F465149

General Info

Members Datasets Scaffolds Average Seq Length
573 304 568 93

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10337456|Ga0065707_103374562
Length 109
Sequence MALMITDECINCDVCEPECPNEAISLGPEIYQIAPERCTECVGHFDEPQCVQVCPVACIPVDPKRVESRETLWQKYQRLVAQAKKDTEGVAGSAPTPTLPQGGREQEPG

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 2842747753 Variovorax sp. R-72060 Isolate Unclassified
3 2929520902 Variovorax beijingensis 502 Isolate Unclassified
4 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
5 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
157 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
158 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
159 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
192 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
198 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
202 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
203 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
204 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
205 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
210 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
256 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
265 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
266 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
267 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
268 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
284 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
287 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
288 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
289 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
290 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
295 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
296 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
299 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
300 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
301 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
302 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.17
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.77
Nodule 0.35
Rhizoplane 4.01
Rhizosphere 67.89
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009214 3300001979 Bacteria 3878
2 Ga0007417J51691_1110541 3300003544 Bacteria 581
3 Ga0055535_1007416 3300003761 Bacteria 2100
4 Ga0055540_1006805 3300003792 Bacteria 4458
5 Ga0055531_10001090 3300003794 Bacteria 21279
6 Ga0065707_10337456 3300005295 Bacteria 934
7 Ga0065707_10420912 3300005295 Bacteria 831
8 Ga0065707_10537994 3300005295 Bacteria 730
9 Ga0070658_10189382 3300005327 Bacteria 1734
10 Ga0070658_10386016 3300005327 Bacteria 1202
11 Ga0070676_11448723 3300005328 Bacteria 528
12 Ga0070690_100241180 3300005330 Bacteria 1275
13 Ga0070690_100917644 3300005330 Bacteria 686
14 Ga0070670_101744585 3300005331 Bacteria 573
15 Ga0070677_10310172 3300005333 Bacteria 805
16 Ga0070677_10539574 3300005333 Bacteria 638
17 Ga0070677_10560153 3300005333 Bacteria 628
18 Ga0068869_100135993 3300005334 Bacteria 1894
19 Ga0070666_10413270 3300005335 Bacteria 971
20 Ga0070680_100257070 3300005336 Bacteria 1477
21 Ga0070680_101659497 3300005336 Bacteria 554
22 Ga0070682_100266161 3300005337 Bacteria 1243
23 Ga0068868_100522906 3300005338 Bacteria 1042
24 Ga0068868_101452412 3300005338 Bacteria 641
25 Ga0070660_100000354 3300005339 Bacteria 30590
26 Ga0070660_100011683 3300005339 Bacteria 6252
27 Ga0070660_101051185 3300005339 Bacteria 689
28 Ga0070689_100392442 3300005340 Bacteria 1172
29 Ga0070691_10211487 3300005341 Bacteria 1023
30 Ga0070661_100003595 3300005344 Bacteria 10675
31 Ga0070661_101494736 3300005344 Bacteria 570
32 Ga0070668_100118282 3300005347 Bacteria 2115
33 Ga0070668_101013468 3300005347 Bacteria 747
34 Ga0070669_100291715 3300005353 Bacteria 1310
35 Ga0070675_100001027 3300005354 Bacteria 20074
36 Ga0070675_100223409 3300005354 Bacteria 1641
37 Ga0070675_100341061 3300005354 Bacteria 1327
38 Ga0070675_100375145 3300005354 Bacteria 1265
39 Ga0070675_100444581 3300005354 Bacteria 1162
40 Ga0070674_100012613 3300005356 Bacteria 5194
41 Ga0070674_100952629 3300005356 Bacteria 751
42 Ga0070673_102024709 3300005364 Bacteria 547
43 Ga0070688_100417019 3300005365 Bacteria 997
44 Ga0070688_101487132 3300005365 Bacteria 551
45 Ga0070659_100000846 3300005366 Bacteria 22322
46 Ga0070659_100232449 3300005366 Bacteria 1524
47 Ga0070667_100002153 3300005367 Bacteria 17348
48 Ga0070667_100145138 3300005367 Bacteria 2081
49 Ga0070667_100203686 3300005367 Bacteria 1756
50 Ga0070667_100217035 3300005367 Bacteria 1701
51 Ga0070701_10519980 3300005438 Bacteria 776
52 Ga0070663_100226653 3300005455 Bacteria 1470
53 Ga0070663_101466481 3300005455 Bacteria 606
54 Ga0070678_100002501 3300005456 Bacteria 10081
55 Ga0070678_100040897 3300005456 Bacteria 3283
56 Ga0070678_100234279 3300005456 Bacteria 1532
57 Ga0070678_100378071 3300005456 Bacteria 1225
58 Ga0070678_101387395 3300005456 Bacteria 656
59 Ga0070662_100001973 3300005457 Bacteria 12604
60 Ga0070662_100089754 3300005457 Bacteria 2306
61 Ga0070681_10278353 3300005458 Bacteria 1584
62 Ga0068867_100116187 3300005459 Bacteria 2061
63 Ga0068867_100865244 3300005459 Bacteria 811
64 Ga0068867_100930765 3300005459 Bacteria 784
65 Ga0068867_101063080 3300005459 Bacteria 737
66 Ga0068867_101139239 3300005459 Bacteria 714
67 Ga0070706_100000700 3300005467 Bacteria 37931
68 Ga0070698_100796762 3300005471 Bacteria 889
69 Ga0070679_100071451 3300005530 Bacteria 3462
70 Ga0070679_100108545 3300005530 Bacteria 2761
71 Ga0070679_100727819 3300005530 Bacteria 935
72 Ga0068853_100037877 3300005539 Bacteria 4106
73 Ga0070672_100528850 3300005543 Bacteria 1022
74 Ga0070665_100059434 3300005548 Bacteria 3832
75 Ga0070665_100407372 3300005548 Bacteria 1368
76 Ga0070665_101141059 3300005548 Bacteria 791
77 Ga0070665_102248670 3300005548 Bacteria 549
78 Ga0068855_100022812 3300005563 Bacteria 7500
79 Ga0068855_100060040 3300005563 Bacteria 4448
80 Ga0068855_100136450 3300005563 Bacteria 2799
81 Ga0068857_100032539 3300005577 Bacteria 4612
82 Ga0068854_100124186 3300005578 Bacteria 1964
83 Ga0070702_101473544 3300005615 Bacteria 559
84 Ga0068852_100187498 3300005616 Bacteria 1949
85 Ga0068852_100229803 3300005616 Bacteria 1768
86 Ga0068859_100909238 3300005617 Bacteria 965
87 Ga0068859_101970645 3300005617 Bacteria 645
88 Ga0068859_102289782 3300005617 Bacteria 596
89 Ga0068864_100375946 3300005618 Bacteria 1345
90 Ga0068866_10133847 3300005718 Bacteria 1414
91 Ga0068863_100191568 3300005841 Bacteria 1965
92 Ga0068863_100892422 3300005841 Bacteria 889
93 Ga0068863_101064235 3300005841 Bacteria 813
94 Ga0068863_101273972 3300005841 Bacteria 742
95 Ga0068863_101283499 3300005841 Bacteria 739
96 Ga0068858_101152333 3300005842 Bacteria 762
97 Ga0068860_100144594 3300005843 Bacteria 2287
98 Ga0068860_100302219 3300005843 Bacteria 1568
99 Ga0068860_100437468 3300005843 Bacteria 1299
100 Ga0068862_100663517 3300005844 Bacteria 1007
101 Ga0075365_10066115 3300006038 Bacteria 2425
102 Ga0075365_10778261 3300006038 Bacteria 675
103 Ga0075368_10026642 3300006042 Bacteria 2224
104 Ga0075363_100032316 3300006048 Bacteria 2718
105 Ga0075363_100140039 3300006048 Bacteria 1361
106 Ga0075363_100147872 3300006048 Bacteria 1325
107 Ga0075363_100509999 3300006048 Bacteria 715
108 Ga0075364_10066367 3300006051 Bacteria 2370
109 Ga0075364_10523274 3300006051 Bacteria 811
110 Ga0075364_10638315 3300006051 Bacteria 727
111 Ga0075432_10007264 3300006058 Bacteria 3773
112 Ga0075362_10006678 3300006177 Bacteria 4310
113 Ga0075362_10039587 3300006177 Bacteria 2073
114 Ga0075362_10049615 3300006177 Bacteria 1875
115 Ga0075362_10111742 3300006177 Bacteria 1286
116 Ga0075362_10351383 3300006177 Bacteria 738
117 Ga0075367_10001893 3300006178 Bacteria 9269
118 Ga0075367_10023179 3300006178 Bacteria 3489
119 Ga0075367_10440801 3300006178 Bacteria 825
120 Ga0075367_10781875 3300006178 Bacteria 608
121 Ga0075369_10022389 3300006186 Bacteria 2606
122 Ga0075369_10067475 3300006186 Bacteria 1570
123 Ga0075369_10340690 3300006186 Bacteria 703
124 Ga0075366_10001135 3300006195 Bacteria 13140
125 Ga0075366_10013712 3300006195 Bacteria 4619
126 Ga0075366_10016581 3300006195 Bacteria 4237
127 Ga0075366_10020149 3300006195 Bacteria 3866
128 Ga0075366_10081601 3300006195 Bacteria 1931
129 Ga0075366_10098006 3300006195 Bacteria 1758
130 Ga0075366_10191090 3300006195 Bacteria 1244
131 Ga0075366_10386361 3300006195 Bacteria 861
132 Ga0075366_10464950 3300006195 Bacteria 781
133 Ga0075366_10565077 3300006195 Bacteria 705
134 Ga0097621_100092847 3300006237 Bacteria 2528
135 Ga0097621_100663252 3300006237 Bacteria 958
136 Ga0097621_101608169 3300006237 Bacteria 618
137 Ga0097621_102190406 3300006237 Bacteria 529
138 Ga0075370_10000133 3300006353 Bacteria 24995
139 Ga0075370_10001450 3300006353 Bacteria 10303
140 Ga0075370_10010864 3300006353 Bacteria 4772
141 Ga0075370_10018072 3300006353 Bacteria 3820
142 Ga0075370_10018552 3300006353 Bacteria 3777
143 Ga0075370_10031408 3300006353 Bacteria 2965
144 Ga0075370_10455059 3300006353 Bacteria 770
145 Ga0075370_10466502 3300006353 Bacteria 760
146 Ga0075370_10541309 3300006353 Bacteria 704
147 Ga0075370_10793026 3300006353 Bacteria 577
148 Ga0068871_100101604 3300006358 Bacteria 2409
149 Ga0068871_100262078 3300006358 Bacteria 1508
150 Ga0068871_100399973 3300006358 Bacteria 1223
151 Ga0068871_100962461 3300006358 Bacteria 793
152 Ga0075430_100013420 3300006846 Bacteria 6983
153 Ga0075429_100001318 3300006880 Bacteria 20245
154 Ga0097620_100909225 3300006931 Bacteria 965
155 Ga0097620_101970483 3300006931 Bacteria 645
156 Ga0097620_102290545 3300006931 Bacteria 596
157 Ga0079104_1027475 3300006946 Bacteria 1459
158 Ga0099826_10582353 3300006948 Bacteria 511
159 Ga0105240_10005767 3300009093 Bacteria 18365
160 Ga0105240_10302814 3300009093 Bacteria 1828
161 Ga0111539_11968237 3300009094 Bacteria 678
162 Ga0111539_13082756 3300009094 Bacteria 538
163 Ga0105245_12278214 3300009098 Bacteria 595
164 Ga0105243_10594657 3300009148 Bacteria 1064
165 Ga0105243_11385105 3300009148 Bacteria 723
166 Ga0105242_10040790 3300009176 Bacteria 3741
167 Ga0105242_10626225 3300009176 Bacteria 1043
168 Ga0105242_12790020 3300009176 Bacteria 539
169 Ga0105242_13024558 3300009176 Bacteria 521
170 Ga0105248_10119058 3300009177 Bacteria 2979
171 Ga0105248_11050995 3300009177 Bacteria 920
172 Ga0105237_10005313 3300009545 Bacteria 14566
173 Ga0105237_10068698 3300009545 Bacteria 3537
174 Ga0105238_10028874 3300009551 Bacteria 5649
175 Ga0105238_11005752 3300009551 Bacteria 855
176 Ga0105249_10070627 3300009553 Bacteria 3224
177 Ga0105249_10205185 3300009553 Bacteria 1931
178 Ga0105249_10875767 3300009553 Bacteria 964
179 Ga0105249_11394989 3300009553 Bacteria 773
180 Ga0105239_10101058 3300010375 Bacteria 3190
181 Ga0105239_11237757 3300010375 Bacteria 860
182 Ga0105246_11157157 3300011119 Bacteria 710
183 Ga0157378_12020785 3300013297 Bacteria 626
184 Ga0163162_10381931 3300013306 Bacteria 1542
185 Ga0163162_11239855 3300013306 Bacteria 847
186 Ga0163162_12089884 3300013306 Bacteria 650
187 Ga0157375_10240126 3300013308 Bacteria 1971
188 Ga0157375_10375145 3300013308 Bacteria 1589
189 Ga0157375_11218252 3300013308 Bacteria 883
190 Ga0163163_10389797 3300014325 Bacteria 1451
191 Ga0163163_11132473 3300014325 Bacteria 845
192 Ga0163163_11403514 3300014325 Bacteria 760
193 Ga0163163_11655891 3300014325 Bacteria 701
194 Ga0157380_10302114 3300014326 Bacteria 1475
195 Ga0157380_10556801 3300014326 Bacteria 1126
196 Ga0157380_11989588 3300014326 Bacteria 643
197 Ga0182008_10003005 3300014497 Bacteria 10376
198 Ga0182008_10010313 3300014497 Bacteria 5003
199 Ga0182008_10163152 3300014497 Bacteria 1122
200 Ga0157379_10088429 3300014968 Bacteria 2778
201 Ga0157379_10174942 3300014968 Bacteria 1938
202 Ga0157379_10924213 3300014968 Bacteria 829
203 Ga0157376_10079988 3300014969 Bacteria 2803
204 Ga0157376_11403641 3300014969 Bacteria 730
205 Ga0157376_11559935 3300014969 Bacteria 694
206 Ga0182006_1023558 3300015261 Bacteria 2548
207 Ga0182007_10004805 3300015262 Bacteria 6064
208 Ga0163161_10024999 3300017792 Bacteria 4222
209 Ga0163161_10209265 3300017792 Bacteria 1506
210 Ga0163161_10945538 3300017792 Bacteria 733
211 Ga0213876_10537746 3300021384 Bacteria 622
212 Ga0209258_100489 3300025242 Bacteria 40371
213 Ga0209759_1001977 3300025256 Bacteria 9830
214 Ga0209673_1018116 3300025273 Bacteria 2573
215 Ga0209673_1020479 3300025273 Bacteria 2340
216 Ga0209675_1038104 3300025291 Bacteria 1074
217 Ga0209025_1005205 3300025294 Bacteria 10733
218 Ga0209256_1000049 3300025299 Bacteria 310696
219 Ga0209051_1000456 3300025303 Bacteria 54000
220 Ga0209257_1000015 3300025304 Bacteria 908141
221 Ga0207682_10384251 3300025893 Bacteria 663
222 Ga0207680_10357255 3300025903 Bacteria 1027
223 Ga0207645_10048479 3300025907 Bacteria 2713
224 Ga0207645_10052162 3300025907 Bacteria 2613
225 Ga0207705_10574485 3300025909 Bacteria 876
226 Ga0207707_10875930 3300025912 Bacteria 744
227 Ga0207695_10372588 3300025913 Bacteria 1314
228 Ga0207671_10099308 3300025914 Bacteria 2203
229 Ga0207660_10684877 3300025917 Bacteria 836
230 Ga0207657_10005778 3300025919 Bacteria 12899
231 Ga0207657_10037495 3300025919 Bacteria 4327
232 Ga0207657_11118319 3300025919 Bacteria 601
233 Ga0207657_11501069 3300025919 Bacteria 504
234 Ga0207649_10010407 3300025920 Bacteria 5110
235 Ga0207652_10058562 3300025921 Bacteria 3319
236 Ga0207646_10408677 3300025922 Bacteria 1226
237 Ga0207681_10011235 3300025923 Bacteria 5500
238 Ga0207681_10336926 3300025923 Bacteria 1204
239 Ga0207681_10375818 3300025923 Bacteria 1143
240 Ga0207694_10200773 3300025924 Bacteria 1622
241 Ga0207650_10375931 3300025925 Bacteria 1173
242 Ga0207650_10444755 3300025925 Bacteria 1078
243 Ga0207650_10946980 3300025925 Bacteria 732
244 Ga0207659_10245191 3300025926 Bacteria 1451
245 Ga0207659_10259706 3300025926 Bacteria 1412
246 Ga0207659_10635188 3300025926 Bacteria 912
247 Ga0207687_10313050 3300025927 Bacteria 1268
248 Ga0207687_10904539 3300025927 Bacteria 755
249 Ga0207664_10151267 3300025929 Bacteria 1972
250 Ga0207644_10199913 3300025931 Bacteria 1576
251 Ga0207644_11746402 3300025931 Bacteria 521
252 Ga0207690_10003760 3300025932 Bacteria 8999
253 Ga0207706_10005101 3300025933 Bacteria 12262
254 Ga0207706_10058552 3300025933 Bacteria 3393
255 Ga0207706_11151867 3300025933 Bacteria 646
256 Ga0207686_10089949 3300025934 Bacteria 2024
257 Ga0207709_10147683 3300025935 Bacteria 1624
258 Ga0207709_11788719 3300025935 Bacteria 511
259 Ga0207669_10004596 3300025937 Bacteria 6091
260 Ga0207691_10042442 3300025940 Bacteria 4193
261 Ga0207691_10265054 3300025940 Bacteria 1480
262 Ga0207691_10277074 3300025940 Bacteria 1444
263 Ga0207711_10160331 3300025941 Bacteria 2035
264 Ga0207689_10026426 3300025942 Bacteria 4860
265 Ga0207667_10056831 3300025949 Bacteria 4109
266 Ga0207667_10078799 3300025949 Bacteria 3414
267 Ga0207667_10135305 3300025949 Bacteria 2538
268 Ga0207712_10484676 3300025961 Bacteria 1054
269 Ga0207668_10552187 3300025972 Bacteria 998
270 Ga0207640_10238457 3300025981 Bacteria 1404
271 Ga0207640_10357000 3300025981 Bacteria 1176
272 Ga0207658_10001079 3300025986 Bacteria 22086
273 Ga0207658_10054381 3300025986 Bacteria 2962
274 Ga0207658_11057474 3300025986 Bacteria 741
275 Ga0207677_10568457 3300026023 Bacteria 991
276 Ga0207677_10666631 3300026023 Bacteria 920
277 Ga0207677_11019856 3300026023 Bacteria 751
278 Ga0207639_10098896 3300026041 Bacteria 2353
279 Ga0207702_10478014 3300026078 Bacteria 1212
280 Ga0207702_11788108 3300026078 Bacteria 607
281 Ga0207641_12018990 3300026088 Bacteria 578
282 Ga0207641_12043259 3300026088 Bacteria 574
283 Ga0207648_10145032 3300026089 Bacteria 2094
284 Ga0207648_10220707 3300026089 Bacteria 1685
285 Ga0207648_10489116 3300026089 Bacteria 1125
286 Ga0207676_11421137 3300026095 Bacteria 690
287 Ga0207674_10029917 3300026116 Bacteria 5730
288 Ga0207675_102076351 3300026118 Bacteria 585
289 Ga0207683_10004243 3300026121 Bacteria 12370
290 Ga0207683_11006933 3300026121 Bacteria 773
291 Ga0207698_10169719 3300026142 Bacteria 1919
292 Ga0207698_10706613 3300026142 Bacteria 1003
293 Ga0209971_1135612 3300027682 Bacteria 606
294 Ga0209813_10037472 3300027866 Bacteria 1461
295 Ga0207428_10398673 3300027907 Bacteria 1008
296 Ga0207428_10830146 3300027907 Bacteria 655
297 Ga0268266_10087578 3300028379 Bacteria 2725
298 Ga0268266_11490230 3300028379 Bacteria 652
299 Ga0268266_11784421 3300028379 Bacteria 590
300 Ga0268265_10045754 3300028380 Bacteria 3268
301 Ga0268265_10244673 3300028380 Bacteria 1585
302 Ga0268265_11596099 3300028380 Bacteria 657
303 Ga0268264_10136557 3300028381 Bacteria 2181
304 Ga0268264_10298458 3300028381 Bacteria 1516
305 Ga0268264_10629152 3300028381 Bacteria 1060
306 Ga0268264_11356619 3300028381 Bacteria 721
307 Ga0307517_10191648 3300028786 Bacteria 1296
308 Ga0307517_10224930 3300028786 Bacteria 1135
309 Ga0307515_10079492 3300028794 Bacteria 4295
310 Ga0307515_10102481 3300028794 Bacteria 3442
311 Ga0307515_10167093 3300028794 Bacteria 2212
312 Ga0307515_10393770 3300028794 Bacteria 1013
313 Ga0307512_10201555 3300030522 Bacteria 1076
314 Ga0307512_10305016 3300030522 Bacteria 738
315 Ga0316179_1109249 3300030734 Bacteria 1789
316 Ga0316178_1010462 3300030735 Bacteria 4027
317 Ga0316183_1067419 3300030742 Bacteria 8873
318 Ga0265327_10249184 3300031251 Bacteria 791
319 Ga0307513_10002473 3300031456 Bacteria 25565
320 Ga0307513_10004582 3300031456 Bacteria 18428
321 Ga0307513_10185683 3300031456 Bacteria 1936
322 Ga0307513_10315173 3300031456 Bacteria 1324
323 Ga0307513_10469354 3300031456 Bacteria 980
324 Ga0307513_10616172 3300031456 Bacteria 794
325 Ga0307509_10051823 3300031507 Bacteria 4384
326 Ga0307509_10472816 3300031507 Bacteria 943
327 Ga0307408_100051410 3300031548 Bacteria 2968
328 Ga0307408_100081760 3300031548 Bacteria 2416
329 Ga0307408_100184612 3300031548 Bacteria 1675
330 Ga0307508_10136659 3300031616 Bacteria 2055
331 Ga0307508_10246616 3300031616 Bacteria 1383
332 Ga0307514_10000928 3300031649 Bacteria 44600
333 Ga0307514_10080793 3300031649 Bacteria 2404
334 Ga0307516_10002259 3300031730 Bacteria 25996
335 Ga0307516_10087584 3300031730 Bacteria 2948
336 Ga0307516_10649421 3300031730 Bacteria 710
337 Ga0307405_10098893 3300031731 Bacteria 1951
338 Ga0307405_10179159 3300031731 Bacteria 1520
339 Ga0307405_10444329 3300031731 Bacteria 1026
340 Ga0307405_10505413 3300031731 Bacteria 970
341 Ga0307405_11473784 3300031731 Bacteria 597
342 Ga0307410_11123998 3300031852 Bacteria 682
343 Ga0307406_10031294 3300031901 Bacteria 3238
344 Ga0307406_11199806 3300031901 Bacteria 659
345 Ga0307412_10008057 3300031911 Bacteria 6003
346 Ga0307412_10556509 3300031911 Bacteria 964
347 Ga0307412_10558109 3300031911 Bacteria 963
348 Ga0307412_11143730 3300031911 Bacteria 695
349 Ga0307412_11576310 3300031911 Bacteria 599
350 Ga0307409_100376534 3300031995 Bacteria 1348
351 Ga0307409_102575018 3300031995 Bacteria 537
352 Ga0307416_100202898 3300032002 Bacteria 1883
353 Ga0307416_100216767 3300032002 Bacteria 1831
354 Ga0307416_100495964 3300032002 Bacteria 1284
355 Ga0307416_100918242 3300032002 Bacteria 976
356 Ga0307414_10671515 3300032004 Bacteria 936
357 Ga0307414_11079933 3300032004 Bacteria 741
358 Ga0307415_101611695 3300032126 Bacteria 624
359 Ga0307507_10318660 3300033179 Bacteria 938
360 Ga0307510_10224231 3300033180 Bacteria 1388
361 Ga0373948_0091304 3300034817 Bacteria 707
362 Ga0373953_0126769 3300035117 Bacteria 1087
363 Ga0373962_0057386 3300035242 Bacteria 1136
364 Ga0373931_0172706 3300035691 Bacteria 1275
365 Ga0373937_0215739 3300036401 Bacteria 1806
366 Ga0373925_0019503 3300037068 Bacteria 4934
367 Ga0395899_0168512 3300037312 Bacteria 1543
368 Ga0395900_0032376 3300037418 Bacteria 5377
369 Ga0395900_0036136 3300037418 Bacteria 5091
370 Ga0395900_0400919 3300037418 Bacteria 1336
371 Ga0395900_0595942 3300037418 Bacteria 1046
372 Ga0395898_0023156 3300037466 Bacteria 6278
373 Ga0395898_0035122 3300037466 Bacteria 4989
374 Ga0395905_0004208 3300037471 Bacteria 15056
375 Ga0395905_0009324 3300037471 Bacteria 9600
376 Ga0395905_0051309 3300037471 Bacteria 3863
377 Ga0395905_0097823 3300037471 Bacteria 2756
378 Ga0395905_0134600 3300037471 Bacteria 2324
379 Ga0395905_0152398 3300037471 Bacteria 2174
380 Ga0395905_0170283 3300037471 Bacteria 2045
381 Ga0436364_1129729 3300037853 Bacteria 513
382 Ga0395901_0055050 3300038443 Bacteria 4136
383 Ga0395901_0133122 3300038443 Bacteria 2612
384 Ga0395901_0457891 3300038443 Bacteria 1304
385 Ga0436365_0305753 3300039437 Bacteria 642
386 Ga0439465_0177572 3300041413 Bacteria 769
387 Ga0451787_580972 3300041441 Bacteria 535
388 Ga0451789_0579583 3300041443 Bacteria 1029
389 Ga0451789_1132921 3300041443 Bacteria 591
390 Ga0451789_1281024 3300041443 Bacteria 901
391 Ga0451791_1266385 3300041451 Bacteria 646
392 Ga0451791_1838390 3300041451 Bacteria 3287
393 Ga0451795_0489275 3300041456 Bacteria 617
394 Ga0451802_1640339 3300041460 Bacteria 535
395 Ga0451807_2264388 3300041486 Bacteria 521
396 Ga0451837_0439785 3300041494 Bacteria 713
397 Ga0451841_0609462 3300041498 Bacteria 529
398 Ga0451843_1258370 3300041509 Bacteria 1404
399 Ga0451843_1692436 3300041509 Bacteria 798
400 Ga0439431_0002851 3300041997 Bacteria 3803
401 Ga0439433_0068286 3300041999 Bacteria 854
402 Ga0439455_0073213 3300042012 Bacteria 923
403 Ga0439457_098107 3300042014 Bacteria 681
404 Ga0450919_001154 3300042121 Bacteria 3436
405 Ga0450898_017534 3300042134 Bacteria 1232
406 Ga0439446_0017968 3300042156 Bacteria 1977
407 Ga0439458_0057676 3300042157 Bacteria 966
408 Ga0439458_0113594 3300042157 Bacteria 709
409 Ga0439434_0214505 3300042435 Bacteria 652
410 Ga0439459_0095371 3300042438 Bacteria 721
411 Ga0450918_000077 3300042531 Bacteria 20527
412 Ga0451577_0967917 3300042876 Bacteria 765
413 Ga0451577_1453105 3300042876 Bacteria 607
414 Ga0451577_2011662 3300042876 Bacteria 505
415 Ga0453683_0001887 3300044673 Bacteria 17174
416 Ga0466965_0082018 3300044683 Bacteria 1631
417 Ga0466965_0104705 3300044683 Bacteria 1449
418 Ga0466965_0108421 3300044683 Bacteria 1425
419 Ga0466965_0348504 3300044683 Bacteria 811
420 Ga0466964_0468125 3300044706 Bacteria 671
421 Ga0453684_0073443 3300044712 Bacteria 4311
422 Ga0453684_0081347 3300044712 Bacteria 4040
423 Ga0453684_0184107 3300044712 Bacteria 2450
424 Ga0466971_0193211 3300044719 Bacteria 959
425 Ga0466959_0389704 3300045049 Bacteria 948
426 Ga0451576_0036711 3300045051 Bacteria 5193
427 Ga0451576_0052498 3300045051 Bacteria 4271
428 Ga0451576_1735305 3300045051 Bacteria 646
429 Ga0466958_0225498 3300045836 Bacteria 1196
430 Ga0495592_0329311 3300046454 Bacteria 985
431 Ga0495590_0014877 3300046457 Bacteria 2835
432 Ga0495651_0815238 3300046462 Bacteria 575
433 Ga0495605_0247092 3300046474 Bacteria 764
434 Ga0495584_0663400 3300046491 Bacteria 532
435 Ga0495632_0010535 3300046519 Bacteria 5464
436 Ga0495643_0074203 3300046522 Bacteria 1782
437 Ga0495663_0272364 3300046525 Bacteria 605
438 Ga0495609_0062134 3300046538 Bacteria 1650
439 Ga0495621_0008804 3300046539 Bacteria 3040
440 Ga0495621_0091217 3300046539 Bacteria 1148
441 Ga0495621_0240630 3300046539 Bacteria 737
442 Ga0495597_0016788 3300046542 Bacteria 3454
443 Ga0495597_0167068 3300046542 Bacteria 895
444 Ga0495656_0002859 3300046615 Bacteria 5785
445 Ga0495656_0240054 3300046615 Bacteria 912
446 Ga0495625_0040040 3300046660 Bacteria 3420
447 Ga0495625_0064915 3300046660 Bacteria 2574
448 Ga0495659_0347184 3300046664 Bacteria 634
449 Ga0495649_0005271 3300046694 Bacteria 8264
450 Ga0495660_0114748 3300046810 Bacteria 1370
451 Ga0495687_012354 3300047443 Bacteria 4520
452 Ga0495687_044055 3300047443 Bacteria 1941
453 Ga0495673_0148519 3300047469 Bacteria 908
454 Ga0495673_0364319 3300047469 Bacteria 508
455 Ga0495615_0007612 3300048090 Bacteria 2062
456 Ga0495615_0143056 3300048090 Bacteria 707
457 Ga0495626_0094233 3300048091 Bacteria 1313
458 Ga0495626_0095827 3300048091 Bacteria 1299
459 Ga0495626_0157371 3300048091 Bacteria 954
460 Ga0496100_0038094 3300048903 Bacteria 3044
461 Ga0496102_0037706 3300048905 Bacteria 4361
462 Ga0496102_0048128 3300048905 Bacteria 3876
463 Ga0496103_0039550 3300048906 Bacteria 2898
464 Ga0496104_0100676 3300048907 Bacteria 2766
465 Ga0496105_0047749 3300048908 Bacteria 3533
466 Ga0496106_0049724 3300048909 Bacteria 3159
467 Ga0496107_0321518 3300048910 Bacteria 1151
468 Ga0496107_0372979 3300048910 Bacteria 1061
469 Ga0496108_0385672 3300048911 Bacteria 1223
470 Ga0496109_1017406 3300048912 Bacteria 766
471 Ga0496110_0366592 3300048913 Bacteria 1312
472 Ga0496114_0374778 3300048917 Bacteria 1260
473 Ga0496114_0447338 3300048917 Bacteria 1144
474 Ga0496117_0093107 3300048920 Bacteria 1934
475 Ga0496122_0000331 3300048925 Bacteria 102617
476 Ga0496123_0001132 3300048926 Bacteria 39831
477 Ga0496125_0403710 3300048928 Bacteria 798
478 Ga0501292_025139 3300049515 Bacteria 980
479 Ga0501298_037990 3300049521 Bacteria 968
480 Ga0501033_0866648 3300049570 Bacteria 608
481 Ga0501039_0897324 3300049575 Bacteria 690
482 Ga0501047_0888307 3300049581 Bacteria 705
483 Ga0501206_009574 3300049653 Bacteria 1290
484 Ga0501217_089409 3300049661 Bacteria 863
485 Ga0501249_002182 3300049679 Bacteria 3988
486 Ga0501257_275022 3300049686 Bacteria 506
487 Ga0501241_125768 3300049758 Bacteria 573
488 Ga0501262_000434 3300049759 Bacteria 5015
489 Ga0501265_009467 3300049762 Bacteria 1178
490 Ga0501268_091137 3300049765 Bacteria 642
491 Ga0501281_17434 3300049777 Bacteria 540
492 Ga0501035_0124140 3300049822 Bacteria 2255
493 Ga0501044_0362476 3300049823 Bacteria 1367
494 Ga0501044_0399715 3300049823 Bacteria 1287
495 nmdc:mga03683_482575_c1 3300050489 Bacteria 599
496 nmdc:mga03683_606388_c1 3300050489 Bacteria 536
497 nmdc:mga03683_7058_c1 3300050489 Bacteria 3878
498 nmdc:mga03n38_387605_c1 3300050490 Bacteria 767
499 nmdc:mga03n38_414323_c1 3300050490 Bacteria 744
500 nmdc:mga03n38_807444_c1 3300050490 Bacteria 546
501 nmdc:mga00v17_15127_c1 3300050491 Bacteria 4326
502 nmdc:mga0yw44_36333_c1 3300050492 Bacteria 2902
503 nmdc:mga0yw44_78157_c1 3300050492 Bacteria 2069
504 nmdc:mga0k408_105757_c1 3300050493 Bacteria 1662
505 nmdc:mga0k408_202243_c1 3300050493 Bacteria 1186
506 nmdc:mga0k408_213_c1 3300050493 Bacteria 31180
507 nmdc:mga0k408_259002_c1 3300050493 Bacteria 1039
508 nmdc:mga0k408_26112_c1 3300050493 Bacteria 3311
509 nmdc:mga0k408_2734_c1 3300050493 Bacteria 9371
510 nmdc:mga0k408_288819_c1 3300050493 Bacteria 979
511 nmdc:mga0k408_4322_c1 3300050493 Bacteria 7542
512 nmdc:mga0k408_433646_c1 3300050493 Bacteria 781
513 nmdc:mga0k408_442693_c1 3300050493 Bacteria 772
514 nmdc:mga0k408_492795_c1 3300050493 Bacteria 726
515 nmdc:mga0k408_59469_c1 3300050493 Bacteria 2220
516 nmdc:mga0k408_73079_c1 3300050493 Bacteria 2003
517 nmdc:mga06z11_103140_c1 3300050494 Bacteria 1568
518 nmdc:mga06z11_194999_c1 3300050494 Bacteria 1174
519 nmdc:mga06z11_5202_c1 3300050494 Bacteria 5200
520 nmdc:mga06z11_906526_c1 3300050494 Bacteria 537
521 nmdc:mga04h51_434274_c1 3300050495 Bacteria 554
522 nmdc:mga04h51_68953_c1 3300050495 Bacteria 1230
523 nmdc:mga07m45_1209_c1 3300050496 Bacteria 11695
524 nmdc:mga07m45_142814_c1 3300050496 Bacteria 1387
525 nmdc:mga07m45_17182_c2 3300050496 Bacteria 1990
526 nmdc:mga07m45_19599_c1 3300050496 Bacteria 3667
527 nmdc:mga07m45_246016_c1 3300050496 Bacteria 1041
528 nmdc:mga07m45_277342_c1 3300050496 Bacteria 975
529 nmdc:mga07m45_378891_c1 3300050496 Bacteria 822
530 nmdc:mga07m45_477169_c1 3300050496 Bacteria 723
531 nmdc:mga07m45_7359_c1 3300050496 Bacteria 5622
532 nmdc:mga07m45_769_c1 3300050496 Bacteria 13783
533 nmdc:mga07m45_847_c1 3300050496 Bacteria 13276
534 nmdc:mga07m45_9115_c1 3300050496 Bacteria 5127
535 nmdc:mga09592_20553_c1 3300050508 Bacteria 5431
536 nmdc:mga09592_608040_c1 3300050508 Bacteria 936
537 nmdc:mga0qj67_308676_c1 3300050509 Bacteria 1281
538 nmdc:mga08y16_517723_c1 3300050511 Bacteria 1210
539 nmdc:mga08y16_725833_c1 3300050511 Bacteria 991
540 nmdc:mga0sz30_74644_c1 3300050516 Bacteria 1463
541 Ga0500578_0470340 3300053086 Bacteria 712
542 Ga0500644_0053501 3300053088 Bacteria 1394
543 Ga0500641_0087128 3300053096 Bacteria 1330
544 Ga0500650_0312279 3300053098 Bacteria 694
545 Ga0500562_026047 3300053108 Bacteria 1532
546 Ga0500594_0053068 3300053118 Bacteria 1147
547 Ga0500594_0152195 3300053118 Bacteria 744
548 Ga0500607_047273 3300053121 Bacteria 2304
549 Ga0500618_027589 3300053125 Bacteria 1350
550 Ga0500559_0012676 3300053136 Bacteria 3578
551 Ga0500559_0107388 3300053136 Bacteria 1291
552 Ga0500559_0235912 3300053136 Bacteria 862
553 Ga0500559_0597099 3300053136 Bacteria 500
554 Ga0500561_0297333 3300053137 Bacteria 515
555 Ga0500568_0010664 3300053139 Bacteria 4293
556 Ga0500568_0159761 3300053139 Bacteria 832
557 Ga0500577_0339546 3300053142 Bacteria 656
558 Ga0500586_122938 3300053145 Bacteria 902
559 Ga0500590_131561 3300053148 Bacteria 1157
560 Ga0500616_0116533 3300053153 Bacteria 1282
561 Ga0500620_041657 3300053155 Bacteria 1510
562 Ga0500622_0090798 3300053156 Bacteria 1516
563 Ga0500634_0055091 3300053161 Bacteria 2129
564 Ga0500645_016733 3300053730 Bacteria 2306
565 Ga0590071_009699 3300059421 Bacteria 2259
566 Ga0501082_1496217 3300060353 Bacteria 590
567 Ga0466962_0341192 3300061719 Bacteria 745
568 Ga0466962_0531282 3300061719 Bacteria 597

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041456 Ga0451795_0489275 Ga0451795_0489275_334_603 80
2 3300005354 Ga0070675_100375145 Ga0070675_1003751452 85
3 3300005356 Ga0070674_100952629 Ga0070674_1009526292 85
4 3300005456 Ga0070678_100040897 Ga0070678_1000408973 85
5 3300005543 Ga0070672_100528850 Ga0070672_1005288502 85
6 3300005548 Ga0070665_100059434 Ga0070665_1000594344 85
7 3300006048 Ga0075363_100147872 Ga0075363_1001478722 85
8 3300006237 Ga0097621_101608169 Ga0097621_1016081692 85
9 3300034817 Ga0373948_0091304 Ga0373948_0091304_19_294 85
10 3300035691 Ga0373931_0172706 Ga0373931_0172706_42_317 85
11 3300042876 Ga0451577_0967917 Ga0451577_0967917_341_613 85
12 3300044683 Ga0466965_0348504 Ga0466965_0348504_107_373 85
13 3300049570 Ga0501033_0866648 Ga0501033_0866648_138_404 85
14 3300049581 Ga0501047_0888307 Ga0501047_0888307_53_319 85
15 3300049823 Ga0501044_0362476 Ga0501044_0362476_134_400 85
16 3300050489 nmdc:mga03683_482575_c1 nmdc:mga03683_482575_c1_37_312 85
17 3300050490 nmdc:mga03n38_414323_c1 nmdc:mga03n38_414323_c1_343_618 85
18 3300050496 nmdc:mga07m45_277342_c1 nmdc:mga07m45_277342_c1_283_558 85
19 3300060353 Ga0501082_1496217 Ga0501082_1496217_150_416 85
20 3300005295 Ga0065707_10420912 Ga0065707_104209122 87
21 3300005330 Ga0070690_100241180 Ga0070690_1002411802 87
22 3300005333 Ga0070677_10560153 Ga0070677_105601532 87
23 3300005347 Ga0070668_101013468 Ga0070668_1010134682 87
24 3300005364 Ga0070673_102024709 Ga0070673_1020247092 87
25 3300005367 Ga0070667_100203686 Ga0070667_1002036863 87
26 3300005367 Ga0070667_100217035 Ga0070667_1002170352 87
27 3300005455 Ga0070663_100226653 Ga0070663_1002266532 87
28 3300005456 Ga0070678_100002501 Ga0070678_1000025017 87
29 3300005456 Ga0070678_100378071 Ga0070678_1003780712 87
30 3300005459 Ga0068867_100116187 Ga0068867_1001161874 87
31 3300005459 Ga0068867_101139239 Ga0068867_1011392392 87
32 3300005467 Ga0070706_100000700 Ga0070706_10000070024 87
33 3300005471 Ga0070698_100796762 Ga0070698_1007967622 87
34 3300005548 Ga0070665_102248670 Ga0070665_1022486701 87
35 3300005615 Ga0070702_101473544 Ga0070702_1014735441 87
36 3300005618 Ga0068864_100375946 Ga0068864_1003759462 87
37 3300005718 Ga0068866_10133847 Ga0068866_101338471 87
38 3300005841 Ga0068863_101064235 Ga0068863_1010642352 87
39 3300005841 Ga0068863_101273972 Ga0068863_1012739721 87
40 3300005843 Ga0068860_100144594 Ga0068860_1001445942 87
41 3300006048 Ga0075363_100032316 Ga0075363_1000323164 87
42 3300006177 Ga0075362_10039587 Ga0075362_100395871 87
43 3300006178 Ga0075367_10001893 Ga0075367_1000189311 87
44 3300006178 Ga0075367_10440801 Ga0075367_104408012 87
45 3300006195 Ga0075366_10016581 Ga0075366_100165812 87
46 3300006195 Ga0075366_10081601 Ga0075366_100816013 87
47 3300006195 Ga0075366_10386361 Ga0075366_103863612 87
48 3300006195 Ga0075366_10464950 Ga0075366_104649502 87
49 3300006237 Ga0097621_100092847 Ga0097621_1000928474 87
50 3300006353 Ga0075370_10018552 Ga0075370_100185524 87
51 3300006358 Ga0068871_100101604 Ga0068871_1001016042 87
52 3300006358 Ga0068871_100962461 Ga0068871_1009624612 87
53 3300009148 Ga0105243_10594657 Ga0105243_105946572 87
54 3300009148 Ga0105243_11385105 Ga0105243_113851052 87
55 3300009176 Ga0105242_10040790 Ga0105242_100407904 87
56 3300009176 Ga0105242_12790020 Ga0105242_127900202 87
57 3300009177 Ga0105248_11050995 Ga0105248_110509952 87
58 3300009553 Ga0105249_10070627 Ga0105249_100706272 87
59 3300009553 Ga0105249_11394989 Ga0105249_113949892 87
60 3300013308 Ga0157375_10375145 Ga0157375_103751452 87
61 3300014325 Ga0163163_11655891 Ga0163163_116558912 87
62 3300014497 Ga0182008_10163152 Ga0182008_101631522 87
63 3300014968 Ga0157379_10924213 Ga0157379_109242132 87
64 3300014969 Ga0157376_10079988 Ga0157376_100799883 87
65 3300017792 Ga0163161_10024999 Ga0163161_100249994 87
66 3300017792 Ga0163161_10945538 Ga0163161_109455382 87
67 3300025273 Ga0209673_1018116 Ga0209673_10181162 87
68 3300025294 Ga0209025_1005205 Ga0209025_10052052 87
69 3300025925 Ga0207650_10444755 Ga0207650_104447551 87
70 3300025926 Ga0207659_10259706 Ga0207659_102597063 87
71 3300025931 Ga0207644_10199913 Ga0207644_101999132 87
72 3300025934 Ga0207686_10089949 Ga0207686_100899492 87
73 3300025935 Ga0207709_11788719 Ga0207709_117887192 87
74 3300025937 Ga0207669_10004596 Ga0207669_100045965 87
75 3300025940 Ga0207691_10277074 Ga0207691_102770743 87
76 3300025941 Ga0207711_10160331 Ga0207711_101603312 87
77 3300025972 Ga0207668_10552187 Ga0207668_105521872 87
78 3300025986 Ga0207658_10054381 Ga0207658_100543815 87
79 3300025986 Ga0207658_11057474 Ga0207658_110574742 87
80 3300026088 Ga0207641_12018990 Ga0207641_120189901 87
81 3300026088 Ga0207641_12043259 Ga0207641_120432592 87
82 3300026089 Ga0207648_10145032 Ga0207648_101450322 87
83 3300026089 Ga0207648_10489116 Ga0207648_104891162 87
84 3300026121 Ga0207683_10004243 Ga0207683_100042431 87
85 3300027907 Ga0207428_10830146 Ga0207428_108301462 87
86 3300028379 Ga0268266_11784421 Ga0268266_117844212 87
87 3300028380 Ga0268265_10045754 Ga0268265_100457544 87
88 3300028381 Ga0268264_11356619 Ga0268264_113566192 87
89 3300031731 Ga0307405_11473784 Ga0307405_114737842 87
90 3300032004 Ga0307414_10671515 Ga0307414_106715152 87
91 3300037418 Ga0395900_0032376 Ga0395900_0032376_3726_3992 87
92 3300037418 Ga0395900_0400919 Ga0395900_0400919_1037_1303 87
93 3300037466 Ga0395898_0035122 Ga0395898_0035122_3498_3764 87
94 3300037471 Ga0395905_0009324 Ga0395905_0009324_5987_6253 87
95 3300037471 Ga0395905_0051309 Ga0395905_0051309_3187_3453 87
96 3300038443 Ga0395901_0055050 Ga0395901_0055050_726_992 87
97 3300038443 Ga0395901_0133122 Ga0395901_0133122_1514_1780 87
98 3300041441 Ga0451787_580972 Ga0451787_580972_256_522 87
99 3300041451 Ga0451791_1838390 Ga0451791_1838390_677_973 87
100 3300041498 Ga0451841_0609462 Ga0451841_0609462_216_482 87
101 3300044712 Ga0453684_0073443 Ga0453684_0073443_2116_2385 87
102 3300044719 Ga0466971_0193211 Ga0466971_0193211_445_711 87
103 3300045049 Ga0466959_0389704 Ga0466959_0389704_615_881 87
104 3300045051 Ga0451576_0052498 Ga0451576_0052498_2243_2512 87
105 3300045836 Ga0466958_0225498 Ga0466958_0225498_346_612 87
106 3300046539 Ga0495621_0008804 Ga0495621_0008804_1317_1583 87
107 3300050489 nmdc:mga03683_7058_c1 nmdc:mga03683_7058_c1_40_306 87
108 3300050493 nmdc:mga0k408_288819_c1 nmdc:mga0k408_288819_c1_324_590 87
109 3300050493 nmdc:mga0k408_433646_c1 nmdc:mga0k408_433646_c1_324_590 87
110 3300050493 nmdc:mga0k408_492795_c1 nmdc:mga0k408_492795_c1_262_528 87
111 3300050494 nmdc:mga06z11_906526_c1 nmdc:mga06z11_906526_c1_149_415 87
112 3300050511 nmdc:mga08y16_517723_c1 nmdc:mga08y16_517723_c1_520_786 87
113 3300061719 Ga0466962_0341192 Ga0466962_0341192_167_433 87
114 3300005327 Ga0070658_10189382 Ga0070658_101893823 88
115 3300005336 Ga0070680_100257070 Ga0070680_1002570702 88
116 3300005336 Ga0070680_101659497 Ga0070680_1016594971 88
117 3300005339 Ga0070660_100011683 Ga0070660_1000116837 88
118 3300005341 Ga0070691_10211487 Ga0070691_102114872 88
119 3300005344 Ga0070661_101494736 Ga0070661_1014947362 88
120 3300005356 Ga0070674_100012613 Ga0070674_1000126133 88
121 3300005458 Ga0070681_10278353 Ga0070681_102783533 88
122 3300005530 Ga0070679_100071451 Ga0070679_1000714513 88
123 3300005530 Ga0070679_100108545 Ga0070679_1001085451 88
124 3300005563 Ga0068855_100022812 Ga0068855_1000228125 88
125 3300006178 Ga0075367_10781875 Ga0075367_107818751 88
126 3300006358 Ga0068871_100262078 Ga0068871_1002620782 88
127 3300006946 Ga0079104_1027475 Ga0079104_10274752 88
128 3300006948 Ga0099826_10582353 Ga0099826_105823532 88
129 3300009093 Ga0105240_10005767 Ga0105240_1000576713 88
130 3300009551 Ga0105238_10028874 Ga0105238_100288747 88
131 3300013297 Ga0157378_12020785 Ga0157378_120207852 88
132 3300013306 Ga0163162_11239855 Ga0163162_112398552 88
133 3300025909 Ga0207705_10574485 Ga0207705_105744852 88
134 3300025912 Ga0207707_10875930 Ga0207707_108759301 88
135 3300025917 Ga0207660_10684877 Ga0207660_106848772 88
136 3300025919 Ga0207657_10037495 Ga0207657_100374957 88
137 3300025919 Ga0207657_11118319 Ga0207657_111183192 88
138 3300025921 Ga0207652_10058562 Ga0207652_100585623 88
139 3300025924 Ga0207694_10200773 Ga0207694_102007732 88
140 3300025929 Ga0207664_10151267 Ga0207664_101512672 88
141 3300025949 Ga0207667_10078799 Ga0207667_100787993 88
142 3300026078 Ga0207702_11788108 Ga0207702_117881082 88
143 3300028794 Ga0307515_10167093 Ga0307515_101670932 88
144 3300031456 Ga0307513_10185683 Ga0307513_101856833 88
145 3300031548 Ga0307408_100051410 Ga0307408_1000514102 88
146 3300031548 Ga0307408_100184612 Ga0307408_1001846122 88
147 3300031731 Ga0307405_10505413 Ga0307405_105054132 88
148 3300031911 Ga0307412_10558109 Ga0307412_105581092 88
149 3300032002 Ga0307416_100216767 Ga0307416_1002167674 88
150 3300032126 Ga0307415_101611695 Ga0307415_1016116951 88
151 3300036401 Ga0373937_0215739 Ga0373937_0215739_1084_1350 88
152 3300037312 Ga0395899_0168512 Ga0395899_0168512_388_657 88
153 3300037466 Ga0395898_0023156 Ga0395898_0023156_4972_5241 88
154 3300037471 Ga0395905_0004208 Ga0395905_0004208_8619_8885 88
155 3300038443 Ga0395901_0457891 Ga0395901_0457891_369_635 88
156 3300042876 Ga0451577_1453105 Ga0451577_1453105_210_494 88
157 3300044712 Ga0453684_0184107 Ga0453684_0184107_2085_2351 88
158 3300048905 Ga0496102_0037706 Ga0496102_0037706_1735_2001 88
159 3300049575 Ga0501039_0897324 Ga0501039_0897324_310_576 88
160 3300049661 Ga0501217_089409 Ga0501217_089409_317_583 88
161 3300049765 Ga0501268_091137 Ga0501268_091137_365_631 88
162 3300053139 Ga0500568_0159761 Ga0500568_0159761_494_760 88
163 3300053142 Ga0500577_0339546 Ga0500577_0339546_260_529 88
164 3300053145 Ga0500586_122938 Ga0500586_122938_204_473 88
165 3300053153 Ga0500616_0116533 Ga0500616_0116533_670_939 88
166 3300053161 Ga0500634_0055091 Ga0500634_0055091_953_1219 88
167 iso_pu_bacteria 2643221644 2644244845 88
168 3300005295 Ga0065707_10537994 Ga0065707_105379941 89
169 3300005339 Ga0070660_100000354 Ga0070660_10000035421 89
170 3300005344 Ga0070661_100003595 Ga0070661_10000359510 89
171 3300005353 Ga0070669_100291715 Ga0070669_1002917152 89
172 3300005354 Ga0070675_100223409 Ga0070675_1002234093 89
173 3300005366 Ga0070659_100000846 Ga0070659_10000084622 89
174 3300005455 Ga0070663_101466481 Ga0070663_1014664812 89
175 3300005457 Ga0070662_100001973 Ga0070662_1000019739 89
176 3300005530 Ga0070679_100727819 Ga0070679_1007278192 89
177 3300005548 Ga0070665_101141059 Ga0070665_1011410591 89
178 3300005616 Ga0068852_100229803 Ga0068852_1002298032 89
179 3300005843 Ga0068860_100302219 Ga0068860_1003022193 89
180 3300006051 Ga0075364_10523274 Ga0075364_105232742 89
181 3300006177 Ga0075362_10351383 Ga0075362_103513832 89
182 3300006195 Ga0075366_10013712 Ga0075366_100137123 89
183 3300009094 Ga0111539_13082756 Ga0111539_130827561 89
184 3300009553 Ga0105249_10875767 Ga0105249_108757672 89
185 3300013306 Ga0163162_12089884 Ga0163162_120898842 89
186 3300014325 Ga0163163_10389797 Ga0163163_103897972 89
187 3300014326 Ga0157380_10302114 Ga0157380_103021142 89
188 3300014497 Ga0182008_10003005 Ga0182008_1000300513 89
189 3300014968 Ga0157379_10088429 Ga0157379_100884293 89
190 3300021384 Ga0213876_10537746 Ga0213876_105377462 89
191 3300025919 Ga0207657_10005778 Ga0207657_100057783 89
192 3300025920 Ga0207649_10010407 Ga0207649_100104074 89
193 3300025922 Ga0207646_10408677 Ga0207646_104086772 89
194 3300025932 Ga0207690_10003760 Ga0207690_100037605 89
195 3300028381 Ga0268264_10298458 Ga0268264_102984583 89
196 3300030734 Ga0316179_1109249 Ga0316179_11092492 89
197 3300030735 Ga0316178_1010462 Ga0316178_10104622 89
198 3300030742 Ga0316183_1067419 Ga0316183_10674194 89
199 3300031251 Ga0265327_10249184 Ga0265327_102491842 89
200 3300031507 Ga0307509_10472816 Ga0307509_104728162 89
201 3300031730 Ga0307516_10649421 Ga0307516_106494212 89
202 3300031731 Ga0307405_10098893 Ga0307405_100988933 89
203 3300031731 Ga0307405_10444329 Ga0307405_104443292 89
204 3300031852 Ga0307410_11123998 Ga0307410_111239981 89
205 3300031995 Ga0307409_102575018 Ga0307409_1025750182 89
206 3300032004 Ga0307414_11079933 Ga0307414_110799332 89
207 3300037418 Ga0395900_0036136 Ga0395900_0036136_182_454 89
208 3300037471 Ga0395905_0134600 Ga0395905_0134600_18_290 89
209 3300039437 Ga0436365_0305753 Ga0436365_0305753_193_465 89
210 3300041486 Ga0451807_2264388 Ga0451807_2264388_236_505 89
211 3300041999 Ga0439433_0068286 Ga0439433_0068286_411_680 89
212 3300042157 Ga0439458_0113594 Ga0439458_0113594_247_516 89
213 3300042876 Ga0451577_2011662 Ga0451577_2011662_186_455 89
214 3300045051 Ga0451576_1735305 Ga0451576_1735305_49_318 89
215 3300046664 Ga0495659_0347184 Ga0495659_0347184_206_496 89
216 3300050489 nmdc:mga03683_606388_c1 nmdc:mga03683_606388_c1_101_370 89
217 3300050493 nmdc:mga0k408_73079_c1 nmdc:mga0k408_73079_c1_262_531 89
218 3300050511 nmdc:mga08y16_725833_c1 nmdc:mga08y16_725833_c1_627_896 89
219 3300053088 Ga0500644_0053501 Ga0500644_0053501_404_676 89
220 3300053096 Ga0500641_0087128 Ga0500641_0087128_373_642 89
221 3300053108 Ga0500562_026047 Ga0500562_026047_558_830 89
222 3300053118 Ga0500594_0152195 Ga0500594_0152195_260_535 89
223 3300053137 Ga0500561_0297333 Ga0500561_0297333_218_487 89
224 3300053730 Ga0500645_016733 Ga0500645_016733_432_701 89
225 iso_pu_bacteria 2842747753 2842752555 89
226 iso_pu_bacteria 2929520902 2929522829 89
227 iso_pu_bacteria 2945972063 2945975574 89
228 3300006048 Ga0075363_100509999 Ga0075363_1005099992 90
229 3300006195 Ga0075366_10001135 Ga0075366_100011352 90
230 3300006195 Ga0075366_10098006 Ga0075366_100980062 90
231 3300006353 Ga0075370_10000133 Ga0075370_100001337 90
232 3300006353 Ga0075370_10018072 Ga0075370_100180722 90
233 3300006353 Ga0075370_10031408 Ga0075370_100314083 90
234 3300006353 Ga0075370_10541309 Ga0075370_105413092 90
235 3300009176 Ga0105242_10626225 Ga0105242_106262252 90
236 3300010375 Ga0105239_11237757 Ga0105239_112377572 90
237 3300013306 Ga0163162_10381931 Ga0163162_103819312 90
238 3300014325 Ga0163163_11403514 Ga0163163_114035142 90
239 3300014326 Ga0157380_11989588 Ga0157380_119895882 90
240 3300014497 Ga0182008_10010313 Ga0182008_100103135 90
241 3300015261 Ga0182006_1023558 Ga0182006_10235583 90
242 3300015262 Ga0182007_10004805 Ga0182007_100048052 90
243 3300025903 Ga0207680_10357255 Ga0207680_103572552 90
244 3300025931 Ga0207644_11746402 Ga0207644_117464022 90
245 3300025933 Ga0207706_10005101 Ga0207706_1000510111 90
246 3300026023 Ga0207677_10666631 Ga0207677_106666312 90
247 3300028380 Ga0268265_10244673 Ga0268265_102446732 90
248 3300028786 Ga0307517_10191648 Ga0307517_101916481 90
249 3300028786 Ga0307517_10224930 Ga0307517_102249302 90
250 3300028794 Ga0307515_10102481 Ga0307515_101024813 90
251 3300028794 Ga0307515_10393770 Ga0307515_103937702 90
252 3300030522 Ga0307512_10305016 Ga0307512_103050162 90
253 3300031456 Ga0307513_10315173 Ga0307513_103151732 90
254 3300031548 Ga0307408_100081760 Ga0307408_1000817604 90
255 3300031616 Ga0307508_10246616 Ga0307508_102466162 90
256 3300031649 Ga0307514_10080793 Ga0307514_100807932 90
257 3300031731 Ga0307405_10179159 Ga0307405_101791592 90
258 3300031901 Ga0307406_10031294 Ga0307406_100312944 90
259 3300031901 Ga0307406_11199806 Ga0307406_111998062 90
260 3300031911 Ga0307412_10556509 Ga0307412_105565092 90
261 3300031911 Ga0307412_11143730 Ga0307412_111437302 90
262 3300031911 Ga0307412_11576310 Ga0307412_115763101 90
263 3300032002 Ga0307416_100202898 Ga0307416_1002028982 90
264 3300032002 Ga0307416_100495964 Ga0307416_1004959643 90
265 3300032002 Ga0307416_100918242 Ga0307416_1009182422 90
266 3300033180 Ga0307510_10224231 Ga0307510_102242313 90
267 3300035242 Ga0373962_0057386 Ga0373962_0057386_354_629 90
268 3300037853 Ga0436364_1129729 Ga0436364_1129729_53_325 90
269 3300041443 Ga0451789_0579583 Ga0451789_0579583_81_353 90
270 3300041443 Ga0451789_1281024 Ga0451789_1281024_300_581 90
271 3300041451 Ga0451791_1266385 Ga0451791_1266385_47_319 90
272 3300041460 Ga0451802_1640339 Ga0451802_1640339_124_405 90
273 3300041494 Ga0451837_0439785 Ga0451837_0439785_297_569 90
274 3300041509 Ga0451843_1692436 Ga0451843_1692436_287_595 90
275 3300042157 Ga0439458_0057676 Ga0439458_0057676_643_921 90
276 3300044683 Ga0466965_0108421 Ga0466965_0108421_554_829 90
277 3300046525 Ga0495663_0272364 Ga0495663_0272364_77_358 90
278 3300046538 Ga0495609_0062134 Ga0495609_0062134_1264_1545 90
279 3300046660 Ga0495625_0064915 Ga0495625_0064915_2116_2397 90
280 3300047469 Ga0495673_0364319 Ga0495673_0364319_11_292 90
281 3300048903 Ga0496100_0038094 Ga0496100_0038094_468_761 90
282 3300048905 Ga0496102_0048128 Ga0496102_0048128_746_1039 90
283 3300048906 Ga0496103_0039550 Ga0496103_0039550_1486_1779 90
284 3300048907 Ga0496104_0100676 Ga0496104_0100676_1059_1352 90
285 3300048908 Ga0496105_0047749 Ga0496105_0047749_2369_2662 90
286 3300048909 Ga0496106_0049724 Ga0496106_0049724_2054_2347 90
287 3300048910 Ga0496107_0321518 Ga0496107_0321518_445_738 90
288 3300048910 Ga0496107_0372979 Ga0496107_0372979_32_325 90
289 3300048911 Ga0496108_0385672 Ga0496108_0385672_348_641 90
290 3300048912 Ga0496109_1017406 Ga0496109_1017406_45_338 90
291 3300048913 Ga0496110_0366592 Ga0496110_0366592_467_760 90
292 3300049515 Ga0501292_025139 Ga0501292_025139_337_630 90
293 3300049521 Ga0501298_037990 Ga0501298_037990_72_365 90
294 3300049653 Ga0501206_009574 Ga0501206_009574_955_1248 90
295 3300049762 Ga0501265_009467 Ga0501265_009467_177_470 90
296 3300049777 Ga0501281_17434 Ga0501281_17434_70_363 90
297 3300050490 nmdc:mga03n38_807444_c1 nmdc:mga03n38_807444_c1_264_536 90
298 3300050493 nmdc:mga0k408_105757_c1 nmdc:mga0k408_105757_c1_1139_1423 90
299 3300050493 nmdc:mga0k408_259002_c1 nmdc:mga0k408_259002_c1_616_888 90
300 3300050493 nmdc:mga0k408_2734_c1 nmdc:mga0k408_2734_c1_546_827 90
301 3300050496 nmdc:mga07m45_1209_c1 nmdc:mga07m45_1209_c1_10649_10933 90
302 3300050496 nmdc:mga07m45_142814_c1 nmdc:mga07m45_142814_c1_361_669 90
303 3300050496 nmdc:mga07m45_477169_c1 nmdc:mga07m45_477169_c1_392_664 90
304 3300050496 nmdc:mga07m45_847_c1 nmdc:mga07m45_847_c1_12898_13179 90
305 3300050496 nmdc:mga07m45_9115_c1 nmdc:mga07m45_9115_c1_3831_4103 90
306 3300053139 Ga0500568_0010664 Ga0500568_0010664_1734_2015 90
307 3300059421 Ga0590071_009699 Ga0590071_009699_647_919 90
308 iso_pu_bacteria 2945945610 2945945954 90
309 3300005327 Ga0070658_10386016 Ga0070658_103860162 91
310 3300005328 Ga0070676_11448723 Ga0070676_114487232 91
311 3300005330 Ga0070690_100917644 Ga0070690_1009176442 91
312 3300005333 Ga0070677_10310172 Ga0070677_103101722 91
313 3300005333 Ga0070677_10539574 Ga0070677_105395742 91
314 3300005334 Ga0068869_100135993 Ga0068869_1001359933 91
315 3300005335 Ga0070666_10413270 Ga0070666_104132702 91
316 3300005337 Ga0070682_100266161 Ga0070682_1002661612 91
317 3300005338 Ga0068868_100522906 Ga0068868_1005229062 91
318 3300005339 Ga0070660_101051185 Ga0070660_1010511852 91
319 3300005340 Ga0070689_100392442 Ga0070689_1003924422 91
320 3300005347 Ga0070668_100118282 Ga0070668_1001182823 91
321 3300005354 Ga0070675_100001027 Ga0070675_1000010275 91
322 3300005354 Ga0070675_100444581 Ga0070675_1004445813 91
323 3300005366 Ga0070659_100232449 Ga0070659_1002324491 91
324 3300005367 Ga0070667_100002153 Ga0070667_10000215310 91
325 3300005438 Ga0070701_10519980 Ga0070701_105199802 91
326 3300005456 Ga0070678_100234279 Ga0070678_1002342792 91
327 3300005456 Ga0070678_101387395 Ga0070678_1013873952 91
328 3300005457 Ga0070662_100089754 Ga0070662_1000897544 91
329 3300005459 Ga0068867_100865244 Ga0068867_1008652442 91
330 3300005459 Ga0068867_100930765 Ga0068867_1009307651 91
331 3300005539 Ga0068853_100037877 Ga0068853_1000378775 91
332 3300005548 Ga0070665_100407372 Ga0070665_1004073723 91
333 3300005563 Ga0068855_100136450 Ga0068855_1001364503 91
334 3300005577 Ga0068857_100032539 Ga0068857_1000325395 91
335 3300005578 Ga0068854_100124186 Ga0068854_1001241864 91
336 3300005617 Ga0068859_100909238 Ga0068859_1009092383 91
337 3300005617 Ga0068859_102289782 Ga0068859_1022897822 91
338 3300005841 Ga0068863_100892422 Ga0068863_1008924222 91
339 3300005842 Ga0068858_101152333 Ga0068858_1011523332 91
340 3300005843 Ga0068860_100437468 Ga0068860_1004374683 91
341 3300006038 Ga0075365_10778261 Ga0075365_107782612 91
342 3300006042 Ga0075368_10026642 Ga0075368_100266422 91
343 3300006048 Ga0075363_100140039 Ga0075363_1001400393 91
344 3300006051 Ga0075364_10066367 Ga0075364_100663674 91
345 3300006051 Ga0075364_10638315 Ga0075364_106383152 91
346 3300006177 Ga0075362_10006678 Ga0075362_100066784 91
347 3300006177 Ga0075362_10049615 Ga0075362_100496151 91
348 3300006177 Ga0075362_10111742 Ga0075362_101117422 91
349 3300006178 Ga0075367_10023179 Ga0075367_100231795 91
350 3300006186 Ga0075369_10022389 Ga0075369_100223893 91
351 3300006186 Ga0075369_10067475 Ga0075369_100674753 91
352 3300006195 Ga0075366_10020149 Ga0075366_100201493 91
353 3300006195 Ga0075366_10191090 Ga0075366_101910902 91
354 3300006195 Ga0075366_10565077 Ga0075366_105650772 91
355 3300006237 Ga0097621_102190406 Ga0097621_1021904061 91
356 3300006353 Ga0075370_10001450 Ga0075370_1000145014 91
357 3300006353 Ga0075370_10010864 Ga0075370_100108644 91
358 3300006353 Ga0075370_10455059 Ga0075370_104550592 91
359 3300006353 Ga0075370_10466502 Ga0075370_104665022 91
360 3300006353 Ga0075370_10793026 Ga0075370_107930261 91
361 3300006931 Ga0097620_100909225 Ga0097620_1009092253 91
362 3300006931 Ga0097620_102290545 Ga0097620_1022905452 91
363 3300009093 Ga0105240_10302814 Ga0105240_103028142 91
364 3300009094 Ga0111539_11968237 Ga0111539_119682371 91
365 3300009098 Ga0105245_12278214 Ga0105245_122782142 91
366 3300009177 Ga0105248_10119058 Ga0105248_101190583 91
367 3300009545 Ga0105237_10005313 Ga0105237_1000531313 91
368 3300009551 Ga0105238_11005752 Ga0105238_110057521 91
369 3300010375 Ga0105239_10101058 Ga0105239_101010585 91
370 3300013308 Ga0157375_10240126 Ga0157375_102401263 91
371 3300013308 Ga0157375_11218252 Ga0157375_112182522 91
372 3300014326 Ga0157380_10556801 Ga0157380_105568012 91
373 3300014968 Ga0157379_10174942 Ga0157379_101749423 91
374 3300017792 Ga0163161_10209265 Ga0163161_102092653 91
375 3300025256 Ga0209759_1001977 Ga0209759_10019775 91
376 3300025893 Ga0207682_10384251 Ga0207682_103842512 91
377 3300025907 Ga0207645_10048479 Ga0207645_100484792 91
378 3300025907 Ga0207645_10052162 Ga0207645_100521623 91
379 3300025913 Ga0207695_10372588 Ga0207695_103725883 91
380 3300025914 Ga0207671_10099308 Ga0207671_100993084 91
381 3300025919 Ga0207657_11501069 Ga0207657_115010692 91
382 3300025923 Ga0207681_10375818 Ga0207681_103758181 91
383 3300025925 Ga0207650_10375931 Ga0207650_103759312 91
384 3300025925 Ga0207650_10946980 Ga0207650_109469801 91
385 3300025926 Ga0207659_10245191 Ga0207659_102451913 91
386 3300025926 Ga0207659_10635188 Ga0207659_106351883 91
387 3300025927 Ga0207687_10313050 Ga0207687_103130502 91
388 3300025933 Ga0207706_10058552 Ga0207706_100585525 91
389 3300025933 Ga0207706_11151867 Ga0207706_111518671 91
390 3300025935 Ga0207709_10147683 Ga0207709_101476832 91
391 3300025940 Ga0207691_10042442 Ga0207691_100424423 91
392 3300025942 Ga0207689_10026426 Ga0207689_100264265 91
393 3300025949 Ga0207667_10135305 Ga0207667_101353053 91
394 3300025981 Ga0207640_10238457 Ga0207640_102384573 91
395 3300025981 Ga0207640_10357000 Ga0207640_103570002 91
396 3300025986 Ga0207658_10001079 Ga0207658_1000107913 91
397 3300026023 Ga0207677_10568457 Ga0207677_105684572 91
398 3300026041 Ga0207639_10098896 Ga0207639_100988965 91
399 3300026089 Ga0207648_10220707 Ga0207648_102207074 91
400 3300026116 Ga0207674_10029917 Ga0207674_100299175 91
401 3300026121 Ga0207683_11006933 Ga0207683_110069332 91
402 3300027866 Ga0209813_10037472 Ga0209813_100374723 91
403 3300028379 Ga0268266_10087578 Ga0268266_100875784 91
404 3300028379 Ga0268266_11490230 Ga0268266_114902301 91
405 3300028380 Ga0268265_11596099 Ga0268265_115960991 91
406 3300028381 Ga0268264_10136557 Ga0268264_101365572 91
407 3300028381 Ga0268264_10629152 Ga0268264_106291521 91
408 3300030522 Ga0307512_10201555 Ga0307512_102015552 91
409 3300031456 Ga0307513_10004582 Ga0307513_1000458212 91
410 3300031649 Ga0307514_10000928 Ga0307514_1000092810 91
411 3300031730 Ga0307516_10087584 Ga0307516_100875842 91
412 3300035117 Ga0373953_0126769 Ga0373953_0126769_510_785 91
413 3300037068 Ga0373925_0019503 Ga0373925_0019503_47_322 91
414 3300041509 Ga0451843_1258370 Ga0451843_1258370_821_1096 91
415 3300042012 Ga0439455_0073213 Ga0439455_0073213_275_559 91
416 3300044673 Ga0453683_0001887 Ga0453683_0001887_2517_2810 91
417 3300045051 Ga0451576_0036711 Ga0451576_0036711_720_1013 91
418 3300046457 Ga0495590_0014877 Ga0495590_0014877_157_444 91
419 3300046474 Ga0495605_0247092 Ga0495605_0247092_287_574 91
420 3300046491 Ga0495584_0663400 Ga0495584_0663400_153_440 91
421 3300046519 Ga0495632_0010535 Ga0495632_0010535_2302_2589 91
422 3300046522 Ga0495643_0074203 Ga0495643_0074203_411_704 91
423 3300046542 Ga0495597_0016788 Ga0495597_0016788_574_867 91
424 3300046542 Ga0495597_0167068 Ga0495597_0167068_423_710 91
425 3300046615 Ga0495656_0240054 Ga0495656_0240054_320_595 91
426 3300046660 Ga0495625_0040040 Ga0495625_0040040_722_1009 91
427 3300046694 Ga0495649_0005271 Ga0495649_0005271_6133_6420 91
428 3300046810 Ga0495660_0114748 Ga0495660_0114748_567_854 91
429 3300047443 Ga0495687_012354 Ga0495687_012354_2608_2901 91
430 3300047443 Ga0495687_044055 Ga0495687_044055_133_420 91
431 3300047469 Ga0495673_0148519 Ga0495673_0148519_14_301 91
432 3300048090 Ga0495615_0007612 Ga0495615_0007612_1660_1935 91
433 3300048091 Ga0495626_0094233 Ga0495626_0094233_848_1141 91
434 3300048091 Ga0495626_0095827 Ga0495626_0095827_217_504 91
435 3300048091 Ga0495626_0157371 Ga0495626_0157371_467_754 91
436 3300048917 Ga0496114_0374778 Ga0496114_0374778_428_727 91
437 3300049758 Ga0501241_125768 Ga0501241_125768_177_479 91
438 3300049822 Ga0501035_0124140 Ga0501035_0124140_1557_1832 91
439 3300050490 nmdc:mga03n38_387605_c1 nmdc:mga03n38_387605_c1_112_405 91
440 3300050491 nmdc:mga00v17_15127_c1 nmdc:mga00v17_15127_c1_2318_2611 91
441 3300050492 nmdc:mga0yw44_78157_c1 nmdc:mga0yw44_78157_c1_313_600 91
442 3300050493 nmdc:mga0k408_202243_c1 nmdc:mga0k408_202243_c1_307_597 91
443 3300050493 nmdc:mga0k408_213_c1 nmdc:mga0k408_213_c1_19584_19871 91
444 3300050493 nmdc:mga0k408_26112_c1 nmdc:mga0k408_26112_c1_2957_3247 91
445 3300050493 nmdc:mga0k408_4322_c1 nmdc:mga0k408_4322_c1_5597_5890 91
446 3300050493 nmdc:mga0k408_442693_c1 nmdc:mga0k408_442693_c1_379_669 91
447 3300050493 nmdc:mga0k408_59469_c1 nmdc:mga0k408_59469_c1_344_625 91
448 3300050494 nmdc:mga06z11_103140_c1 nmdc:mga06z11_103140_c1_226_507 91
449 3300050494 nmdc:mga06z11_194999_c1 nmdc:mga06z11_194999_c1_139_432 91
450 3300050494 nmdc:mga06z11_5202_c1 nmdc:mga06z11_5202_c1_76_363 91
451 3300050495 nmdc:mga04h51_434274_c1 nmdc:mga04h51_434274_c1_192_479 91
452 3300050495 nmdc:mga04h51_68953_c1 nmdc:mga04h51_68953_c1_528_818 91
453 3300050496 nmdc:mga07m45_19599_c1 nmdc:mga07m45_19599_c1_2010_2303 91
454 3300050496 nmdc:mga07m45_246016_c1 nmdc:mga07m45_246016_c1_573_863 91
455 3300050496 nmdc:mga07m45_378891_c1 nmdc:mga07m45_378891_c1_103_393 91
456 3300050496 nmdc:mga07m45_7359_c1 nmdc:mga07m45_7359_c1_1620_1901 91
457 3300050496 nmdc:mga07m45_769_c1 nmdc:mga07m45_769_c1_2888_3175 91
458 3300050516 nmdc:mga0sz30_74644_c1 nmdc:mga0sz30_74644_c1_1086_1373 91
459 3300053086 Ga0500578_0470340 Ga0500578_0470340_142_429 91
460 3300053098 Ga0500650_0312279 Ga0500650_0312279_273_560 91
461 3300003544 Ga0007417J51691_1110541 Ga0007417J51691_11105412 92
462 3300003761 Ga0055535_1007416 Ga0055535_10074162 92
463 3300005331 Ga0070670_101744585 Ga0070670_1017445852 92
464 3300005354 Ga0070675_100341061 Ga0070675_1003410611 92
465 3300005365 Ga0070688_101487132 Ga0070688_1014871322 92
466 3300005459 Ga0068867_101063080 Ga0068867_1010630802 92
467 3300005841 Ga0068863_100191568 Ga0068863_1001915681 92
468 3300005841 Ga0068863_101283499 Ga0068863_1012834992 92
469 3300005844 Ga0068862_100663517 Ga0068862_1006635171 92
470 3300006038 Ga0075365_10066115 Ga0075365_100661154 92
471 3300006186 Ga0075369_10340690 Ga0075369_103406902 92
472 3300006237 Ga0097621_100663252 Ga0097621_1006632522 92
473 3300006358 Ga0068871_100399973 Ga0068871_1003999732 92
474 3300006846 Ga0075430_100013420 Ga0075430_1000134204 92
475 3300006880 Ga0075429_100001318 Ga0075429_10000131817 92
476 3300009545 Ga0105237_10068698 Ga0105237_100686984 92
477 3300011119 Ga0105246_11157157 Ga0105246_111571572 92
478 3300014325 Ga0163163_11132473 Ga0163163_111324732 92
479 3300014969 Ga0157376_11403641 Ga0157376_114036412 92
480 3300014969 Ga0157376_11559935 Ga0157376_115599352 92
481 3300025291 Ga0209675_1038104 Ga0209675_10381041 92
482 3300025299 Ga0209256_1000049 Ga0209256_100004947 92
483 3300025923 Ga0207681_10336926 Ga0207681_103369261 92
484 3300025927 Ga0207687_10904539 Ga0207687_109045391 92
485 3300025961 Ga0207712_10484676 Ga0207712_104846762 92
486 3300026095 Ga0207676_11421137 Ga0207676_114211372 92
487 3300027682 Ga0209971_1135612 Ga0209971_11356121 92
488 3300031507 Ga0307509_10051823 Ga0307509_100518235 92
489 3300031616 Ga0307508_10136659 Ga0307508_101366593 92
490 3300031730 Ga0307516_10002259 Ga0307516_1000225918 92
491 3300031911 Ga0307412_10008057 Ga0307412_100080579 92
492 3300033179 Ga0307507_10318660 Ga0307507_103186601 92
493 3300041413 Ga0439465_0177572 Ga0439465_0177572_267_545 92
494 3300041997 Ga0439431_0002851 Ga0439431_0002851_1612_1890 92
495 3300042014 Ga0439457_098107 Ga0439457_098107_235_630 92
496 3300042121 Ga0450919_001154 Ga0450919_001154_2059_2337 92
497 3300042134 Ga0450898_017534 Ga0450898_017534_466_825 92
498 3300042156 Ga0439446_0017968 Ga0439446_0017968_1030_1371 92
499 3300042435 Ga0439434_0214505 Ga0439434_0214505_272_550 92
500 3300042438 Ga0439459_0095371 Ga0439459_0095371_88_465 92
501 3300042531 Ga0450918_000077 Ga0450918_000077_19042_19320 92
502 3300044712 Ga0453684_0081347 Ga0453684_0081347_2389_2667 92
503 3300046462 Ga0495651_0815238 Ga0495651_0815238_210_488 92
504 3300046539 Ga0495621_0240630 Ga0495621_0240630_49_366 92
505 3300048917 Ga0496114_0447338 Ga0496114_0447338_755_1033 92
506 3300048925 Ga0496122_0000331 Ga0496122_0000331_69051_69365 92
507 3300048926 Ga0496123_0001132 Ga0496123_0001132_34154_34468 92
508 3300049679 Ga0501249_002182 Ga0501249_002182_2477_2779 92
509 3300049759 Ga0501262_000434 Ga0501262_000434_2388_2690 92
510 3300050492 nmdc:mga0yw44_36333_c1 nmdc:mga0yw44_36333_c1_1730_2023 92
511 3300050496 nmdc:mga07m45_17182_c2 nmdc:mga07m45_17182_c2_924_1202 92
512 3300050508 nmdc:mga09592_20553_c1 nmdc:mga09592_20553_c1_2066_2380 92
513 3300053118 Ga0500594_0053068 Ga0500594_0053068_696_983 92
514 3300053125 Ga0500618_027589 Ga0500618_027589_442_750 92
515 3300053136 Ga0500559_0012676 Ga0500559_0012676_2569_2856 92
516 3300053136 Ga0500559_0235912 Ga0500559_0235912_103_381 92
517 3300053148 Ga0500590_131561 Ga0500590_131561_741_1022 92
518 3300053155 Ga0500620_041657 Ga0500620_041657_1008_1286 92
519 3300006058 Ga0075432_10007264 Ga0075432_100072646 93
520 3300025242 Ga0209258_100489 Ga0209258_1004896 93
521 3300025923 Ga0207681_10011235 Ga0207681_100112351 93
522 3300025940 Ga0207691_10265054 Ga0207691_102650543 93
523 3300027907 Ga0207428_10398673 Ga0207428_103986732 93
524 3300028794 Ga0307515_10079492 Ga0307515_100794924 93
525 3300031456 Ga0307513_10002473 Ga0307513_1000247311 93
526 3300031456 Ga0307513_10616172 Ga0307513_106161722 93
527 3300037471 Ga0395905_0097823 Ga0395905_0097823_1315_1596 93
528 3300041443 Ga0451789_1132921 Ga0451789_1132921_47_355 93
529 3300044683 Ga0466965_0082018 Ga0466965_0082018_1220_1501 93
530 3300044706 Ga0466964_0468125 Ga0466964_0468125_46_327 93
531 3300046454 Ga0495592_0329311 Ga0495592_0329311_582_875 93
532 3300048920 Ga0496117_0093107 Ga0496117_0093107_108_425 93
533 3300048928 Ga0496125_0403710 Ga0496125_0403710_314_607 93
534 3300053136 Ga0500559_0107388 Ga0500559_0107388_922_1227 93
535 3300053156 Ga0500622_0090798 Ga0500622_0090798_159_464 93
536 3300061719 Ga0466962_0531282 Ga0466962_0531282_20_301 93
537 3300003792 Ga0055540_1006805 Ga0055540_10068055 94
538 3300003794 Ga0055531_10001090 Ga0055531_1000109018 94
539 3300009176 Ga0105242_13024558 Ga0105242_130245581 94
540 3300025273 Ga0209673_1020479 Ga0209673_10204794 94
541 3300025303 Ga0209051_1000456 Ga0209051_10004565 94
542 3300025304 Ga0209257_1000015 Ga0209257_1000015835 94
543 3300044683 Ga0466965_0104705 Ga0466965_0104705_863_1165 94
544 3300046539 Ga0495621_0091217 Ga0495621_0091217_559_867 94
545 3300046615 Ga0495656_0002859 Ga0495656_0002859_1637_1945 94
546 3300048090 Ga0495615_0143056 Ga0495615_0143056_290_598 94
547 3300050508 nmdc:mga09592_608040_c1 nmdc:mga09592_608040_c1_466_768 94
548 3300050509 nmdc:mga0qj67_308676_c1 nmdc:mga0qj67_308676_c1_363_665 94
549 3300009553 Ga0105249_10205185 Ga0105249_102051853 95
550 3300037471 Ga0395905_0152398 Ga0395905_0152398_777_1088 95
551 3300005338 Ga0068868_101452412 Ga0068868_1014524122 96
552 3300005367 Ga0070667_100145138 Ga0070667_1001451382 96
553 3300026023 Ga0207677_11019856 Ga0207677_110198561 96
554 3300026142 Ga0207698_10706613 Ga0207698_107066132 96
555 3300053121 Ga0500607_047273 Ga0500607_047273_615_905 96
556 3300053136 Ga0500559_0597099 Ga0500559_0597099_176_466 96
557 3300031995 Ga0307409_100376534 Ga0307409_1003765343 97
558 3300037418 Ga0395900_0595942 Ga0395900_0595942_67_396 97
559 3300037471 Ga0395905_0170283 Ga0395905_0170283_504_833 97
560 3300005295 Ga0065707_10337456 Ga0065707_103374562 98
561 3300005365 Ga0070688_100417019 Ga0070688_1004170192 98
562 3300005563 Ga0068855_100060040 Ga0068855_1000600404 98
563 3300005616 Ga0068852_100187498 Ga0068852_1001874982 98
564 3300005617 Ga0068859_101970645 Ga0068859_1019706451 98
565 3300006931 Ga0097620_101970483 Ga0097620_1019704831 98
566 3300025949 Ga0207667_10056831 Ga0207667_100568312 98
567 3300026118 Ga0207675_102076351 Ga0207675_1020763512 98
568 3300026142 Ga0207698_10169719 Ga0207698_101697192 98
569 3300049686 Ga0501257_275022 Ga0501257_275022_104_409 98
570 3300001979 JGI24740J21852_10009214 JGI24740J21852_100092143 99
571 3300026078 Ga0207702_10478014 Ga0207702_104780142 99
572 3300031456 Ga0307513_10469354 Ga0307513_104693542 99
573 3300049823 Ga0501044_0399715 Ga0501044_0399715_414_725 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

3

25

0.93

PF12838

Fer4_7

4Fe-4S dicluster domain

8

58

0.91

Feature Viewer

pLDDT pTM Quality
54.61 0.32 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map