582 Bacteria 48347
512 Ga0501206_002529 3300049653 Bacteria 2306
513 Ga0501211_000635 3300049658 Bacteria 3528
514 Ga0501222_000024 3300049662 Bacteria 65412
515 Ga0501222_004661 3300049662 Bacteria 1863
516 Ga0501235_003288 3300049669 Bacteria 3491
517 Ga0501253_004819 3300049683 Bacteria 1729
518 Ga0501221_000027 3300049704 Bacteria 14687
519 Ga0501225_0022447 3300049705 Bacteria 1742
520 Ga0501229_000431 3300049706 Bacteria 4718
521 Ga0501267_000778 3300049764 Bacteria 2577
522 Ga0501035_0029856 3300049822 Bacteria 4972
523 Ga0501045_0013429 3300049824 Bacteria 5786
524 nmdc:mga03683_37254_c1 3300050489 Bacteria 1981
525 nmdc:mga03683_39250_c1 3300050489 Bacteria 1938
526 nmdc:mga03683_68196_c1 3300050489 Bacteria 1516
527 nmdc:mga0k408_107382_c1 3300050493 Bacteria 1649
528 nmdc:mga0k408_1421_c1 3300050493 Bacteria 12955
529 nmdc:mga0k408_16204_c1 3300050493 Bacteria 4133
530 nmdc:mga0k408_22310_c1 3300050493 Bacteria 3564
531 nmdc:mga0k408_3190_c1 3300050493 Bacteria 8684
532 nmdc:mga0k408_48625_c1 3300050493 Bacteria 2454
533 nmdc:mga0k408_6350_c1 3300050493 Bacteria 6308
534 nmdc:mga0k408_97_c1 3300050493 Bacteria 42090
535 nmdc:mga06z11_11465_c1 3300050494 Bacteria 3823
536 nmdc:mga06z11_6048_c1 3300050494 Bacteria 4896
537 nmdc:mga04h51_22694_c1 3300050495 Bacteria 1902
538 nmdc:mga07m45_128758_c1 3300050496 Bacteria 1464
539 nmdc:mga07m45_2013_c1 3300050496 Bacteria 9419
540 nmdc:mga07m45_35720_c1 3300050496 Bacteria 2765
541 nmdc:mga07m45_436_c1 3300050496 Bacteria 17330
542 nmdc:mga0qj67_66267_c1 3300050509 Bacteria 2876
543 nmdc:mga0sz30_1897_c1 3300050516 Bacteria 7459
544 nmdc:mga0sz30_69153_c1 3300050516 Bacteria 1518
545 Ga0495601_0056299 3300053077 Bacteria 2490
546 Ga0495595_0094799 3300053084 Bacteria 1435
547 Ga0500578_0015510 3300053086 Bacteria 4895
548 Ga0500644_0001801 3300053088 Bacteria 5541
549 Ga0500651_0053288 3300053093 Bacteria 2537
550 Ga0500594_0001873 3300053118 Bacteria 4558
551 Ga0500559_0000092 3300053136 Bacteria 71917
552 Ga0500559_0003760 3300053136 Bacteria 7368
553 Ga0500568_0035385 3300053139 Bacteria 2038
554 Ga0500590_003152 3300053148 Bacteria 7532
555 Ga0500619_000010 3300053154 Bacteria 61024
556 Ga0500622_0000874 3300053156 Bacteria 25654
557 Ga0500645_003193 3300053730 Bacteria 6810
558 Ga0590071_012821 3300059421 Bacteria 1964
559 Ga0587111_0006455 3300060346 Bacteria 1861
560 2548501270 2547132374 Bacteria 5530232
561 2548848047 2547132512 Bacteria 3416496
562 2587756222 2585428062 Bacteria 6842168
563 2643746408 2643221544 Bacteria 5886209
564 2643868490 2643221570 Bacteria 5103772
565 2643933116 2643221585 Bacteria 5812563
566 2643994597 2643221596 Bacteria 5006805
567 2644061645 2643221609 Bacteria 6756331
568 2644217258 2643221639 Bacteria 6649903
569 2644243743 2643221644 Bacteria 6865017
570 2644258974 2643221646 Bacteria 6433402
571 2644295442 2643221652 Bacteria 5140275
572 2644314365 2643221656 Bacteria 5809961
573 2644649186 2643221717 Bacteria 5676132
574 2739055707 2738541337 Bacteria 6183410
575 2831866167 2831864461 Bacteria 6502356
576 2904548214 2904541872 Bacteria 8915136
577 2928116051 2928115317 Bacteria 6477646
578 2929163204 2929160207 Bacteria 9075316
579 2990715527 2990710928 Bacteria 5002431
580 Ga0307414_10008246
581 JGI24740J21852_10020646
582 JGI25156J39149_1000563
583 JGI25154J39366_1000824
584 JGI25157J39369_1000027
585 rootH1_10009659
586 rootL2_10003861
587 rootL2_10009273
588 rootH1_10007051
589 rootH1_10019349
590 Ga0055533_1000073
591 Ga0055525_1000038
592 Ga0055525_1000687
593 Ga0055535_1000229
594 Ga0055529_1000064
595 Ga0055526_1002388
596 Ga0055524_1000811
597 Ga0055524_1003733
598 Ga0055524_1013243
599 Ga0055530_10001410
600 Ga0055540_1000014
601 Ga0055531_10000043
602 Ga0055531_10005944
603 Ga0055543_1002234
604 Ga0065165_1000283
605 Ga0065165_1000732
606 Ga0070676_10018129
607 Ga0070676_10047868
608 Ga0070683_100070724
609 Ga0070670_100000850
610 Ga0070670_100075432
611 Ga0070670_100103546
612 Ga0070677_10006469
613 Ga0068869_100001930
614 Ga0068869_100005265
615 Ga0068869_100007786
616 Ga0068869_100040612
617 Ga0068869_100286523
618 Ga0070666_10001417
619 Ga0070680_100125842
620 Ga0068868_100005488
621 Ga0068868_100007503
622 Ga0068868_100018596
623 Ga0068868_100137821
624 Ga0070689_100007461
625 Ga0070661_100000220
626 Ga0070661_100004395
627 Ga0070661_100108429
628 Ga0070668_100114886
629 Ga0070669_100004026
630 Ga0070669_100266408
631 Ga0070675_100002378
632 Ga0070675_100005838
633 Ga0070675_100010712
634 Ga0070675_100074646
635 Ga0070671_100001602
636 Ga0070671_100048779
637 Ga0070671_100066546
638 Ga0070671_100249551
639 Ga0070674_100023104
640 Ga0070674_100160670
641 Ga0070673_100005543
642 Ga0070673_100031127
643 Ga0070673_100094350
644 Ga0070673_100121359
645 Ga0070688_100068611
646 Ga0070688_100106521
647 Ga0070659_100011721
648 Ga0070659_100025954
649 Ga0070659_100040856
650 Ga0070667_100000700
651 Ga0070667_100009105
652 Ga0070667_100047152
653 Ga0070667_100133250
654 Ga0070667_100341366
655 Ga0070663_100000511
656 Ga0070678_100000433
657 Ga0070678_100007186
658 Ga0070662_100003680
659 Ga0070662_100006117
660 Ga0070662_100021310
661 Ga0070662_100190549
662 Ga0068867_100000790
663 Ga0068867_100018436
664 Ga0068867_100130503
665 Ga0070706_100005275
666 Ga0070706_100272100
667 Ga0070684_100047218
668 Ga0068853_100115148
669 Ga0070672_100009309
670 Ga0070672_100032098
671 Ga0070672_100153876
672 Ga0070672_100177767
673 Ga0070672_100239859
674 Ga0070686_100065311
675 Ga0070693_100061269
676 Ga0070665_100009189
677 Ga0070665_100010362
678 Ga0070665_100094661
679 Ga0070664_100000267
680 Ga0070664_100014574
681 Ga0070664_100295237
682 Ga0068857_100050441
683 Ga0068857_100089978
684 Ga0068857_100175497
685 Ga0068854_100024301
686 Ga0068854_100294446
687 Ga0068856_100002053
688 Ga0068856_100053763
689 Ga0068856_100097786
690 Ga0068856_100173849
691 Ga0070702_100070293
692 Ga0068852_100029460
693 Ga0068852_100034194
694 Ga0068852_100083629
695 Ga0068852_100087670
696 Ga0068852_100175936
697 Ga0068852_100222056
698 Ga0068859_100003363
699 Ga0068859_100025954
700 Ga0068864_100001169
701 Ga0068864_100009554
702 Ga0068866_10004218
703 Ga0068861_100002761
704 Ga0068861_100012081
705 Ga0068851_10016166
706 Ga0068863_100003087
707 Ga0068863_100017354
708 Ga0068863_100127723
709 Ga0068863_100241801
710 Ga0068858_100001403
711 Ga0068858_100016272
712 Ga0068858_100026308
713 Ga0068858_100041047
714 Ga0068858_100089488
715 Ga0068860_100003047
716 Ga0068860_100040000
717 Ga0068860_100107276
718 Ga0068862_100006386
719 Ga0068862_100050001
720 Ga0075365_10064112
721 Ga0075368_10012650
722 Ga0075363_100058403
723 Ga0075364_10062334
724 Ga0075362_10039634
725 Ga0075362_10072100
726 Ga0075367_10010627
727 Ga0075369_10073347
728 Ga0075366_10000057
729 Ga0075366_10006397
730 Ga0075366_10008679
731 Ga0075366_10022149
732 Ga0075366_10023870
733 Ga0075366_10074715
734 Ga0097621_100010488
735 Ga0075370_10001735
736 Ga0075370_10011833
737 Ga0075370_10086420
738 Ga0068871_100020919
739 Ga0068871_100023965
740 Ga0068871_100054655
741 Ga0068865_100055161
742 Ga0068865_100102466
743 Ga0097620_100003363
744 Ga0097620_100025956
745 Ga0099823_1000083
746 Ga0079104_1000013
747 Ga0105240_10015301
748 Ga0105243_10002845
749 Ga0105243_10031064
750 Ga0105243_10072980
751 Ga0105243_10297918
752 Ga0105243_10317003
753 Ga0105241_10140065
754 Ga0105248_10009574
755 Ga0105248_10260997
756 Ga0105248_10339165
757 Ga0105248_10351456
758 Ga0105248_10378446
759 Ga0105237_10000441
760 Ga0105237_10014405
761 Ga0105237_10091316
762 Ga0105238_10009732
763 Ga0105249_10004602
764 Ga0105249_10110718
765 Ga0105239_10000417
766 Ga0105239_10037326
767 Ga0105239_10404132
768 Ga0105246_10015911
769 Ga0157319_1000037
770 Ga0157371_10215441
771 Ga0157369_10016240
772 Ga0157374_10027953
773 Ga0157374_10039209
774 Ga0157374_10060407
775 Ga0157374_10190929
776 Ga0157378_10433601
777 Ga0157372_10012500
778 Ga0157372_10075980
779 Ga0157375_10014622
780 Ga0157375_10068827
781 Ga0157375_10074029
782 Ga0157380_10096418
783 Ga0157377_10000091
784 Ga0157379_10014441
785 Ga0157379_10045749
786 Ga0157379_10073834
787 Ga0157379_10166132
788 Ga0157376_10130254
789 Ga0163161_10053626
790 Ga0163161_10076498
791 Ga0163161_10158902
792 Ga0163161_10198636
793 Ga0213872_10005532
794 Ga0209674_100039
795 Ga0209563_100005
796 Ga0209563_100110
797 Ga0207427_101215
798 Ga0209258_100124
799 Ga0209646_1000196
800 Ga0209026_1000011
801 Ga0209677_100151
802 Ga0209677_100488
803 Ga0209759_1000107
804 Ga0209759_1000652
805 Ga0209759_1000898
806 Ga0209759_1002444
807 Ga0209455_1000114
808 Ga0209673_1004315
809 Ga0209675_1018130
810 Ga0209025_1000073
811 Ga0209564_1000003
812 Ga0209050_1000142
813 Ga0209050_1002548
814 Ga0209256_1000130
815 Ga0209256_1000471
816 Ga0209256_1000967
817 Ga0209051_1000035
818 Ga0209051_1006920
819 Ga0209051_1045439
820 Ga0209257_1000049
821 Ga0209257_1000346
822 Ga0209257_1001013
823 Ga0209257_1001664
824 Ga0207697_10005656
825 Ga0207697_10025489
826 Ga0207656_10051584
827 Ga0207682_10012069
828 Ga0207682_10069737
829 Ga0207642_10005296
830 Ga0207688_10039783
831 Ga0207680_10002275
832 Ga0207645_10022078
833 Ga0207643_10103874
834 Ga0207705_10161489
835 Ga0207684_10002424
836 Ga0207684_10225612
837 Ga0207695_10023628
838 Ga0207695_10024383
839 Ga0207695_10041056
840 Ga0207671_10010439
841 Ga0207662_10009825
842 Ga0207657_10067987
843 Ga0207657_10069336
844 Ga0207649_10004236
845 Ga0207649_10023503
846 Ga0207649_10078383
847 Ga0207646_10038725
848 Ga0207694_10022050
849 Ga0207694_10047792
850 Ga0207650_10001495
851 Ga0207650_10002662
852 Ga0207650_10009201
853 Ga0207650_10088991
854 Ga0207659_10000197
855 Ga0207659_10002339
856 Ga0207659_10063764
857 Ga0207659_10096641
858 Ga0207687_10091982
859 Ga0207687_10100803
860 Ga0207687_10181671
861 Ga0207644_10003455
862 Ga0207644_10035491
863 Ga0207644_10051476
864 Ga0207644_10053618
865 Ga0207644_10054586
866 Ga0207690_10034111
867 Ga0207690_10040139
868 Ga0207706_10000993
869 Ga0207706_10001576
870 Ga0207706_10032969
871 Ga0207706_10094816
872 Ga0207686_10235319
873 Ga0207709_10004566
874 Ga0207670_10022716
875 Ga0207670_10070544
876 Ga0207669_10022258
877 Ga0207669_10105420
878 Ga0207669_10141322
879 Ga0207704_10040992
880 Ga0207704_10151029
881 Ga0207704_10156901
882 Ga0207665_10132413
883 Ga0207691_10004989
884 Ga0207691_10020851
885 Ga0207691_10021708
886 Ga0207691_10087692
887 Ga0207691_10142238
888 Ga0207691_10201285
889 Ga0207691_10240515
890 Ga0207711_10027239
891 Ga0207711_10402120
892 Ga0207689_10000855
893 Ga0207689_10003648
894 Ga0207689_10009091
895 Ga0207689_10037021
896 Ga0207661_10074747
897 Ga0207679_10000486
898 Ga0207679_10150701
899 Ga0207667_10022793
900 Ga0207651_10001363
901 Ga0207651_10040929
902 Ga0207651_10045110
903 Ga0207712_10056510
904 Ga0207668_10096253
905 Ga0207640_10050526
906 Ga0207640_10124031
907 Ga0207658_10000584
908 Ga0207658_10003965
909 Ga0207658_10005437
910 Ga0207677_10000523
911 Ga0207677_10005674
912 Ga0207703_10000325
913 Ga0207703_10040823
914 Ga0207639_10136479
915 Ga0207678_10005512
916 Ga0207678_10013887
917 Ga0207678_10057494
918 Ga0207708_10113761
919 Ga0207702_10000356
920 Ga0207702_10057280
921 Ga0207641_10001571
922 Ga0207641_10011281
923 Ga0207641_10025455
924 Ga0207641_10039655
925 Ga0207641_10114321
926 Ga0207648_10000264
927 Ga0207648_10001338
928 Ga0207648_10002162
929 Ga0207648_10251273
930 Ga0207648_10297248
931 Ga0207676_10000490
932 Ga0207676_10005347
933 Ga0207676_10013103
934 Ga0207674_10029541
935 Ga0207674_10071817
936 Ga0207674_10093960
937 Ga0207674_10414113
938 Ga0207675_100000911
939 Ga0207675_100008377
940 Ga0207675_100023015
941 Ga0207683_10008423
942 Ga0207683_10095657
943 Ga0207683_10125186
944 Ga0207683_10173044
945 Ga0207683_10382777
946 Ga0207698_10064480
947 Ga0207698_10225598
948 Ga0207698_10345914
949 Ga0209281_1000076
950 Ga0209389_1005358
951 Ga0209970_1000205
952 Ga0209974_10019225
953 Ga0209974_10021631
954 Ga0268266_10004766
955 Ga0268266_10108331
956 Ga0268265_10123854
957 Ga0268264_10002108
958 Ga0268264_10067248
959 Ga0268264_10088476
960 Ga0268264_10270055
961 Ga0265336_10000022
962 Ga0307515_10000232
963 Ga0307515_10000626
964 Ga0307515_10003007
965 Ga0307515_10027050
966 Ga0307515_10031847
967 Ga0307515_10087591
968 Ga0307515_10121617
969 Ga0307512_10037626
970 Ga0265330_10000045
971 Ga0265332_10000010
972 Ga0265332_10000031
973 Ga0265332_10000220
974 Ga0265325_10000849
975 Ga0265331_10005247
976 Ga0265331_10010489
977 Ga0265327_10000028
978 Ga0265327_10000065
979 Ga0307513_10001541
980 Ga0307509_10002982
981 Ga0307509_10018801
982 Ga0307408_100000160
983 Ga0307408_100174270
984 Ga0307508_10001328
985 Ga0307508_10094116
986 Ga0307514_10000965
987 Ga0307514_10006184
988 Ga0307514_10047979
989 Ga0265314_10000095
990 Ga0307516_10000705
991 Ga0307516_10001481
992 Ga0307516_10172539
993 Ga0307406_10021649
994 Ga0307412_10305626
995 Ga0307409_100002804
996 Ga0307409_100044192
997 Ga0307416_100001904
998 Ga0307411_10098498
999 Ga0307415_100002488
1000 Ga0307415_100025039
1001 Ga0307510_10007541
1002 Ga0307510_10010166
1003 Ga0307510_10123859
1004 Ga0373950_0000951
1005 Ga0373932_0003452
1006 Ga0373939_0000327
1007 Ga0373939_0007608
1008 Ga0373945_0047048
1009 Ga0373960_0011647
1010 Ga0373931_0000429
1011 Ga0373931_0001365
1012 Ga0373931_0035651
1013 Ga0373937_0011428
1014 Ga0373937_0107300
1015 Ga0373925_0007028
1016 Ga0395900_0000025
1017 Ga0395898_0001478
1018 Ga0395905_0000460
1019 Ga0395905_0022908
1020 Ga0395905_0028216
1021 Ga0395901_0004869
1022 Ga0436365_1928031
1023 Ga0436361_0237090
1024 Ga0436361_0677882
1025 Ga0436363_0109176
1026 Ga0451789_0025616
1027 Ga0450911_000124
1028 Ga0450919_000447
1029 Ga0450923_001314
1030 Ga0450891_000198
1031 Ga0450892_002384
1032 Ga0450889_000024
1033 Ga0439459_0001598
1034 Ga0450918_000044
1035 Ga0466969_0026992
1036 Ga0466972_0000265
1037 Ga0466965_0033940
1038 Ga0466961_0078111
1039 Ga0466963_0141919
1040 Ga0466964_0034414
1041 Ga0453684_0026989
1042 Ga0453684_0064995
1043 Ga0453684_0112233
1044 Ga0451576_0138829
1045 Ga0451576_0183069
1046 Ga0495592_0000264
1047 Ga0495590_0010873
1048 Ga0495629_0209215
1049 Ga0495650_0003658
1050 Ga0495580_0026613
1051 Ga0495610_0029434
1052 Ga0495628_0092880
1053 Ga0495630_0060395
1054 Ga0495632_0016647
1055 Ga0495643_0032666
1056 Ga0495654_0000516
1057 Ga0495586_0019238
1058 Ga0495597_0002730
1059 Ga0495645_0022876
1060 Ga0495625_0001732
1061 Ga0495625_0015914
1062 Ga0495646_0062030
1063 Ga0495658_0010196
1064 Ga0495613_0138638
1065 Ga0495624_0071105
1066 Ga0495672_0000050
1067 Ga0495687_000212
1068 Ga0495687_003075
1069 Ga0495687_003785
1070 Ga0495684_0050709
1071 Ga0495686_0000641
1072 Ga0495686_0058528
1073 Ga0496102_0078226
1074 Ga0496105_0091185
1075 Ga0496106_0010687
1076 Ga0496106_0076197
1077 Ga0496110_0008007
1078 Ga0496115_0078134
1079 Ga0496121_0008194
1080 Ga0496124_0000344
1081 Ga0496124_0012761
1082 Ga0496124_0015117
1083 Ga0501305_000068
1084 Ga0501292_004968
1085 Ga0501298_003312
1086 Ga0501300_001358
1087 Ga0501043_0000004
1088 Ga0501046_0000016
1089 Ga0501047_0000012
1090 Ga0501048_0000091
1091 Ga0501206_002529
1092 Ga0501211_000635
1093 Ga0501222_000024
1094 Ga0501222_004661
1095 Ga0501235_003288
1096 Ga0501253_004819
1097 Ga0501221_000027
1098 Ga0501225_0022447
1099 Ga0501229_000431
1100 Ga0501267_000778
1101 Ga0501035_0029856
1102 Ga0501045_0013429
1103 nmdc:mga03683_37254_c1
1104 nmdc:mga03683_39250_c1
1105 nmdc:mga03683_68196_c1
1106 nmdc:mga0k408_107382_c1
1107 nmdc:mga0k408_1421_c1
1108 nmdc:mga0k408_16204_c1
1109 nmdc:mga0k408_22310_c1
1110 nmdc:mga0k408_3190_c1
1111 nmdc:mga0k408_48625_c1
1112 nmdc:mga0k408_6350_c1
1113 nmdc:mga0k408_97_c1
1114 nmdc:mga06z11_11465_c1
1115 nmdc:mga06z11_6048_c1
1116 nmdc:mga04h51_22694_c1
1117 nmdc:mga07m45_128758_c1
1118 nmdc:mga07m45_2013_c1
1119 nmdc:mga07m45_35720_c1
1120 nmdc:mga07m45_436_c1
1121 nmdc:mga0qj67_66267_c1
1122 nmdc:mga0sz30_1897_c1
1123 nmdc:mga0sz30_69153_c1
1124 Ga0495601_0056299
1125 Ga0495595_0094799
1126 Ga0500578_0015510
1127 Ga0500644_0001801
1128 Ga0500651_0053288
1129 Ga0500594_0001873
1130 Ga0500559_0000092
1131 Ga0500559_0003760
1132 Ga0500568_0035385
1133 Ga0500590_003152
1134 Ga0500619_000010
1135 Ga0500622_0000874
1136 Ga0500645_003193
1137 Ga0590071_012821
1138 Ga0587111_0006455
1139 2548501270
1140 2548848047
1141 2587756222
1142 2643746408
1143 2643868490
1144 2643933116
1145 2643994597
1146 2644061645
1147 2644217258
1148 2644243743
1149 2644258974
1150 2644295442
1151 2644314365
1152 2644649186
1153 2739055707
1154 2831866167
1155 2904548214
1156 2928116051
1157 2929163204
1158 2990715527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02119

FlgI

Flagellar P-ring protein

76

417

0.98

Map