F465568

General Info

Members Datasets Scaffolds Average Seq Length
576 418 1152 206

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2824600985|2824607987
Length 244
Sequence NLSNLLTDLIEVMISSVTCQLPFERLLSWRLSANAQDPMTRPPAMFIADSLGLDFLNSVATPVDTPVDWLDDGDGLIDWLAQARLVPADVLEALKMRAKPGELDEVADEARALREWFRAFVRRHAGRRLAEDALRELGPLNSLLERDEVFGRIAAASDDGDHVLALRPTRRWRSPGSLLLPIGEALAKFVCDEDFADVKACEGHNCTMLFADHTRRRARRWCTMAICGNRAKQAAHRSRLKNRQ

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
68 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
93 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
94 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
95 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
142 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
143 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
150 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
279 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
280 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
284 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
287 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
290 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
291 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
292 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
298 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
299 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
300 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
301 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
302 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
303 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
304 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
305 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
308 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
309 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
313 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
314 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
315 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
316 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
317 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
318 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
319 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
320 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
321 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
322 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
323 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
324 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
325 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
326 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
327 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
328 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
329 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
330 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
331 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
332 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
333 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
334 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
335 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
336 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
337 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
338 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
339 2831864461 Roseateles noduli HZ7 Isolate Nodule
340 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
341 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
342 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
343 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
344 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
345 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
346 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
347 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
348 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
349 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
350 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
351 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
352 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
353 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
354 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
355 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
356 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
357 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
358 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
359 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
360 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
361 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
362 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
363 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
364 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
365 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
366 2904699407
367 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
368 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
369 2906610324
370 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
371 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
372 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
373 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
374 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
375 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
376 2919404418 Luteibacter sp. 3190 Isolate Unclassified
377 2922425934
378 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
379 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
380 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
381 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
382 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
383 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
384 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
385 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
386 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
387 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
388 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
389 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
390 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
391 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
392 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
393 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
394 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
395 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
396 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
397 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
398 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
399 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
400 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
401 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
402 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
403 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
404 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
405 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
406 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
407 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
408 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
409 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
410 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
411 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
412 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
413 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
414 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
415 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
416 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
417 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
418 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.33
Metatranscriptomes 0.35
Isolates 18.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.31
Nodule 14.76
Rhizoplane 3.3
Rhizosphere 50.52
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10036235 3300002067 Bacteria 1447
2 JGI25159J45721_1000321 3300002987 Bacteria 22253
3 JGI25165J46597_1006260 3300003214 Bacteria 2132
4 JGI25153J46596_10000758 3300003215 Bacteria 19728
5 JGI25153J46596_10002902 3300003215 Bacteria 9725
6 rootH2_10002064 3300003320 Bacteria 3308
7 rootL2_10060534 3300003322 Bacteria 1147
8 rootL2_10228413 3300003322 Bacteria 3086
9 JGI25160J50197_1000023 3300003354 Bacteria 200692
10 JGI25161J50226_1000012 3300003374 Bacteria 200668
11 JGI25161J50226_1016542 3300003374 Bacteria 788
12 Ga0006562J51391_1034330 3300003578 Bacteria 17510
13 Ga0006562J51391_1034334 3300003578 Bacteria 4230
14 JGI25404J52841_10012376 3300003659 Bacteria 1847
15 Ga0055539_1010049 3300003752 Bacteria 1173
16 Ga0055526_1000193 3300003771 Bacteria 53165
17 Ga0055537_1000060 3300003773 Bacteria 79376
18 Ga0055524_1011325 3300003775 Bacteria 3497
19 Ga0055524_1018953 3300003775 Bacteria 2369
20 Ga0055534_1000009 3300003784 Bacteria 210256
21 Ga0055528_1000012 3300003790 Bacteria 182704
22 Ga0055531_10006861 3300003794 Bacteria 6347
23 Ga0055531_10020350 3300003794 Bacteria 2627
24 Ga0055543_1000009 3300004625 Bacteria 200706
25 Ga0065165_1000064 3300005262 Bacteria 175153
26 Ga0065165_1003855 3300005262 Bacteria 9959
27 Ga0065165_1008389 3300005262 Bacteria 4847
28 Ga0065165_1041967 3300005262 Bacteria 1354
29 Ga0070658_10026341 3300005327 Bacteria 4664
30 Ga0070658_10079618 3300005327 Bacteria 2691
31 Ga0070680_100592523 3300005336 Bacteria 951
32 Ga0070682_100021438 3300005337 Bacteria 3813
33 Ga0068868_100064188 3300005338 Bacteria 2915
34 Ga0070660_100080334 3300005339 Bacteria 2559
35 Ga0070661_100248499 3300005344 Bacteria 1372
36 Ga0070669_100369427 3300005353 Bacteria 1168
37 Ga0070659_100529618 3300005366 Bacteria 1007
38 Ga0070667_100045988 3300005367 Bacteria 3671
39 Ga0070667_100697049 3300005367 Bacteria 940
40 Ga0070703_10031172 3300005406 Bacteria 1611
41 Ga0070713_100107530 3300005436 Bacteria 2427
42 Ga0070713_100603362 3300005436 Bacteria 1043
43 Ga0070710_10178781 3300005437 Bacteria 1327
44 Ga0070711_100731196 3300005439 Bacteria 835
45 Ga0070705_100354365 3300005440 Bacteria 1071
46 Ga0070663_100204499 3300005455 Bacteria 1543
47 Ga0070662_100301172 3300005457 Bacteria 1303
48 Ga0070681_10000451 3300005458 Bacteria 33589
49 Ga0070706_100375754 3300005467 Bacteria 1324
50 Ga0070707_100234805 3300005468 Bacteria 1785
51 Ga0070707_100570334 3300005468 Bacteria 1094
52 Ga0070698_100040971 3300005471 Bacteria 4757
53 Ga0070699_100505457 3300005518 Bacteria 1098
54 Ga0070679_100029654 3300005530 Bacteria 5397
55 Ga0070679_100032323 3300005530 Bacteria 5175
56 Ga0070697_100092973 3300005536 Bacteria 2496
57 Ga0068853_100308278 3300005539 Bacteria 1465
58 Ga0070665_100076892 3300005548 Bacteria 3344
59 Ga0070665_100323818 3300005548 Bacteria 1546
60 Ga0068855_100401229 3300005563 Bacteria 1502
61 Ga0068854_100429754 3300005578 Bacteria 1099
62 Ga0068856_100026430 3300005614 Bacteria 5661
63 Ga0068856_100153679 3300005614 Bacteria 2311
64 Ga0068856_100363534 3300005614 Bacteria 1466
65 Ga0068852_100183266 3300005616 Bacteria 1970
66 Ga0068852_100843725 3300005616 Bacteria 932
67 Ga0068859_100994104 3300005617 Bacteria 921
68 Ga0068864_101076603 3300005618 Bacteria 799
69 Ga0068863_100809469 3300005841 Bacteria 935
70 Ga0068858_100118578 3300005842 Bacteria 2474
71 Ga0068858_100687273 3300005842 Bacteria 995
72 Ga0081540_1000611 3300005983 Bacteria 34020
73 Ga0075365_10076302 3300006038 Bacteria 2263
74 Ga0075365_10114978 3300006038 Bacteria 1852
75 Ga0075365_10172513 3300006038 Bacteria 1510
76 Ga0075368_10007563 3300006042 Bacteria 3835
77 Ga0075363_100010826 3300006048 Bacteria 4349
78 Ga0075364_10260429 3300006051 Bacteria 1179
79 Ga0070716_100224951 3300006173 Bacteria 1263
80 Ga0070712_100005515 3300006175 Bacteria 7833
81 Ga0070712_100551799 3300006175 Bacteria 971
82 Ga0075362_10070000 3300006177 Bacteria 1601
83 Ga0075367_10012855 3300006178 Bacteria 4482
84 Ga0075367_10371156 3300006178 Bacteria 904
85 Ga0075369_10011152 3300006186 Bacteria 3529
86 Ga0075369_10097331 3300006186 Bacteria 1318
87 Ga0075369_10122079 3300006186 Bacteria 1180
88 Ga0075366_10048803 3300006195 Bacteria 2511
89 Ga0075366_10064644 3300006195 Bacteria 2176
90 Ga0075370_10032291 3300006353 Bacteria 2926
91 Ga0075370_10135127 3300006353 Bacteria 1440
92 Ga0075434_100330182 3300006871 Bacteria 1546
93 Ga0075434_100642969 3300006871 Bacteria 1079
94 Ga0075434_100868833 3300006871 Bacteria 917
95 Ga0097620_100994166 3300006931 Bacteria 921
96 Ga0099825_1031415 3300006941 Bacteria 2253
97 Ga0099823_1043159 3300006944 Bacteria 3124
98 Ga0075435_100152675 3300007076 Bacteria 1942
99 Ga0099794_10001423 3300007265 Bacteria 8382
100 Ga0099794_10021711 3300007265 Bacteria 2919
101 Ga0099795_10000811 3300007788 Bacteria 6174
102 Ga0099795_10001295 3300007788 Bacteria 5330
103 Ga0099795_10005869 3300007788 Bacteria 3305
104 Ga0105240_10067121 3300009093 Bacteria 4447
105 Ga0105240_10509122 3300009093 Bacteria 1337
106 Ga0105247_10026879 3300009101 Bacteria 3478
107 Ga0114129_11226700 3300009147 Bacteria 933
108 Ga0105241_10039028 3300009174 Bacteria 3581
109 Ga0105242_10658301 3300009176 Bacteria 1019
110 Ga0105248_10141072 3300009177 Bacteria 2718
111 Ga0105237_10040734 3300009545 Bacteria 4685
112 Ga0105237_10817931 3300009545 Bacteria 938
113 Ga0105238_10009627 3300009551 Bacteria 9668
114 Ga0105238_10108054 3300009551 Bacteria 2763
115 Ga0105238_10921075 3300009551 Bacteria 893
116 Ga0099796_10000759 3300010159 Bacteria 5779
117 Ga0099796_10053851 3300010159 Bacteria 1405
118 Ga0099796_10165681 3300010159 Bacteria 879
119 Ga0099796_10169208 3300010159 Unclassified 871
120 Ga0105239_10300463 3300010375 Bacteria 1808
121 Ga0105246_10085961 3300011119 Bacteria 2254
122 Ga0157370_10208768 3300013104 Bacteria 1810
123 Ga0157369_10000848 3300013105 Bacteria 39040
124 Ga0157374_10249119 3300013296 Bacteria 1748
125 Ga0163162_10508813 3300013306 Bacteria 1334
126 Ga0157372_10976336 3300013307 Bacteria 981
127 Ga0157375_10733372 3300013308 Bacteria 1140
128 Ga0163163_10020785 3300014325 Bacteria 6189
129 Ga0157377_10835013 3300014745 Bacteria 683
130 Ga0157379_10563410 3300014968 Bacteria 1061
131 Ga0214544_1000026 3300021320 Bacteria 161530
132 Ga0214542_1000025 3300021321 Bacteria 183588
133 Ga0214545_1000014 3300021324 Bacteria 183588
134 Ga0214543_1000034 3300021327 Bacteria 183712
135 Ga0213872_10000178 3300021361 Bacteria 56792
136 Ga0213872_10006184 3300021361 Bacteria 6044
137 Ga0213872_10006196 3300021361 Bacteria 6039
138 Ga0213872_10006719 3300021361 Bacteria 5732
139 Ga0213872_10007548 3300021361 Bacteria 5344
140 Ga0213872_10140097 3300021361 Bacteria 1062
141 Ga0209677_104422 3300025253 Bacteria 4061
142 Ga0209148_1026300 3300025254 Bacteria 904
143 Ga0209233_1001081 3300025261 Bacteria 11249
144 Ga0209233_1005521 3300025261 Bacteria 4185
145 Ga0209565_1000015 3300025263 Bacteria 494091
146 Ga0209673_1000017 3300025273 Bacteria 492994
147 Ga0209130_1000048 3300025284 Bacteria 233357
148 Ga0209675_1000012 3300025291 Bacteria 494061
149 Ga0209564_1000016 3300025295 Bacteria 613131
150 Ga0209564_1028125 3300025295 Bacteria 1806
151 Ga0209758_1000141 3300025297 Bacteria 172481
152 Ga0209758_1016616 3300025297 Bacteria 3726
153 Ga0209758_1017128 3300025297 Bacteria 3632
154 Ga0209758_1081837 3300025297 Bacteria 974
155 Ga0209050_1009166 3300025298 Bacteria 5116
156 Ga0209256_1000314 3300025299 Bacteria 84164
157 Ga0209256_1000532 3300025299 Bacteria 55253
158 Ga0209256_1008286 3300025299 Bacteria 4856
159 Ga0207426_1000136 3300025302 Bacteria 201401
160 Ga0207426_1001707 3300025302 Bacteria 16860
161 Ga0207426_1066038 3300025302 Bacteria 1024
162 Ga0209051_1049223 3300025303 Bacteria 1421
163 Ga0209257_1000426 3300025304 Bacteria 81095
164 Ga0209257_1000700 3300025304 Bacteria 51955
165 Ga0209257_1017626 3300025304 Bacteria 2800
166 Ga0207692_10249213 3300025898 Bacteria 1064
167 Ga0207710_10059126 3300025900 Bacteria 1735
168 Ga0207647_10006758 3300025904 Bacteria 8324
169 Ga0207705_10024531 3300025909 Bacteria 4303
170 Ga0207684_10306872 3300025910 Bacteria 1368
171 Ga0207654_10059094 3300025911 Bacteria 2235
172 Ga0207707_10002336 3300025912 Bacteria 17082
173 Ga0207695_10296878 3300025913 Bacteria 1507
174 Ga0207695_10476719 3300025913 Bacteria 1130
175 Ga0207693_10002707 3300025915 Bacteria 15361
176 Ga0207693_10049928 3300025915 Bacteria 3286
177 Ga0207663_10071802 3300025916 Bacteria 2235
178 Ga0207663_10607501 3300025916 Unclassified 860
179 Ga0207657_10206621 3300025919 Bacteria 1577
180 Ga0207649_10118805 3300025920 Bacteria 1779
181 Ga0207652_10028653 3300025921 Bacteria 4649
182 Ga0207646_10184878 3300025922 Bacteria 1882
183 Ga0207646_10629477 3300025922 Bacteria 962
184 Ga0207681_10108051 3300025923 Bacteria 2019
185 Ga0207694_10000322 3300025924 Bacteria 45212
186 Ga0207700_10187654 3300025928 Bacteria 1735
187 Ga0207706_10728883 3300025933 Bacteria 846
188 Ga0207665_10260349 3300025939 Bacteria 1285
189 Ga0207711_10471243 3300025941 Bacteria 1169
190 Ga0207689_10649812 3300025942 Bacteria 888
191 Ga0207667_10344340 3300025949 Bacteria 1521
192 Ga0207651_10770092 3300025960 Bacteria 852
193 Ga0207640_10097245 3300025981 Bacteria 2055
194 Ga0207658_10174272 3300025986 Bacteria 1775
195 Ga0207703_10268074 3300026035 Bacteria 1546
196 Ga0207639_10308497 3300026041 Bacteria 1401
197 Ga0207639_10553192 3300026041 Bacteria 1057
198 Ga0207678_10013068 3300026067 Bacteria 7284
199 Ga0207678_10045747 3300026067 Bacteria 3784
200 Ga0207702_10026135 3300026078 Bacteria 4846
201 Ga0207702_10675190 3300026078 Bacteria 1017
202 Ga0207683_10630086 3300026121 Bacteria 993
203 Ga0209389_1000004 3300027296 Bacteria 263759
204 Ga0209489_100295 3300027361 Bacteria 87273
205 Ga0209700_100013 3300027363 Bacteria 341906
206 Ga0209179_1000940 3300027512 Bacteria 3294
207 Ga0209179_1006747 3300027512 Bacteria 1866
208 Ga0209179_1011049 3300027512 Bacteria 1590
209 Ga0209588_1005984 3300027671 Bacteria 3509
210 Ga0209588_1028323 3300027671 Bacteria 1783
211 Ga0268266_10000148 3300028379 Bacteria 135001
212 Ga0268266_10191162 3300028379 Bacteria 1869
213 Ga0268266_10528717 3300028379 Bacteria 1128
214 Ga0268266_10608650 3300028379 Bacteria 1050
215 Ga0307515_10136828 3300028794 Bacteria 2657
216 Ga0307510_10106752 3300033180 Bacteria 2562
217 Ga0307510_10122784 3300033180 Bacteria 2295
218 Ga0315911_1000017 3300033442 Bacteria 161609
219 Ga0316215_1003720 3300033544 Bacteria 1459
220 Ga0373943_0123171 3300035170 Bacteria 1380
221 Ga0373935_0468499 3300035692 Bacteria 912
222 Ga0373927_0102330 3300035695 Bacteria 1863
223 Ga0373927_0160125 3300035695 Bacteria 1474
224 Ga0373927_0161438 3300035695 Bacteria 1468
225 Ga0373947_0100246 3300035725 Bacteria 1819
226 Ga0373947_0325529 3300035725 Bacteria 1028
227 Ga0373937_0014205 3300036401 Bacteria 7026
228 Ga0373925_0803134 3300037068 Bacteria 776
229 Ga0395898_0485615 3300037466 Bacteria 1175
230 Ga0395898_1229904 3300037466 Bacteria 680
231 Ga0395905_0520463 3300037471 Bacteria 1090
232 Ga0436360_0135104 3300039438 Bacteria 1383
233 Ga0436361_0301219 3300039447 Bacteria 7553
234 Ga0436361_0390607 3300039447 Bacteria 4630
235 Ga0436361_0520952 3300039447 Bacteria 6492
236 Ga0436361_0586839 3300039447 Bacteria 9954
237 Ga0436361_0983546 3300039447 Bacteria 5005
238 Ga0436361_1026829 3300039447 Bacteria 6575
239 Ga0436363_0642328 3300039450 Bacteria 10688
240 Ga0436363_1121890 3300039450 Bacteria 1482
241 Ga0451841_0701862 3300041498 Bacteria 1770
242 Ga0466972_0310345 3300044658 Bacteria 737
243 Ga0466964_0248426 3300044706 Bacteria 876
244 Ga0466968_0236991 3300044735 Bacteria 863
245 Ga0466970_0279150 3300044765 Bacteria 939
246 Ga0466957_0231456 3300044842 Bacteria 1223
247 Ga0466960_0214102 3300044901 Bacteria 1058
248 Ga0466959_0016785 3300045049 Bacteria 5357
249 Ga0466959_0058111 3300045049 Bacteria 2818
250 Ga0466958_0072720 3300045836 Unclassified 2106
251 Ga0495592_0095162 3300046454 Bacteria 2131
252 Ga0495603_0023485 3300046455 Bacteria 3730
253 Ga0495629_0059597 3300046459 Bacteria 2668
254 Ga0495629_0061797 3300046459 Bacteria 2617
255 Ga0495629_0064819 3300046459 Bacteria 2550
256 Ga0495638_0002025 3300046460 Bacteria 17254
257 Ga0495641_0151371 3300046461 Bacteria 1037
258 Ga0495651_0017451 3300046462 Bacteria 5558
259 Ga0495651_0049992 3300046462 Bacteria 3226
260 Ga0495651_0090103 3300046462 Bacteria 2301
261 Ga0495651_0283947 3300046462 Bacteria 1117
262 Ga0495653_0532342 3300046463 Bacteria 729
263 Ga0495639_0029192 3300046475 Bacteria 2448
264 Ga0495662_0002818 3300046476 Bacteria 8796
265 Ga0495664_0105995 3300046477 Bacteria 1695
266 Ga0495583_0163927 3300046506 Bacteria 916
267 Ga0495606_0028145 3300046507 Bacteria 3970
268 Ga0495606_0048852 3300046507 Bacteria 2779
269 Ga0495606_0102308 3300046507 Bacteria 1742
270 Ga0495606_0128077 3300046507 Bacteria 1512
271 Ga0495606_0216968 3300046507 Bacteria 1080
272 Ga0495608_0126161 3300046511 Bacteria 1639
273 Ga0495610_0200288 3300046512 Bacteria 818
274 Ga0495616_0267327 3300046513 Bacteria 730
275 Ga0495618_0524527 3300046514 Bacteria 712
276 Ga0495620_0158255 3300046515 Bacteria 881
277 Ga0495643_0016476 3300046522 Bacteria 4340
278 Ga0495643_0022577 3300046522 Bacteria 3589
279 Ga0495643_0247215 3300046522 Bacteria 834
280 Ga0495648_0035711 3300046524 Bacteria 3219
281 Ga0495648_0046103 3300046524 Bacteria 2705
282 Ga0495648_0104658 3300046524 Bacteria 1554
283 Ga0495648_0118870 3300046524 Bacteria 1424
284 Ga0495652_0035489 3300046529 Bacteria 4340
285 Ga0495652_0043201 3300046529 Bacteria 3884
286 Ga0495652_0549251 3300046529 Bacteria 794
287 Ga0495640_0067692 3300046533 Bacteria 2405
288 Ga0495640_0081074 3300046533 Bacteria 2157
289 Ga0495640_0200236 3300046533 Bacteria 1266
290 Ga0495587_0029246 3300046536 Bacteria 3345
291 Ga0495597_0049305 3300046542 Bacteria 1861
292 Ga0495622_0013104 3300046557 Bacteria 3848
293 Ga0495622_0090410 3300046557 Bacteria 1406
294 Ga0495667_0123364 3300046559 Bacteria 1672
295 Ga0495667_0314849 3300046559 Bacteria 991
296 Ga0495656_0245862 3300046615 Bacteria 902
297 Ga0495668_0000101 3300046616 Bacteria 137289
298 Ga0495668_0128396 3300046616 Bacteria 1388
299 Ga0495668_0331181 3300046616 Bacteria 835
300 Ga0495634_0191102 3300046642 Bacteria 1277
301 Ga0495625_0002313 3300046660 Bacteria 20833
302 Ga0495635_0002475 3300046663 Bacteria 12609
303 Ga0495588_0065648 3300046674 Bacteria 1883
304 Ga0495657_0012044 3300046675 Bacteria 6435
305 Ga0495657_0057884 3300046675 Bacteria 2575
306 Ga0495657_0394439 3300046675 Bacteria 815
307 Ga0495599_0029536 3300046678 Bacteria 3437
308 Ga0495599_0116213 3300046678 Bacteria 1664
309 Ga0495623_0034406 3300046679 Bacteria 3249
310 Ga0495623_0121800 3300046679 Bacteria 1570
311 Ga0495646_0091289 3300046680 Bacteria 1758
312 Ga0495646_0267174 3300046680 Bacteria 912
313 Ga0495624_0196133 3300046690 Bacteria 1227
314 Ga0495670_0012075 3300046691 Bacteria 4249
315 Ga0495649_0321625 3300046694 Bacteria 785
316 Ga0495600_0119156 3300046809 Bacteria 1717
317 Ga0495600_0333247 3300046809 Bacteria 952
318 Ga0495581_0041065 3300047315 Bacteria 2677
319 Ga0495604_0007865 3300047317 Bacteria 8441
320 Ga0495604_0036436 3300047317 Bacteria 3878
321 Ga0495604_0108099 3300047317 Bacteria 2032
322 Ga0495604_0152125 3300047317 Bacteria 1643
323 Ga0495604_0445910 3300047317 Bacteria 846
324 Ga0495674_0126935 3300047319 Bacteria 2151
325 Ga0495672_0047816 3300047320 Bacteria 2541
326 Ga0495676_0149635 3300047321 Bacteria 1663
327 Ga0495676_0268401 3300047321 Bacteria 1159
328 Ga0495683_0073607 3300047323 Bacteria 1675
329 Ga0495687_007506 3300047443 Bacteria 6409
330 Ga0495687_077558 3300047443 Bacteria 1312
331 Ga0495675_0041205 3300047444 Bacteria 2943
332 Ga0495684_0273611 3300047471 Bacteria 1221
333 Ga0495686_0001489 3300047472 Bacteria 25384
334 Ga0495686_0093247 3300047472 Bacteria 1826
335 Ga0495686_0101215 3300047472 Bacteria 1737
336 Ga0495686_0113222 3300047472 Bacteria 1625
337 Ga0495593_0025086 3300047673 Bacteria 3299
338 Ga0495602_0033245 3300048088 Bacteria 4841
339 Ga0495602_0249111 3300048088 Bacteria 1325
340 Ga0496100_1021148 3300048903 Bacteria 651
341 Ga0496101_0195578 3300048904 Bacteria 1562
342 Ga0496102_0023434 3300048905 Bacteria 5483
343 Ga0496104_0142870 3300048907 Bacteria 2299
344 Ga0496105_0079017 3300048908 Bacteria 2716
345 Ga0496105_0101334 3300048908 Bacteria 2378
346 Ga0496108_0351351 3300048911 Bacteria 1286
347 Ga0496109_0044539 3300048912 Bacteria 4025
348 Ga0496110_0440817 3300048913 Bacteria 1187
349 Ga0496111_0095467 3300048914 Bacteria 2182
350 Ga0496112_0117039 3300048915 Bacteria 2635
351 Ga0496112_0908842 3300048915 Bacteria 802
352 Ga0496113_0022420 3300048916 Bacteria 4467
353 Ga0496113_0126101 3300048916 Bacteria 2005
354 Ga0496114_0041060 3300048917 Bacteria 3834
355 Ga0496114_0127629 3300048917 Bacteria 2194
356 Ga0496115_0212663 3300048918 Bacteria 1597
357 Ga0496115_0562446 3300048918 Bacteria 910
358 Ga0496116_0165025 3300048919 Bacteria 1209
359 Ga0496118_0046602 3300048921 Bacteria 3370
360 Ga0496119_0013626 3300048922 Bacteria 6453
361 Ga0496119_0354347 3300048922 Bacteria 710
362 Ga0496120_0005798 3300048923 Bacteria 9681
363 Ga0496120_0035479 3300048923 Bacteria 2978
364 Ga0496121_0034371 3300048924 Bacteria 4564
365 Ga0496121_0058023 3300048924 Bacteria 3204
366 Ga0496121_0331885 3300048924 Bacteria 1020
367 Ga0496122_0001093 3300048925 Bacteria 46994
368 Ga0496124_0048014 3300048927 Bacteria 3650
369 Ga0496124_0244465 3300048927 Bacteria 1332
370 Ga0496125_0014853 3300048928 Bacteria 7562
371 Ga0496125_0070734 3300048928 Bacteria 2730
372 Ga0496125_0094346 3300048928 Bacteria 2230
373 Ga0496125_0266694 3300048928 Bacteria 1070
374 Ga0496125_0303318 3300048928 Bacteria 977
375 Ga0496125_0417603 3300048928 Bacteria 779
376 Ga0496126_0066305 3300048929 Bacteria 3228
377 Ga0496126_0326870 3300048929 Bacteria 1259
378 Ga0495678_015393 3300049459 Bacteria 3519
379 Ga0501032_0385153 3300049569 Bacteria 901
380 Ga0501033_0121712 3300049570 Bacteria 1893
381 Ga0501034_0608984 3300049571 Bacteria 997
382 Ga0501036_0045226 3300049572 Bacteria 3730
383 Ga0501037_0193646 3300049573 Bacteria 1439
384 Ga0501038_0029709 3300049574 Bacteria 4840
385 Ga0501043_0009637 3300049579 Bacteria 7570
386 Ga0501043_0071562 3300049579 Bacteria 2724
387 Ga0501046_0060351 3300049580 Bacteria 2967
388 Ga0501046_0133793 3300049580 Bacteria 1879
389 Ga0501047_0597750 3300049581 Bacteria 925
390 Ga0501067_0023552 3300049583 Bacteria 3413
391 Ga0501069_0077293 3300049585 Bacteria 1872
392 Ga0501076_0832741 3300049592 Bacteria 761
393 Ga0501080_0009228 3300049742 Bacteria 8990
394 Ga0501080_0476359 3300049742 Bacteria 1117
395 Ga0501083_0094262 3300049744 Bacteria 1976
396 Ga0501044_0016746 3300049823 Bacteria 7868
397 Ga0501044_0035274 3300049823 Bacteria 5239
398 Ga0501044_0798786 3300049823 Bacteria 823
399 nmdc:mga00v17_103609_c1 3300050491 Bacteria 1386
400 nmdc:mga00v17_76702_c1 3300050491 Bacteria 2080
401 nmdc:mga0yw44_113867_c1 3300050492 Bacteria 1736
402 nmdc:mga0yw44_21645_c1 3300050492 Bacteria 3591
403 nmdc:mga0yw44_316767_c1 3300050492 Bacteria 1047
404 nmdc:mga0k408_61684_c1 3300050493 Bacteria 2180
405 nmdc:mga06z11_326792_c1 3300050494 Bacteria 915
406 nmdc:mga04h51_40676_c1 3300050495 Bacteria 1516
407 nmdc:mga07m45_33801_c1 3300050496 Bacteria 2841
408 nmdc:mga05p37_1360823_c1 3300050507 Bacteria 718
409 nmdc:mga0n895_354035_c1 3300050512 Bacteria 1487
410 nmdc:mga0n895_846434_c1 3300050512 Bacteria 903
411 nmdc:mga0rr50_109010_c1 3300050513 Bacteria 2188
412 nmdc:mga0rr50_219040_c1 3300050513 Bacteria 1571
413 nmdc:mga0a205_501216_c1 3300050515 Bacteria 1071
414 nmdc:mga0sz30_172045_c1 3300050516 Bacteria 960
415 nmdc:mga0sz30_26991_c1 3300050516 Bacteria 2357
416 nmdc:mga0sz30_35361_c1 3300050516 Bacteria 2084
417 Ga0495601_0040054 3300053077 Bacteria 2934
418 Ga0495601_0183026 3300053077 Bacteria 1370
419 Ga0495612_0033466 3300053078 Bacteria 2080
420 Ga0500610_0174819 3300053079 Bacteria 1057
421 Ga0495595_0280589 3300053084 Bacteria 836
422 Ga0495619_0047595 3300053085 Bacteria 2824
423 Ga0495619_0079754 3300053085 Bacteria 2202
424 Ga0495619_0260560 3300053085 Bacteria 1202
425 Ga0500578_0130097 3300053086 Bacteria 1579
426 Ga0500643_000435 3300053087 Bacteria 31475
427 Ga0500646_0106310 3300053090 Bacteria 887
428 Ga0500647_0219735 3300053091 Bacteria 851
429 Ga0500583_0060606 3300053092 Bacteria 1785
430 Ga0500566_0231523 3300053094 Bacteria 911
431 Ga0500640_022982 3300053095 Bacteria 2698
432 Ga0500641_0007667 3300053096 Bacteria 3847
433 Ga0500641_0077542 3300053096 Bacteria 1407
434 Ga0500650_0094854 3300053098 Bacteria 1397
435 Ga0500555_002729 3300053103 Bacteria 5076
436 Ga0500557_000029 3300053105 Bacteria 77152
437 Ga0500572_003446 3300053111 Bacteria 3616
438 Ga0500595_030064 3300053119 Bacteria 1835
439 Ga0500607_017763 3300053121 Bacteria 4050
440 Ga0500608_097645 3300053122 Bacteria 1364
441 Ga0500614_023424 3300053123 Bacteria 1451
442 Ga0500642_0000333 3300053130 Bacteria 16200
443 Ga0500642_0004383 3300053130 Bacteria 4414
444 Ga0500642_0088314 3300053130 Bacteria 1431
445 Ga0500658_0029071 3300053134 Bacteria 2148
446 Ga0500559_0092980 3300053136 Bacteria 1382
447 Ga0500559_0162125 3300053136 Bacteria 1051
448 Ga0500564_028151 3300053138 Bacteria 2587
449 Ga0500568_0015021 3300053139 Bacteria 3474
450 Ga0500577_0030909 3300053142 Bacteria 1869
451 Ga0500590_002128 3300053148 Bacteria 8598
452 Ga0500590_036036 3300053148 Bacteria 2559
453 Ga0500604_0057216 3300053151 Bacteria 1217
454 Ga0500620_109001 3300053155 Bacteria 969
455 Ga0500622_0002532 3300053156 Bacteria 13121
456 Ga0500627_0164777 3300053158 Bacteria 1000
457 Ga0500638_166004 3300053162 Bacteria 967
458 Ga0500636_0000112 3300053177 Bacteria 42041
459 Ga0500636_0076642 3300053177 Bacteria 1933
460 Ga0500636_0311096 3300053177 Bacteria 770
461 Ga0500625_000732 3300053729 Bacteria 9749
462 Ga0500645_029248 3300053730 Bacteria 1664
463 Ga0500552_007013 3300053733 Bacteria 1285
464 Ga0500601_000308 3300053737 Bacteria 9152
465 Ga0500601_010724 3300053737 Bacteria 1028
466 Ga0500661_003982 3300055283 Bacteria 2766
467 Ga0501082_0004920 3300060353 Bacteria 11659
468 Ga0466962_0416273 3300061719 Bacteria 674
469 2824607987 2824600985 Bacteria 8488197
470 2507510976 2507262055 Bacteria 8048963
471 2508544800 2508501009 Bacteria 7784016
472 2508696974 2508501042 Bacteria 8719808
473 2509151010 2508501128 Bacteria 8613869
474 2513637502 2513237094 Bacteria 8789602
475 2513649656 2513237095 Bacteria 8976980
476 2513656343 2513237096 Bacteria 8722461
477 2513677031 2513237098 Bacteria 9902361
478 2513857041 2513237137 Bacteria 9558895
479 2513917478 2513237145 Bacteria 8979722
480 2515625468 2515154112 Bacteria 8294334
481 2517100561 2517093001 Bacteria 9002274
482 2517887848 2517572143 Bacteria 9484767
483 2524438214 2524023205 Bacteria 8918781
484 2524457374 2524023209 Bacteria 6679728
485 2524535515 2524023228 Bacteria 10118060
486 2671120636 2667528175 Bacteria 7532676
487 2745076903 2744054633 Bacteria 8678936
488 2793070642 2791355197 Bacteria 8420563
489 2818238127 2816332527 Bacteria 8933356
490 2824616518 2824609381 Bacteria 8672835
491 2824657826 2824653114 Bacteria 8493680
492 2824711154 2824704595 Bacteria 9667483
493 2824762867 2824753945 Bacteria 9787441
494 2824770536 2824763712 Bacteria 9792355
495 2824780833 2824773399 Bacteria 8360218
496 2831870274 2831864461 Bacteria 6502356
497 2841960247 2841957949 Bacteria 8652217
498 2842299070 2842298080 Bacteria 6123127
499 2842358536 2842357229 Bacteria 6485165
500 2844316947 2844315083 Bacteria 8138177
501 2847938537 2847930680 Bacteria 9342022
502 2849081503 2849076700 Bacteria 7039503
503 2874597717 2874590934 Bacteria 8299676
504 2874649279 2874645413 Bacteria 8214782
505 2876762436 2876761206 Bacteria 10111113
506 2876774810 2876771140 Bacteria 8287509
507 2876822438 2876818435 Bacteria 8274608
508 2879077898 2879074833 Bacteria 8279565
509 2879086219 2879083081 Bacteria 8587928
510 2879132550 2879127579 Bacteria 8294491
511 2879146049 2879142872 Bacteria 8267021
512 2881370654 2881364244 Bacteria 7710352
513 2884813466 2884811622 Bacteria 5552861
514 2884813517 2884811622 Bacteria 5552861
515 2884838326 2884836552 Bacteria 5219991
516 2884854618 2884852848 Bacteria 5221161
517 2885383378 2885374607 Bacteria 8927485
518 2888381554 2888378607 Bacteria 9652610
519 2888389085 2888388044 Bacteria 7304136
520 2888421953 2888419890 Bacteria 7857137
521 2896156714 2896154374 Bacteria 5221518
522 2903733994 2903727486 Bacteria 8281579
523 2904695532 2904690495 Bacteria 9412302
524 2904709999
525 2904719191 2904711408 Bacteria 9771557
526 2906604610 2906602504 Bacteria 8295279
527 2906612877
528 2906629307 2906626472 Bacteria 8826946
529 2906636636 2906635258 Bacteria 8601019
530 2906651550 2906643746 Bacteria 8722424
531 2906663082 2906660503 Bacteria 8595048
532 2908746070 2908739725 Bacteria 8628932
533 2908764168 2908756301 Bacteria 8864324
534 2919407200 2919404418 Bacteria 4232372
535 2922433376
536 2932798282 2932794094 Bacteria 7915132
537 2932804078 2932801729 Bacteria 7987968
538 2935612783 2935608549 Bacteria 8203142
539 2935630468 2935630451 Bacteria 8169952
540 2935655422 2935648319 Bacteria 8801166
541 2935664277 2935656913 Bacteria 8965014
542 2935824273 2935819856 Bacteria 8261050
543 2935852581 2935847175 Bacteria 8228321
544 2935884117 2935883170 Bacteria 7964738
545 2935912273 2935908558 Bacteria 8568796
546 2935924053 2935916978 Bacteria 9113783
547 2935929302 2935926038 Bacteria 8601059
548 2935935933 2935934488 Bacteria 8602579
549 2935950441 2935942939 Bacteria 8599779
550 2935957401 2935951376 Bacteria 8602333
551 2935962073 2935959822 Bacteria 7869783
552 2935968432 2935967501 Bacteria 8603075
553 2935976621 2935975950 Bacteria 8347125
554 2935987935 2935984226 Bacteria 8302647
555 2936018347 2936011229 Bacteria 8801034
556 2936026890 2936019824 Bacteria 8804134
557 2936035746 2936028420 Bacteria 8965941
558 2936053825 2936046547 Bacteria 8903709
559 2936058639 2936055302 Bacteria 8785755
560 2941507120 2941507105 Bacteria 8166816
561 2941520410 2941515067 Bacteria 8166720
562 2941523745 2941523033 Bacteria 8169134
563 3005482948 3005474847 Bacteria 9259049
564 3005596577 3005594810 Bacteria 8716512
565 8006935249 8006933436 Bacteria 10410654
566 8006975218 8006973647 Bacteria 10679141
567 8016633815 8016630954 Bacteria 9217207
568 8019573483 8019565922 Bacteria 9639779
569 8019625173 8019619141 Bacteria 9218857
570 8019637007 8019629233 Bacteria 8687553
571 8019642596 8019638758 Bacteria 9062356
572 8019664847 8019659431 Bacteria 8577854
573 8019674410 8019668869 Bacteria 8791617
574 8019681696 8019678201 Bacteria 8863603
575 8019694080 8019687851 Bacteria 8712826
576 8056969985 8056967851 Bacteria 9038162
577 JGI24735J21928_10036235
578 JGI25159J45721_1000321
579 JGI25165J46597_1006260
580 JGI25153J46596_10000758
581 JGI25153J46596_10002902
582 rootH2_10002064
583 rootL2_10060534
584 rootL2_10228413
585 JGI25160J50197_1000023
586 JGI25161J50226_1000012
587 JGI25161J50226_1016542
588 Ga0006562J51391_1034330
589 Ga0006562J51391_1034334
590 JGI25404J52841_10012376
591 Ga0055539_1010049
592 Ga0055526_1000193
593 Ga0055537_1000060
594 Ga0055524_1011325
595 Ga0055524_1018953
596 Ga0055534_1000009
597 Ga0055528_1000012
598 Ga0055531_10006861
599 Ga0055531_10020350
600 Ga0055543_1000009
601 Ga0065165_1000064
602 Ga0065165_1003855
603 Ga0065165_1008389
604 Ga0065165_1041967
605 Ga0070658_10026341
606 Ga0070658_10079618
607 Ga0070680_100592523
608 Ga0070682_100021438
609 Ga0068868_100064188
610 Ga0070660_100080334
611 Ga0070661_100248499
612 Ga0070669_100369427
613 Ga0070659_100529618
614 Ga0070667_100045988
615 Ga0070667_100697049
616 Ga0070703_10031172
617 Ga0070713_100107530
618 Ga0070713_100603362
619 Ga0070710_10178781
620 Ga0070711_100731196
621 Ga0070705_100354365
622 Ga0070663_100204499
623 Ga0070662_100301172
624 Ga0070681_10000451
625 Ga0070706_100375754
626 Ga0070707_100234805
627 Ga0070707_100570334
628 Ga0070698_100040971
629 Ga0070699_100505457
630 Ga0070679_100029654
631 Ga0070679_100032323
632 Ga0070697_100092973
633 Ga0068853_100308278
634 Ga0070665_100076892
635 Ga0070665_100323818
636 Ga0068855_100401229
637 Ga0068854_100429754
638 Ga0068856_100026430
639 Ga0068856_100153679
640 Ga0068856_100363534
641 Ga0068852_100183266
642 Ga0068852_100843725
643 Ga0068859_100994104
644 Ga0068864_101076603
645 Ga0068863_100809469
646 Ga0068858_100118578
647 Ga0068858_100687273
648 Ga0081540_1000611
649 Ga0075365_10076302
650 Ga0075365_10114978
651 Ga0075365_10172513
652 Ga0075368_10007563
653 Ga0075363_100010826
654 Ga0075364_10260429
655 Ga0070716_100224951
656 Ga0070712_100005515
657 Ga0070712_100551799
658 Ga0075362_10070000
659 Ga0075367_10012855
660 Ga0075367_10371156
661 Ga0075369_10011152
662 Ga0075369_10097331
663 Ga0075369_10122079
664 Ga0075366_10048803
665 Ga0075366_10064644
666 Ga0075370_10032291
667 Ga0075370_10135127
668 Ga0075434_100330182
669 Ga0075434_100642969
670 Ga0075434_100868833
671 Ga0097620_100994166
672 Ga0099825_1031415
673 Ga0099823_1043159
674 Ga0075435_100152675
675 Ga0099794_10001423
676 Ga0099794_10021711
677 Ga0099795_10000811
678 Ga0099795_10001295
679 Ga0099795_10005869
680 Ga0105240_10067121
681 Ga0105240_10509122
682 Ga0105247_10026879
683 Ga0114129_11226700
684 Ga0105241_10039028
685 Ga0105242_10658301
686 Ga0105248_10141072
687 Ga0105237_10040734
688 Ga0105237_10817931
689 Ga0105238_10009627
690 Ga0105238_10108054
691 Ga0105238_10921075
692 Ga0099796_10000759
693 Ga0099796_10053851
694 Ga0099796_10165681
695 Ga0099796_10169208
696 Ga0105239_10300463
697 Ga0105246_10085961
698 Ga0157370_10208768
699 Ga0157369_10000848
700 Ga0157374_10249119
701 Ga0163162_10508813
702 Ga0157372_10976336
703 Ga0157375_10733372
704 Ga0163163_10020785
705 Ga0157377_10835013
706 Ga0157379_10563410
707 Ga0214544_1000026
708 Ga0214542_1000025
709 Ga0214545_1000014
710 Ga0214543_1000034
711 Ga0213872_10000178
712 Ga0213872_10006184
713 Ga0213872_10006196
714 Ga0213872_10006719
715 Ga0213872_10007548
716 Ga0213872_10140097
717 Ga0209677_104422
718 Ga0209148_1026300
719 Ga0209233_1001081
720 Ga0209233_1005521
721 Ga0209565_1000015
722 Ga0209673_1000017
723 Ga0209130_1000048
724 Ga0209675_1000012
725 Ga0209564_1000016
726 Ga0209564_1028125
727 Ga0209758_1000141
728 Ga0209758_1016616
729 Ga0209758_1017128
730 Ga0209758_1081837
731 Ga0209050_1009166
732 Ga0209256_1000314
733 Ga0209256_1000532
734 Ga0209256_1008286
735 Ga0207426_1000136
736 Ga0207426_1001707
737 Ga0207426_1066038
738 Ga0209051_1049223
739 Ga0209257_1000426
740 Ga0209257_1000700
741 Ga0209257_1017626
742 Ga0207692_10249213
743 Ga0207710_10059126
744 Ga0207647_10006758
745 Ga0207705_10024531
746 Ga0207684_10306872
747 Ga0207654_10059094
748 Ga0207707_10002336
749 Ga0207695_10296878
750 Ga0207695_10476719
751 Ga0207693_10002707
752 Ga0207693_10049928
753 Ga0207663_10071802
754 Ga0207663_10607501
755 Ga0207657_10206621
756 Ga0207649_10118805
757 Ga0207652_10028653
758 Ga0207646_10184878
759 Ga0207646_10629477
760 Ga0207681_10108051
761 Ga0207694_10000322
762 Ga0207700_10187654
763 Ga0207706_10728883
764 Ga0207665_10260349
765 Ga0207711_10471243
766 Ga0207689_10649812
767 Ga0207667_10344340
768 Ga0207651_10770092
769 Ga0207640_10097245
770 Ga0207658_10174272
771 Ga0207703_10268074
772 Ga0207639_10308497
773 Ga0207639_10553192
774 Ga0207678_10013068
775 Ga0207678_10045747
776 Ga0207702_10026135
777 Ga0207702_10675190
778 Ga0207683_10630086
779 Ga0209389_1000004
780 Ga0209489_100295
781 Ga0209700_100013
782 Ga0209179_1000940
783 Ga0209179_1006747
784 Ga0209179_1011049
785 Ga0209588_1005984
786 Ga0209588_1028323
787 Ga0268266_10000148
788 Ga0268266_10191162
789 Ga0268266_10528717
790 Ga0268266_10608650
791 Ga0307515_10136828
792 Ga0307510_10106752
793 Ga0307510_10122784
794 Ga0315911_1000017
795 Ga0316215_1003720
796 Ga0373943_0123171
797 Ga0373935_0468499
798 Ga0373927_0102330
799 Ga0373927_0160125
800 Ga0373927_0161438
801 Ga0373947_0100246
802 Ga0373947_0325529
803 Ga0373937_0014205
804 Ga0373925_0803134
805 Ga0395898_0485615
806 Ga0395898_1229904
807 Ga0395905_0520463
808 Ga0436360_0135104
809 Ga0436361_0301219
810 Ga0436361_0390607
811 Ga0436361_0520952
812 Ga0436361_0586839
813 Ga0436361_0983546
814 Ga0436361_1026829
815 Ga0436363_0642328
816 Ga0436363_1121890
817 Ga0451841_0701862
818 Ga0466972_0310345
819 Ga0466964_0248426
820 Ga0466968_0236991
821 Ga0466970_0279150
822 Ga0466957_0231456
823 Ga0466960_0214102
824 Ga0466959_0016785
825 Ga0466959_0058111
826 Ga0466958_0072720
827 Ga0495592_0095162
828 Ga0495603_0023485
829 Ga0495629_0059597
830 Ga0495629_0061797
831 Ga0495629_0064819
832 Ga0495638_0002025
833 Ga0495641_0151371
834 Ga0495651_0017451
835 Ga0495651_0049992
836 Ga0495651_0090103
837 Ga0495651_0283947
838 Ga0495653_0532342
839 Ga0495639_0029192
840 Ga0495662_0002818
841 Ga0495664_0105995
842 Ga0495583_0163927
843 Ga0495606_0028145
844 Ga0495606_0048852
845 Ga0495606_0102308
846 Ga0495606_0128077
847 Ga0495606_0216968
848 Ga0495608_0126161
849 Ga0495610_0200288
850 Ga0495616_0267327
851 Ga0495618_0524527
852 Ga0495620_0158255
853 Ga0495643_0016476
854 Ga0495643_0022577
855 Ga0495643_0247215
856 Ga0495648_0035711
857 Ga0495648_0046103
858 Ga0495648_0104658
859 Ga0495648_0118870
860 Ga0495652_0035489
861 Ga0495652_0043201
862 Ga0495652_0549251
863 Ga0495640_0067692
864 Ga0495640_0081074
865 Ga0495640_0200236
866 Ga0495587_0029246
867 Ga0495597_0049305
868 Ga0495622_0013104
869 Ga0495622_0090410
870 Ga0495667_0123364
871 Ga0495667_0314849
872 Ga0495656_0245862
873 Ga0495668_0000101
874 Ga0495668_0128396
875 Ga0495668_0331181
876 Ga0495634_0191102
877 Ga0495625_0002313
878 Ga0495635_0002475
879 Ga0495588_0065648
880 Ga0495657_0012044
881 Ga0495657_0057884
882 Ga0495657_0394439
883 Ga0495599_0029536
884 Ga0495599_0116213
885 Ga0495623_0034406
886 Ga0495623_0121800
887 Ga0495646_0091289
888 Ga0495646_0267174
889 Ga0495624_0196133
890 Ga0495670_0012075
891 Ga0495649_0321625
892 Ga0495600_0119156
893 Ga0495600_0333247
894 Ga0495581_0041065
895 Ga0495604_0007865
896 Ga0495604_0036436
897 Ga0495604_0108099
898 Ga0495604_0152125
899 Ga0495604_0445910
900 Ga0495674_0126935
901 Ga0495672_0047816
902 Ga0495676_0149635
903 Ga0495676_0268401
904 Ga0495683_0073607
905 Ga0495687_007506
906 Ga0495687_077558
907 Ga0495675_0041205
908 Ga0495684_0273611
909 Ga0495686_0001489
910 Ga0495686_0093247
911 Ga0495686_0101215
912 Ga0495686_0113222
913 Ga0495593_0025086
914 Ga0495602_0033245
915 Ga0495602_0249111
916 Ga0496100_1021148
917 Ga0496101_0195578
918 Ga0496102_0023434
919 Ga0496104_0142870
920 Ga0496105_0079017
921 Ga0496105_0101334
922 Ga0496108_0351351
923 Ga0496109_0044539
924 Ga0496110_0440817
925 Ga0496111_0095467
926 Ga0496112_0117039
927 Ga0496112_0908842
928 Ga0496113_0022420
929 Ga0496113_0126101
930 Ga0496114_0041060
931 Ga0496114_0127629
932 Ga0496115_0212663
933 Ga0496115_0562446
934 Ga0496116_0165025
935 Ga0496118_0046602
936 Ga0496119_0013626
937 Ga0496119_0354347
938 Ga0496120_0005798
939 Ga0496120_0035479
940 Ga0496121_0034371
941 Ga0496121_0058023
942 Ga0496121_0331885
943 Ga0496122_0001093
944 Ga0496124_0048014
945 Ga0496124_0244465
946 Ga0496125_0014853
947 Ga0496125_0070734
948 Ga0496125_0094346
949 Ga0496125_0266694
950 Ga0496125_0303318
951 Ga0496125_0417603
952 Ga0496126_0066305
953 Ga0496126_0326870
954 Ga0495678_015393
955 Ga0501032_0385153
956 Ga0501033_0121712
957 Ga0501034_0608984
958 Ga0501036_0045226
959 Ga0501037_0193646
960 Ga0501038_0029709
961 Ga0501043_0009637
962 Ga0501043_0071562
963 Ga0501046_0060351
964 Ga0501046_0133793
965 Ga0501047_0597750
966 Ga0501067_0023552
967 Ga0501069_0077293
968 Ga0501076_0832741
969 Ga0501080_0009228
970 Ga0501080_0476359
971 Ga0501083_0094262
972 Ga0501044_0016746
973 Ga0501044_0035274
974 Ga0501044_0798786
975 nmdc:mga00v17_103609_c1
976 nmdc:mga00v17_76702_c1
977 nmdc:mga0yw44_113867_c1
978 nmdc:mga0yw44_21645_c1
979 nmdc:mga0yw44_316767_c1
980 nmdc:mga0k408_61684_c1
981 nmdc:mga06z11_326792_c1
982 nmdc:mga04h51_40676_c1
983 nmdc:mga07m45_33801_c1
984 nmdc:mga05p37_1360823_c1
985 nmdc:mga0n895_354035_c1
986 nmdc:mga0n895_846434_c1
987 nmdc:mga0rr50_109010_c1
988 nmdc:mga0rr50_219040_c1
989 nmdc:mga0a205_501216_c1
990 nmdc:mga0sz30_172045_c1
991 nmdc:mga0sz30_26991_c1
992 nmdc:mga0sz30_35361_c1
993 Ga0495601_0040054
994 Ga0495601_0183026
995 Ga0495612_0033466
996 Ga0500610_0174819
997 Ga0495595_0280589
998 Ga0495619_0047595
999 Ga0495619_0079754
1000 Ga0495619_0260560
1001 Ga0500578_0130097
1002 Ga0500643_000435
1003 Ga0500646_0106310
1004 Ga0500647_0219735
1005 Ga0500583_0060606
1006 Ga0500566_0231523
1007 Ga0500640_022982
1008 Ga0500641_0007667
1009 Ga0500641_0077542
1010 Ga0500650_0094854
1011 Ga0500555_002729
1012 Ga0500557_000029
1013 Ga0500572_003446
1014 Ga0500595_030064
1015 Ga0500607_017763
1016 Ga0500608_097645
1017 Ga0500614_023424
1018 Ga0500642_0000333
1019 Ga0500642_0004383
1020 Ga0500642_0088314
1021 Ga0500658_0029071
1022 Ga0500559_0092980
1023 Ga0500559_0162125
1024 Ga0500564_028151
1025 Ga0500568_0015021
1026 Ga0500577_0030909
1027 Ga0500590_002128
1028 Ga0500590_036036
1029 Ga0500604_0057216
1030 Ga0500620_109001
1031 Ga0500622_0002532
1032 Ga0500627_0164777
1033 Ga0500638_166004
1034 Ga0500636_0000112
1035 Ga0500636_0076642
1036 Ga0500636_0311096
1037 Ga0500625_000732
1038 Ga0500645_029248
1039 Ga0500552_007013
1040 Ga0500601_000308
1041 Ga0500601_010724
1042 Ga0500661_003982
1043 Ga0501082_0004920
1044 Ga0466962_0416273
1045 2824607987
1046 2507510976
1047 2508544800
1048 2508696974
1049 2509151010
1050 2513637502
1051 2513649656
1052 2513656343
1053 2513677031
1054 2513857041
1055 2513917478
1056 2515625468
1057 2517100561
1058 2517887848
1059 2524438214
1060 2524457374
1061 2524535515
1062 2671120636
1063 2745076903
1064 2793070642
1065 2818238127
1066 2824616518
1067 2824657826
1068 2824711154
1069 2824762867
1070 2824770536
1071 2824780833
1072 2831870274
1073 2841960247
1074 2842299070
1075 2842358536
1076 2844316947
1077 2847938537
1078 2849081503
1079 2874597717
1080 2874649279
1081 2876762436
1082 2876774810
1083 2876822438
1084 2879077898
1085 2879086219
1086 2879132550
1087 2879146049
1088 2881370654
1089 2884813466
1090 2884813517
1091 2884838326
1092 2884854618
1093 2885383378
1094 2888381554
1095 2888389085
1096 2888421953
1097 2896156714
1098 2903733994
1099 2904695532
1100 2904709999
1101 2904719191
1102 2906604610
1103 2906612877
1104 2906629307
1105 2906636636
1106 2906651550
1107 2906663082
1108 2908746070
1109 2908764168
1110 2919407200
1111 2922433376
1112 2932798282
1113 2932804078
1114 2935612783
1115 2935630468
1116 2935655422
1117 2935664277
1118 2935824273
1119 2935852581
1120 2935884117
1121 2935912273
1122 2935924053
1123 2935929302
1124 2935935933
1125 2935950441
1126 2935957401
1127 2935962073
1128 2935968432
1129 2935976621
1130 2935987935
1131 2936018347
1132 2936026890
1133 2936035746
1134 2936053825
1135 2936058639
1136 2941507120
1137 2941520410
1138 2941523745
1139 3005482948
1140 3005596577
1141 8006935249
1142 8006975218
1143 8016633815
1144 8019573483
1145 8019625173
1146 8019637007
1147 8019642596
1148 8019664847
1149 8019674410
1150 8019681696
1151 8019694080
1152 8056969985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

198

240

0.98

PF07336

ABATE

Putative stress-induced transcription regulator

49

193

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.6647 1 202
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.6587 1 202
3bzw-assembly1.cif.gz_A crystal structure of a putative lipase from bacteroides thetaiotaomicron 0.4977 111 153
2g0q-assembly1.cif.gz_A solution structure of at5g39720.1 from arabidopsis thaliana 0.4674 94 139
5wch-assembly1.cif.gz_D crystal structure of the catalytic domain of human usp9x 0.46 102 136
ID Description Score Start End Superfamily
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.7028 15 202 1.10.3300.10
af_O60135_31_535_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.6731 108 134 3.40.50.12780
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.6621 15 202 1.10.3300.10
af_A0A1D6PQV4_1_250_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5917 108 135 1.10.510.10
af_B2RRD7_325_448_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5041 98 134 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A6P2DWS1-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9783 1 215
AF-A0A6P2DWS1-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9738 1 215
AF-A0A430BN82-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9732 29 208
AF-A0A6P2E6B6-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9691 2 204
AF-A0A4Q8R150-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9633 1 185

Map