F465149
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 304 | 568 | 93 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10337456|Ga0065707_103374562 |
| Length | 109 |
| Sequence | MALMITDECINCDVCEPECPNEAISLGPEIYQIAPERCTECVGHFDEPQCVQVCPVACIPVDPKRVESRETLWQKYQRLVAQAKKDTEGVAGSAPTPTLPQGGREQEPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 2 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 3 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 4 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 5 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 74 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 155 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 156 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 157 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 158 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 159 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 165 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 166 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 176 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 177 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 191 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 198 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 199 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 200 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 201 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 202 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 203 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 204 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 205 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 209 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 210 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 256 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 261 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 262 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 263 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 264 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 267 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 284 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 287 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 288 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 289 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 290 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 292 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 295 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 296 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 297 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 299 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 300 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 302 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.77 |
| Nodule | 0.35 |
| Rhizoplane | 4.01 |
| Rhizosphere | 67.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009214 | 3300001979 | Bacteria | 3878 |
| 2 | Ga0007417J51691_1110541 | 3300003544 | Bacteria | 581 |
| 3 | Ga0055535_1007416 | 3300003761 | Bacteria | 2100 |
| 4 | Ga0055540_1006805 | 3300003792 | Bacteria | 4458 |
| 5 | Ga0055531_10001090 | 3300003794 | Bacteria | 21279 |
| 6 | Ga0065707_10337456 | 3300005295 | Bacteria | 934 |
| 7 | Ga0065707_10420912 | 3300005295 | Bacteria | 831 |
| 8 | Ga0065707_10537994 | 3300005295 | Bacteria | 730 |
| 9 | Ga0070658_10189382 | 3300005327 | Bacteria | 1734 |
| 10 | Ga0070658_10386016 | 3300005327 | Bacteria | 1202 |
| 11 | Ga0070676_11448723 | 3300005328 | Bacteria | 528 |
| 12 | Ga0070690_100241180 | 3300005330 | Bacteria | 1275 |
| 13 | Ga0070690_100917644 | 3300005330 | Bacteria | 686 |
| 14 | Ga0070670_101744585 | 3300005331 | Bacteria | 573 |
| 15 | Ga0070677_10310172 | 3300005333 | Bacteria | 805 |
| 16 | Ga0070677_10539574 | 3300005333 | Bacteria | 638 |
| 17 | Ga0070677_10560153 | 3300005333 | Bacteria | 628 |
| 18 | Ga0068869_100135993 | 3300005334 | Bacteria | 1894 |
| 19 | Ga0070666_10413270 | 3300005335 | Bacteria | 971 |
| 20 | Ga0070680_100257070 | 3300005336 | Bacteria | 1477 |
| 21 | Ga0070680_101659497 | 3300005336 | Bacteria | 554 |
| 22 | Ga0070682_100266161 | 3300005337 | Bacteria | 1243 |
| 23 | Ga0068868_100522906 | 3300005338 | Bacteria | 1042 |
| 24 | Ga0068868_101452412 | 3300005338 | Bacteria | 641 |
| 25 | Ga0070660_100000354 | 3300005339 | Bacteria | 30590 |
| 26 | Ga0070660_100011683 | 3300005339 | Bacteria | 6252 |
| 27 | Ga0070660_101051185 | 3300005339 | Bacteria | 689 |
| 28 | Ga0070689_100392442 | 3300005340 | Bacteria | 1172 |
| 29 | Ga0070691_10211487 | 3300005341 | Bacteria | 1023 |
| 30 | Ga0070661_100003595 | 3300005344 | Bacteria | 10675 |
| 31 | Ga0070661_101494736 | 3300005344 | Bacteria | 570 |
| 32 | Ga0070668_100118282 | 3300005347 | Bacteria | 2115 |
| 33 | Ga0070668_101013468 | 3300005347 | Bacteria | 747 |
| 34 | Ga0070669_100291715 | 3300005353 | Bacteria | 1310 |
| 35 | Ga0070675_100001027 | 3300005354 | Bacteria | 20074 |
| 36 | Ga0070675_100223409 | 3300005354 | Bacteria | 1641 |
| 37 | Ga0070675_100341061 | 3300005354 | Bacteria | 1327 |
| 38 | Ga0070675_100375145 | 3300005354 | Bacteria | 1265 |
| 39 | Ga0070675_100444581 | 3300005354 | Bacteria | 1162 |
| 40 | Ga0070674_100012613 | 3300005356 | Bacteria | 5194 |
| 41 | Ga0070674_100952629 | 3300005356 | Bacteria | 751 |
| 42 | Ga0070673_102024709 | 3300005364 | Bacteria | 547 |
| 43 | Ga0070688_100417019 | 3300005365 | Bacteria | 997 |
| 44 | Ga0070688_101487132 | 3300005365 | Bacteria | 551 |
| 45 | Ga0070659_100000846 | 3300005366 | Bacteria | 22322 |
| 46 | Ga0070659_100232449 | 3300005366 | Bacteria | 1524 |
| 47 | Ga0070667_100002153 | 3300005367 | Bacteria | 17348 |
| 48 | Ga0070667_100145138 | 3300005367 | Bacteria | 2081 |
| 49 | Ga0070667_100203686 | 3300005367 | Bacteria | 1756 |
| 50 | Ga0070667_100217035 | 3300005367 | Bacteria | 1701 |
| 51 | Ga0070701_10519980 | 3300005438 | Bacteria | 776 |
| 52 | Ga0070663_100226653 | 3300005455 | Bacteria | 1470 |
| 53 | Ga0070663_101466481 | 3300005455 | Bacteria | 606 |
| 54 | Ga0070678_100002501 | 3300005456 | Bacteria | 10081 |
| 55 | Ga0070678_100040897 | 3300005456 | Bacteria | 3283 |
| 56 | Ga0070678_100234279 | 3300005456 | Bacteria | 1532 |
| 57 | Ga0070678_100378071 | 3300005456 | Bacteria | 1225 |
| 58 | Ga0070678_101387395 | 3300005456 | Bacteria | 656 |
| 59 | Ga0070662_100001973 | 3300005457 | Bacteria | 12604 |
| 60 | Ga0070662_100089754 | 3300005457 | Bacteria | 2306 |
| 61 | Ga0070681_10278353 | 3300005458 | Bacteria | 1584 |
| 62 | Ga0068867_100116187 | 3300005459 | Bacteria | 2061 |
| 63 | Ga0068867_100865244 | 3300005459 | Bacteria | 811 |
| 64 | Ga0068867_100930765 | 3300005459 | Bacteria | 784 |
| 65 | Ga0068867_101063080 | 3300005459 | Bacteria | 737 |
| 66 | Ga0068867_101139239 | 3300005459 | Bacteria | 714 |
| 67 | Ga0070706_100000700 | 3300005467 | Bacteria | 37931 |
| 68 | Ga0070698_100796762 | 3300005471 | Bacteria | 889 |
| 69 | Ga0070679_100071451 | 3300005530 | Bacteria | 3462 |
| 70 | Ga0070679_100108545 | 3300005530 | Bacteria | 2761 |
| 71 | Ga0070679_100727819 | 3300005530 | Bacteria | 935 |
| 72 | Ga0068853_100037877 | 3300005539 | Bacteria | 4106 |
| 73 | Ga0070672_100528850 | 3300005543 | Bacteria | 1022 |
| 74 | Ga0070665_100059434 | 3300005548 | Bacteria | 3832 |
| 75 | Ga0070665_100407372 | 3300005548 | Bacteria | 1368 |
| 76 | Ga0070665_101141059 | 3300005548 | Bacteria | 791 |
| 77 | Ga0070665_102248670 | 3300005548 | Bacteria | 549 |
| 78 | Ga0068855_100022812 | 3300005563 | Bacteria | 7500 |
| 79 | Ga0068855_100060040 | 3300005563 | Bacteria | 4448 |
| 80 | Ga0068855_100136450 | 3300005563 | Bacteria | 2799 |
| 81 | Ga0068857_100032539 | 3300005577 | Bacteria | 4612 |
| 82 | Ga0068854_100124186 | 3300005578 | Bacteria | 1964 |
| 83 | Ga0070702_101473544 | 3300005615 | Bacteria | 559 |
| 84 | Ga0068852_100187498 | 3300005616 | Bacteria | 1949 |
| 85 | Ga0068852_100229803 | 3300005616 | Bacteria | 1768 |
| 86 | Ga0068859_100909238 | 3300005617 | Bacteria | 965 |
| 87 | Ga0068859_101970645 | 3300005617 | Bacteria | 645 |
| 88 | Ga0068859_102289782 | 3300005617 | Bacteria | 596 |
| 89 | Ga0068864_100375946 | 3300005618 | Bacteria | 1345 |
| 90 | Ga0068866_10133847 | 3300005718 | Bacteria | 1414 |
| 91 | Ga0068863_100191568 | 3300005841 | Bacteria | 1965 |
| 92 | Ga0068863_100892422 | 3300005841 | Bacteria | 889 |
| 93 | Ga0068863_101064235 | 3300005841 | Bacteria | 813 |
| 94 | Ga0068863_101273972 | 3300005841 | Bacteria | 742 |
| 95 | Ga0068863_101283499 | 3300005841 | Bacteria | 739 |
| 96 | Ga0068858_101152333 | 3300005842 | Bacteria | 762 |
| 97 | Ga0068860_100144594 | 3300005843 | Bacteria | 2287 |
| 98 | Ga0068860_100302219 | 3300005843 | Bacteria | 1568 |
| 99 | Ga0068860_100437468 | 3300005843 | Bacteria | 1299 |
| 100 | Ga0068862_100663517 | 3300005844 | Bacteria | 1007 |
| 101 | Ga0075365_10066115 | 3300006038 | Bacteria | 2425 |
| 102 | Ga0075365_10778261 | 3300006038 | Bacteria | 675 |
| 103 | Ga0075368_10026642 | 3300006042 | Bacteria | 2224 |
| 104 | Ga0075363_100032316 | 3300006048 | Bacteria | 2718 |
| 105 | Ga0075363_100140039 | 3300006048 | Bacteria | 1361 |
| 106 | Ga0075363_100147872 | 3300006048 | Bacteria | 1325 |
| 107 | Ga0075363_100509999 | 3300006048 | Bacteria | 715 |
| 108 | Ga0075364_10066367 | 3300006051 | Bacteria | 2370 |
| 109 | Ga0075364_10523274 | 3300006051 | Bacteria | 811 |
| 110 | Ga0075364_10638315 | 3300006051 | Bacteria | 727 |
| 111 | Ga0075432_10007264 | 3300006058 | Bacteria | 3773 |
| 112 | Ga0075362_10006678 | 3300006177 | Bacteria | 4310 |
| 113 | Ga0075362_10039587 | 3300006177 | Bacteria | 2073 |
| 114 | Ga0075362_10049615 | 3300006177 | Bacteria | 1875 |
| 115 | Ga0075362_10111742 | 3300006177 | Bacteria | 1286 |
| 116 | Ga0075362_10351383 | 3300006177 | Bacteria | 738 |
| 117 | Ga0075367_10001893 | 3300006178 | Bacteria | 9269 |
| 118 | Ga0075367_10023179 | 3300006178 | Bacteria | 3489 |
| 119 | Ga0075367_10440801 | 3300006178 | Bacteria | 825 |
| 120 | Ga0075367_10781875 | 3300006178 | Bacteria | 608 |
| 121 | Ga0075369_10022389 | 3300006186 | Bacteria | 2606 |
| 122 | Ga0075369_10067475 | 3300006186 | Bacteria | 1570 |
| 123 | Ga0075369_10340690 | 3300006186 | Bacteria | 703 |
| 124 | Ga0075366_10001135 | 3300006195 | Bacteria | 13140 |
| 125 | Ga0075366_10013712 | 3300006195 | Bacteria | 4619 |
| 126 | Ga0075366_10016581 | 3300006195 | Bacteria | 4237 |
| 127 | Ga0075366_10020149 | 3300006195 | Bacteria | 3866 |
| 128 | Ga0075366_10081601 | 3300006195 | Bacteria | 1931 |
| 129 | Ga0075366_10098006 | 3300006195 | Bacteria | 1758 |
| 130 | Ga0075366_10191090 | 3300006195 | Bacteria | 1244 |
| 131 | Ga0075366_10386361 | 3300006195 | Bacteria | 861 |
| 132 | Ga0075366_10464950 | 3300006195 | Bacteria | 781 |
| 133 | Ga0075366_10565077 | 3300006195 | Bacteria | 705 |
| 134 | Ga0097621_100092847 | 3300006237 | Bacteria | 2528 |
| 135 | Ga0097621_100663252 | 3300006237 | Bacteria | 958 |
| 136 | Ga0097621_101608169 | 3300006237 | Bacteria | 618 |
| 137 | Ga0097621_102190406 | 3300006237 | Bacteria | 529 |
| 138 | Ga0075370_10000133 | 3300006353 | Bacteria | 24995 |
| 139 | Ga0075370_10001450 | 3300006353 | Bacteria | 10303 |
| 140 | Ga0075370_10010864 | 3300006353 | Bacteria | 4772 |
| 141 | Ga0075370_10018072 | 3300006353 | Bacteria | 3820 |
| 142 | Ga0075370_10018552 | 3300006353 | Bacteria | 3777 |
| 143 | Ga0075370_10031408 | 3300006353 | Bacteria | 2965 |
| 144 | Ga0075370_10455059 | 3300006353 | Bacteria | 770 |
| 145 | Ga0075370_10466502 | 3300006353 | Bacteria | 760 |
| 146 | Ga0075370_10541309 | 3300006353 | Bacteria | 704 |
| 147 | Ga0075370_10793026 | 3300006353 | Bacteria | 577 |
| 148 | Ga0068871_100101604 | 3300006358 | Bacteria | 2409 |
| 149 | Ga0068871_100262078 | 3300006358 | Bacteria | 1508 |
| 150 | Ga0068871_100399973 | 3300006358 | Bacteria | 1223 |
| 151 | Ga0068871_100962461 | 3300006358 | Bacteria | 793 |
| 152 | Ga0075430_100013420 | 3300006846 | Bacteria | 6983 |
| 153 | Ga0075429_100001318 | 3300006880 | Bacteria | 20245 |
| 154 | Ga0097620_100909225 | 3300006931 | Bacteria | 965 |
| 155 | Ga0097620_101970483 | 3300006931 | Bacteria | 645 |
| 156 | Ga0097620_102290545 | 3300006931 | Bacteria | 596 |
| 157 | Ga0079104_1027475 | 3300006946 | Bacteria | 1459 |
| 158 | Ga0099826_10582353 | 3300006948 | Bacteria | 511 |
| 159 | Ga0105240_10005767 | 3300009093 | Bacteria | 18365 |
| 160 | Ga0105240_10302814 | 3300009093 | Bacteria | 1828 |
| 161 | Ga0111539_11968237 | 3300009094 | Bacteria | 678 |
| 162 | Ga0111539_13082756 | 3300009094 | Bacteria | 538 |
| 163 | Ga0105245_12278214 | 3300009098 | Bacteria | 595 |
| 164 | Ga0105243_10594657 | 3300009148 | Bacteria | 1064 |
| 165 | Ga0105243_11385105 | 3300009148 | Bacteria | 723 |
| 166 | Ga0105242_10040790 | 3300009176 | Bacteria | 3741 |
| 167 | Ga0105242_10626225 | 3300009176 | Bacteria | 1043 |
| 168 | Ga0105242_12790020 | 3300009176 | Bacteria | 539 |
| 169 | Ga0105242_13024558 | 3300009176 | Bacteria | 521 |
| 170 | Ga0105248_10119058 | 3300009177 | Bacteria | 2979 |
| 171 | Ga0105248_11050995 | 3300009177 | Bacteria | 920 |
| 172 | Ga0105237_10005313 | 3300009545 | Bacteria | 14566 |
| 173 | Ga0105237_10068698 | 3300009545 | Bacteria | 3537 |
| 174 | Ga0105238_10028874 | 3300009551 | Bacteria | 5649 |
| 175 | Ga0105238_11005752 | 3300009551 | Bacteria | 855 |
| 176 | Ga0105249_10070627 | 3300009553 | Bacteria | 3224 |
| 177 | Ga0105249_10205185 | 3300009553 | Bacteria | 1931 |
| 178 | Ga0105249_10875767 | 3300009553 | Bacteria | 964 |
| 179 | Ga0105249_11394989 | 3300009553 | Bacteria | 773 |
| 180 | Ga0105239_10101058 | 3300010375 | Bacteria | 3190 |
| 181 | Ga0105239_11237757 | 3300010375 | Bacteria | 860 |
| 182 | Ga0105246_11157157 | 3300011119 | Bacteria | 710 |
| 183 | Ga0157378_12020785 | 3300013297 | Bacteria | 626 |
| 184 | Ga0163162_10381931 | 3300013306 | Bacteria | 1542 |
| 185 | Ga0163162_11239855 | 3300013306 | Bacteria | 847 |
| 186 | Ga0163162_12089884 | 3300013306 | Bacteria | 650 |
| 187 | Ga0157375_10240126 | 3300013308 | Bacteria | 1971 |
| 188 | Ga0157375_10375145 | 3300013308 | Bacteria | 1589 |
| 189 | Ga0157375_11218252 | 3300013308 | Bacteria | 883 |
| 190 | Ga0163163_10389797 | 3300014325 | Bacteria | 1451 |
| 191 | Ga0163163_11132473 | 3300014325 | Bacteria | 845 |
| 192 | Ga0163163_11403514 | 3300014325 | Bacteria | 760 |
| 193 | Ga0163163_11655891 | 3300014325 | Bacteria | 701 |
| 194 | Ga0157380_10302114 | 3300014326 | Bacteria | 1475 |
| 195 | Ga0157380_10556801 | 3300014326 | Bacteria | 1126 |
| 196 | Ga0157380_11989588 | 3300014326 | Bacteria | 643 |
| 197 | Ga0182008_10003005 | 3300014497 | Bacteria | 10376 |
| 198 | Ga0182008_10010313 | 3300014497 | Bacteria | 5003 |
| 199 | Ga0182008_10163152 | 3300014497 | Bacteria | 1122 |
| 200 | Ga0157379_10088429 | 3300014968 | Bacteria | 2778 |
| 201 | Ga0157379_10174942 | 3300014968 | Bacteria | 1938 |
| 202 | Ga0157379_10924213 | 3300014968 | Bacteria | 829 |
| 203 | Ga0157376_10079988 | 3300014969 | Bacteria | 2803 |
| 204 | Ga0157376_11403641 | 3300014969 | Bacteria | 730 |
| 205 | Ga0157376_11559935 | 3300014969 | Bacteria | 694 |
| 206 | Ga0182006_1023558 | 3300015261 | Bacteria | 2548 |
| 207 | Ga0182007_10004805 | 3300015262 | Bacteria | 6064 |
| 208 | Ga0163161_10024999 | 3300017792 | Bacteria | 4222 |
| 209 | Ga0163161_10209265 | 3300017792 | Bacteria | 1506 |
| 210 | Ga0163161_10945538 | 3300017792 | Bacteria | 733 |
| 211 | Ga0213876_10537746 | 3300021384 | Bacteria | 622 |
| 212 | Ga0209258_100489 | 3300025242 | Bacteria | 40371 |
| 213 | Ga0209759_1001977 | 3300025256 | Bacteria | 9830 |
| 214 | Ga0209673_1018116 | 3300025273 | Bacteria | 2573 |
| 215 | Ga0209673_1020479 | 3300025273 | Bacteria | 2340 |
| 216 | Ga0209675_1038104 | 3300025291 | Bacteria | 1074 |
| 217 | Ga0209025_1005205 | 3300025294 | Bacteria | 10733 |
| 218 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 219 | Ga0209051_1000456 | 3300025303 | Bacteria | 54000 |
| 220 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 221 | Ga0207682_10384251 | 3300025893 | Bacteria | 663 |
| 222 | Ga0207680_10357255 | 3300025903 | Bacteria | 1027 |
| 223 | Ga0207645_10048479 | 3300025907 | Bacteria | 2713 |
| 224 | Ga0207645_10052162 | 3300025907 | Bacteria | 2613 |
| 225 | Ga0207705_10574485 | 3300025909 | Bacteria | 876 |
| 226 | Ga0207707_10875930 | 3300025912 | Bacteria | 744 |
| 227 | Ga0207695_10372588 | 3300025913 | Bacteria | 1314 |
| 228 | Ga0207671_10099308 | 3300025914 | Bacteria | 2203 |
| 229 | Ga0207660_10684877 | 3300025917 | Bacteria | 836 |
| 230 | Ga0207657_10005778 | 3300025919 | Bacteria | 12899 |
| 231 | Ga0207657_10037495 | 3300025919 | Bacteria | 4327 |
| 232 | Ga0207657_11118319 | 3300025919 | Bacteria | 601 |
| 233 | Ga0207657_11501069 | 3300025919 | Bacteria | 504 |
| 234 | Ga0207649_10010407 | 3300025920 | Bacteria | 5110 |
| 235 | Ga0207652_10058562 | 3300025921 | Bacteria | 3319 |
| 236 | Ga0207646_10408677 | 3300025922 | Bacteria | 1226 |
| 237 | Ga0207681_10011235 | 3300025923 | Bacteria | 5500 |
| 238 | Ga0207681_10336926 | 3300025923 | Bacteria | 1204 |
| 239 | Ga0207681_10375818 | 3300025923 | Bacteria | 1143 |
| 240 | Ga0207694_10200773 | 3300025924 | Bacteria | 1622 |
| 241 | Ga0207650_10375931 | 3300025925 | Bacteria | 1173 |
| 242 | Ga0207650_10444755 | 3300025925 | Bacteria | 1078 |
| 243 | Ga0207650_10946980 | 3300025925 | Bacteria | 732 |
| 244 | Ga0207659_10245191 | 3300025926 | Bacteria | 1451 |
| 245 | Ga0207659_10259706 | 3300025926 | Bacteria | 1412 |
| 246 | Ga0207659_10635188 | 3300025926 | Bacteria | 912 |
| 247 | Ga0207687_10313050 | 3300025927 | Bacteria | 1268 |
| 248 | Ga0207687_10904539 | 3300025927 | Bacteria | 755 |
| 249 | Ga0207664_10151267 | 3300025929 | Bacteria | 1972 |
| 250 | Ga0207644_10199913 | 3300025931 | Bacteria | 1576 |
| 251 | Ga0207644_11746402 | 3300025931 | Bacteria | 521 |
| 252 | Ga0207690_10003760 | 3300025932 | Bacteria | 8999 |
| 253 | Ga0207706_10005101 | 3300025933 | Bacteria | 12262 |
| 254 | Ga0207706_10058552 | 3300025933 | Bacteria | 3393 |
| 255 | Ga0207706_11151867 | 3300025933 | Bacteria | 646 |
| 256 | Ga0207686_10089949 | 3300025934 | Bacteria | 2024 |
| 257 | Ga0207709_10147683 | 3300025935 | Bacteria | 1624 |
| 258 | Ga0207709_11788719 | 3300025935 | Bacteria | 511 |
| 259 | Ga0207669_10004596 | 3300025937 | Bacteria | 6091 |
| 260 | Ga0207691_10042442 | 3300025940 | Bacteria | 4193 |
| 261 | Ga0207691_10265054 | 3300025940 | Bacteria | 1480 |
| 262 | Ga0207691_10277074 | 3300025940 | Bacteria | 1444 |
| 263 | Ga0207711_10160331 | 3300025941 | Bacteria | 2035 |
| 264 | Ga0207689_10026426 | 3300025942 | Bacteria | 4860 |
| 265 | Ga0207667_10056831 | 3300025949 | Bacteria | 4109 |
| 266 | Ga0207667_10078799 | 3300025949 | Bacteria | 3414 |
| 267 | Ga0207667_10135305 | 3300025949 | Bacteria | 2538 |
| 268 | Ga0207712_10484676 | 3300025961 | Bacteria | 1054 |
| 269 | Ga0207668_10552187 | 3300025972 | Bacteria | 998 |
| 270 | Ga0207640_10238457 | 3300025981 | Bacteria | 1404 |
| 271 | Ga0207640_10357000 | 3300025981 | Bacteria | 1176 |
| 272 | Ga0207658_10001079 | 3300025986 | Bacteria | 22086 |
| 273 | Ga0207658_10054381 | 3300025986 | Bacteria | 2962 |
| 274 | Ga0207658_11057474 | 3300025986 | Bacteria | 741 |
| 275 | Ga0207677_10568457 | 3300026023 | Bacteria | 991 |
| 276 | Ga0207677_10666631 | 3300026023 | Bacteria | 920 |
| 277 | Ga0207677_11019856 | 3300026023 | Bacteria | 751 |
| 278 | Ga0207639_10098896 | 3300026041 | Bacteria | 2353 |
| 279 | Ga0207702_10478014 | 3300026078 | Bacteria | 1212 |
| 280 | Ga0207702_11788108 | 3300026078 | Bacteria | 607 |
| 281 | Ga0207641_12018990 | 3300026088 | Bacteria | 578 |
| 282 | Ga0207641_12043259 | 3300026088 | Bacteria | 574 |
| 283 | Ga0207648_10145032 | 3300026089 | Bacteria | 2094 |
| 284 | Ga0207648_10220707 | 3300026089 | Bacteria | 1685 |
| 285 | Ga0207648_10489116 | 3300026089 | Bacteria | 1125 |
| 286 | Ga0207676_11421137 | 3300026095 | Bacteria | 690 |
| 287 | Ga0207674_10029917 | 3300026116 | Bacteria | 5730 |
| 288 | Ga0207675_102076351 | 3300026118 | Bacteria | 585 |
| 289 | Ga0207683_10004243 | 3300026121 | Bacteria | 12370 |
| 290 | Ga0207683_11006933 | 3300026121 | Bacteria | 773 |
| 291 | Ga0207698_10169719 | 3300026142 | Bacteria | 1919 |
| 292 | Ga0207698_10706613 | 3300026142 | Bacteria | 1003 |
| 293 | Ga0209971_1135612 | 3300027682 | Bacteria | 606 |
| 294 | Ga0209813_10037472 | 3300027866 | Bacteria | 1461 |
| 295 | Ga0207428_10398673 | 3300027907 | Bacteria | 1008 |
| 296 | Ga0207428_10830146 | 3300027907 | Bacteria | 655 |
| 297 | Ga0268266_10087578 | 3300028379 | Bacteria | 2725 |
| 298 | Ga0268266_11490230 | 3300028379 | Bacteria | 652 |
| 299 | Ga0268266_11784421 | 3300028379 | Bacteria | 590 |
| 300 | Ga0268265_10045754 | 3300028380 | Bacteria | 3268 |
| 301 | Ga0268265_10244673 | 3300028380 | Bacteria | 1585 |
| 302 | Ga0268265_11596099 | 3300028380 | Bacteria | 657 |
| 303 | Ga0268264_10136557 | 3300028381 | Bacteria | 2181 |
| 304 | Ga0268264_10298458 | 3300028381 | Bacteria | 1516 |
| 305 | Ga0268264_10629152 | 3300028381 | Bacteria | 1060 |
| 306 | Ga0268264_11356619 | 3300028381 | Bacteria | 721 |
| 307 | Ga0307517_10191648 | 3300028786 | Bacteria | 1296 |
| 308 | Ga0307517_10224930 | 3300028786 | Bacteria | 1135 |
| 309 | Ga0307515_10079492 | 3300028794 | Bacteria | 4295 |
| 310 | Ga0307515_10102481 | 3300028794 | Bacteria | 3442 |
| 311 | Ga0307515_10167093 | 3300028794 | Bacteria | 2212 |
| 312 | Ga0307515_10393770 | 3300028794 | Bacteria | 1013 |
| 313 | Ga0307512_10201555 | 3300030522 | Bacteria | 1076 |
| 314 | Ga0307512_10305016 | 3300030522 | Bacteria | 738 |
| 315 | Ga0316179_1109249 | 3300030734 | Bacteria | 1789 |
| 316 | Ga0316178_1010462 | 3300030735 | Bacteria | 4027 |
| 317 | Ga0316183_1067419 | 3300030742 | Bacteria | 8873 |
| 318 | Ga0265327_10249184 | 3300031251 | Bacteria | 791 |
| 319 | Ga0307513_10002473 | 3300031456 | Bacteria | 25565 |
| 320 | Ga0307513_10004582 | 3300031456 | Bacteria | 18428 |
| 321 | Ga0307513_10185683 | 3300031456 | Bacteria | 1936 |
| 322 | Ga0307513_10315173 | 3300031456 | Bacteria | 1324 |
| 323 | Ga0307513_10469354 | 3300031456 | Bacteria | 980 |
| 324 | Ga0307513_10616172 | 3300031456 | Bacteria | 794 |
| 325 | Ga0307509_10051823 | 3300031507 | Bacteria | 4384 |
| 326 | Ga0307509_10472816 | 3300031507 | Bacteria | 943 |
| 327 | Ga0307408_100051410 | 3300031548 | Bacteria | 2968 |
| 328 | Ga0307408_100081760 | 3300031548 | Bacteria | 2416 |
| 329 | Ga0307408_100184612 | 3300031548 | Bacteria | 1675 |
| 330 | Ga0307508_10136659 | 3300031616 | Bacteria | 2055 |
| 331 | Ga0307508_10246616 | 3300031616 | Bacteria | 1383 |
| 332 | Ga0307514_10000928 | 3300031649 | Bacteria | 44600 |
| 333 | Ga0307514_10080793 | 3300031649 | Bacteria | 2404 |
| 334 | Ga0307516_10002259 | 3300031730 | Bacteria | 25996 |
| 335 | Ga0307516_10087584 | 3300031730 | Bacteria | 2948 |
| 336 | Ga0307516_10649421 | 3300031730 | Bacteria | 710 |
| 337 | Ga0307405_10098893 | 3300031731 | Bacteria | 1951 |
| 338 | Ga0307405_10179159 | 3300031731 | Bacteria | 1520 |
| 339 | Ga0307405_10444329 | 3300031731 | Bacteria | 1026 |
| 340 | Ga0307405_10505413 | 3300031731 | Bacteria | 970 |
| 341 | Ga0307405_11473784 | 3300031731 | Bacteria | 597 |
| 342 | Ga0307410_11123998 | 3300031852 | Bacteria | 682 |
| 343 | Ga0307406_10031294 | 3300031901 | Bacteria | 3238 |
| 344 | Ga0307406_11199806 | 3300031901 | Bacteria | 659 |
| 345 | Ga0307412_10008057 | 3300031911 | Bacteria | 6003 |
| 346 | Ga0307412_10556509 | 3300031911 | Bacteria | 964 |
| 347 | Ga0307412_10558109 | 3300031911 | Bacteria | 963 |
| 348 | Ga0307412_11143730 | 3300031911 | Bacteria | 695 |
| 349 | Ga0307412_11576310 | 3300031911 | Bacteria | 599 |
| 350 | Ga0307409_100376534 | 3300031995 | Bacteria | 1348 |
| 351 | Ga0307409_102575018 | 3300031995 | Bacteria | 537 |
| 352 | Ga0307416_100202898 | 3300032002 | Bacteria | 1883 |
| 353 | Ga0307416_100216767 | 3300032002 | Bacteria | 1831 |
| 354 | Ga0307416_100495964 | 3300032002 | Bacteria | 1284 |
| 355 | Ga0307416_100918242 | 3300032002 | Bacteria | 976 |
| 356 | Ga0307414_10671515 | 3300032004 | Bacteria | 936 |
| 357 | Ga0307414_11079933 | 3300032004 | Bacteria | 741 |
| 358 | Ga0307415_101611695 | 3300032126 | Bacteria | 624 |
| 359 | Ga0307507_10318660 | 3300033179 | Bacteria | 938 |
| 360 | Ga0307510_10224231 | 3300033180 | Bacteria | 1388 |
| 361 | Ga0373948_0091304 | 3300034817 | Bacteria | 707 |
| 362 | Ga0373953_0126769 | 3300035117 | Bacteria | 1087 |
| 363 | Ga0373962_0057386 | 3300035242 | Bacteria | 1136 |
| 364 | Ga0373931_0172706 | 3300035691 | Bacteria | 1275 |
| 365 | Ga0373937_0215739 | 3300036401 | Bacteria | 1806 |
| 366 | Ga0373925_0019503 | 3300037068 | Bacteria | 4934 |
| 367 | Ga0395899_0168512 | 3300037312 | Bacteria | 1543 |
| 368 | Ga0395900_0032376 | 3300037418 | Bacteria | 5377 |
| 369 | Ga0395900_0036136 | 3300037418 | Bacteria | 5091 |
| 370 | Ga0395900_0400919 | 3300037418 | Bacteria | 1336 |
| 371 | Ga0395900_0595942 | 3300037418 | Bacteria | 1046 |
| 372 | Ga0395898_0023156 | 3300037466 | Bacteria | 6278 |
| 373 | Ga0395898_0035122 | 3300037466 | Bacteria | 4989 |
| 374 | Ga0395905_0004208 | 3300037471 | Bacteria | 15056 |
| 375 | Ga0395905_0009324 | 3300037471 | Bacteria | 9600 |
| 376 | Ga0395905_0051309 | 3300037471 | Bacteria | 3863 |
| 377 | Ga0395905_0097823 | 3300037471 | Bacteria | 2756 |
| 378 | Ga0395905_0134600 | 3300037471 | Bacteria | 2324 |
| 379 | Ga0395905_0152398 | 3300037471 | Bacteria | 2174 |
| 380 | Ga0395905_0170283 | 3300037471 | Bacteria | 2045 |
| 381 | Ga0436364_1129729 | 3300037853 | Bacteria | 513 |
| 382 | Ga0395901_0055050 | 3300038443 | Bacteria | 4136 |
| 383 | Ga0395901_0133122 | 3300038443 | Bacteria | 2612 |
| 384 | Ga0395901_0457891 | 3300038443 | Bacteria | 1304 |
| 385 | Ga0436365_0305753 | 3300039437 | Bacteria | 642 |
| 386 | Ga0439465_0177572 | 3300041413 | Bacteria | 769 |
| 387 | Ga0451787_580972 | 3300041441 | Bacteria | 535 |
| 388 | Ga0451789_0579583 | 3300041443 | Bacteria | 1029 |
| 389 | Ga0451789_1132921 | 3300041443 | Bacteria | 591 |
| 390 | Ga0451789_1281024 | 3300041443 | Bacteria | 901 |
| 391 | Ga0451791_1266385 | 3300041451 | Bacteria | 646 |
| 392 | Ga0451791_1838390 | 3300041451 | Bacteria | 3287 |
| 393 | Ga0451795_0489275 | 3300041456 | Bacteria | 617 |
| 394 | Ga0451802_1640339 | 3300041460 | Bacteria | 535 |
| 395 | Ga0451807_2264388 | 3300041486 | Bacteria | 521 |
| 396 | Ga0451837_0439785 | 3300041494 | Bacteria | 713 |
| 397 | Ga0451841_0609462 | 3300041498 | Bacteria | 529 |
| 398 | Ga0451843_1258370 | 3300041509 | Bacteria | 1404 |
| 399 | Ga0451843_1692436 | 3300041509 | Bacteria | 798 |
| 400 | Ga0439431_0002851 | 3300041997 | Bacteria | 3803 |
| 401 | Ga0439433_0068286 | 3300041999 | Bacteria | 854 |
| 402 | Ga0439455_0073213 | 3300042012 | Bacteria | 923 |
| 403 | Ga0439457_098107 | 3300042014 | Bacteria | 681 |
| 404 | Ga0450919_001154 | 3300042121 | Bacteria | 3436 |
| 405 | Ga0450898_017534 | 3300042134 | Bacteria | 1232 |
| 406 | Ga0439446_0017968 | 3300042156 | Bacteria | 1977 |
| 407 | Ga0439458_0057676 | 3300042157 | Bacteria | 966 |
| 408 | Ga0439458_0113594 | 3300042157 | Bacteria | 709 |
| 409 | Ga0439434_0214505 | 3300042435 | Bacteria | 652 |
| 410 | Ga0439459_0095371 | 3300042438 | Bacteria | 721 |
| 411 | Ga0450918_000077 | 3300042531 | Bacteria | 20527 |
| 412 | Ga0451577_0967917 | 3300042876 | Bacteria | 765 |
| 413 | Ga0451577_1453105 | 3300042876 | Bacteria | 607 |
| 414 | Ga0451577_2011662 | 3300042876 | Bacteria | 505 |
| 415 | Ga0453683_0001887 | 3300044673 | Bacteria | 17174 |
| 416 | Ga0466965_0082018 | 3300044683 | Bacteria | 1631 |
| 417 | Ga0466965_0104705 | 3300044683 | Bacteria | 1449 |
| 418 | Ga0466965_0108421 | 3300044683 | Bacteria | 1425 |
| 419 | Ga0466965_0348504 | 3300044683 | Bacteria | 811 |
| 420 | Ga0466964_0468125 | 3300044706 | Bacteria | 671 |
| 421 | Ga0453684_0073443 | 3300044712 | Bacteria | 4311 |
| 422 | Ga0453684_0081347 | 3300044712 | Bacteria | 4040 |
| 423 | Ga0453684_0184107 | 3300044712 | Bacteria | 2450 |
| 424 | Ga0466971_0193211 | 3300044719 | Bacteria | 959 |
| 425 | Ga0466959_0389704 | 3300045049 | Bacteria | 948 |
| 426 | Ga0451576_0036711 | 3300045051 | Bacteria | 5193 |
| 427 | Ga0451576_0052498 | 3300045051 | Bacteria | 4271 |
| 428 | Ga0451576_1735305 | 3300045051 | Bacteria | 646 |
| 429 | Ga0466958_0225498 | 3300045836 | Bacteria | 1196 |
| 430 | Ga0495592_0329311 | 3300046454 | Bacteria | 985 |
| 431 | Ga0495590_0014877 | 3300046457 | Bacteria | 2835 |
| 432 | Ga0495651_0815238 | 3300046462 | Bacteria | 575 |
| 433 | Ga0495605_0247092 | 3300046474 | Bacteria | 764 |
| 434 | Ga0495584_0663400 | 3300046491 | Bacteria | 532 |
| 435 | Ga0495632_0010535 | 3300046519 | Bacteria | 5464 |
| 436 | Ga0495643_0074203 | 3300046522 | Bacteria | 1782 |
| 437 | Ga0495663_0272364 | 3300046525 | Bacteria | 605 |
| 438 | Ga0495609_0062134 | 3300046538 | Bacteria | 1650 |
| 439 | Ga0495621_0008804 | 3300046539 | Bacteria | 3040 |
| 440 | Ga0495621_0091217 | 3300046539 | Bacteria | 1148 |
| 441 | Ga0495621_0240630 | 3300046539 | Bacteria | 737 |
| 442 | Ga0495597_0016788 | 3300046542 | Bacteria | 3454 |
| 443 | Ga0495597_0167068 | 3300046542 | Bacteria | 895 |
| 444 | Ga0495656_0002859 | 3300046615 | Bacteria | 5785 |
| 445 | Ga0495656_0240054 | 3300046615 | Bacteria | 912 |
| 446 | Ga0495625_0040040 | 3300046660 | Bacteria | 3420 |
| 447 | Ga0495625_0064915 | 3300046660 | Bacteria | 2574 |
| 448 | Ga0495659_0347184 | 3300046664 | Bacteria | 634 |
| 449 | Ga0495649_0005271 | 3300046694 | Bacteria | 8264 |
| 450 | Ga0495660_0114748 | 3300046810 | Bacteria | 1370 |
| 451 | Ga0495687_012354 | 3300047443 | Bacteria | 4520 |
| 452 | Ga0495687_044055 | 3300047443 | Bacteria | 1941 |
| 453 | Ga0495673_0148519 | 3300047469 | Bacteria | 908 |
| 454 | Ga0495673_0364319 | 3300047469 | Bacteria | 508 |
| 455 | Ga0495615_0007612 | 3300048090 | Bacteria | 2062 |
| 456 | Ga0495615_0143056 | 3300048090 | Bacteria | 707 |
| 457 | Ga0495626_0094233 | 3300048091 | Bacteria | 1313 |
| 458 | Ga0495626_0095827 | 3300048091 | Bacteria | 1299 |
| 459 | Ga0495626_0157371 | 3300048091 | Bacteria | 954 |
| 460 | Ga0496100_0038094 | 3300048903 | Bacteria | 3044 |
| 461 | Ga0496102_0037706 | 3300048905 | Bacteria | 4361 |
| 462 | Ga0496102_0048128 | 3300048905 | Bacteria | 3876 |
| 463 | Ga0496103_0039550 | 3300048906 | Bacteria | 2898 |
| 464 | Ga0496104_0100676 | 3300048907 | Bacteria | 2766 |
| 465 | Ga0496105_0047749 | 3300048908 | Bacteria | 3533 |
| 466 | Ga0496106_0049724 | 3300048909 | Bacteria | 3159 |
| 467 | Ga0496107_0321518 | 3300048910 | Bacteria | 1151 |
| 468 | Ga0496107_0372979 | 3300048910 | Bacteria | 1061 |
| 469 | Ga0496108_0385672 | 3300048911 | Bacteria | 1223 |
| 470 | Ga0496109_1017406 | 3300048912 | Bacteria | 766 |
| 471 | Ga0496110_0366592 | 3300048913 | Bacteria | 1312 |
| 472 | Ga0496114_0374778 | 3300048917 | Bacteria | 1260 |
| 473 | Ga0496114_0447338 | 3300048917 | Bacteria | 1144 |
| 474 | Ga0496117_0093107 | 3300048920 | Bacteria | 1934 |
| 475 | Ga0496122_0000331 | 3300048925 | Bacteria | 102617 |
| 476 | Ga0496123_0001132 | 3300048926 | Bacteria | 39831 |
| 477 | Ga0496125_0403710 | 3300048928 | Bacteria | 798 |
| 478 | Ga0501292_025139 | 3300049515 | Bacteria | 980 |
| 479 | Ga0501298_037990 | 3300049521 | Bacteria | 968 |
| 480 | Ga0501033_0866648 | 3300049570 | Bacteria | 608 |
| 481 | Ga0501039_0897324 | 3300049575 | Bacteria | 690 |
| 482 | Ga0501047_0888307 | 3300049581 | Bacteria | 705 |
| 483 | Ga0501206_009574 | 3300049653 | Bacteria | 1290 |
| 484 | Ga0501217_089409 | 3300049661 | Bacteria | 863 |
| 485 | Ga0501249_002182 | 3300049679 | Bacteria | 3988 |
| 486 | Ga0501257_275022 | 3300049686 | Bacteria | 506 |
| 487 | Ga0501241_125768 | 3300049758 | Bacteria | 573 |
| 488 | Ga0501262_000434 | 3300049759 | Bacteria | 5015 |
| 489 | Ga0501265_009467 | 3300049762 | Bacteria | 1178 |
| 490 | Ga0501268_091137 | 3300049765 | Bacteria | 642 |
| 491 | Ga0501281_17434 | 3300049777 | Bacteria | 540 |
| 492 | Ga0501035_0124140 | 3300049822 | Bacteria | 2255 |
| 493 | Ga0501044_0362476 | 3300049823 | Bacteria | 1367 |
| 494 | Ga0501044_0399715 | 3300049823 | Bacteria | 1287 |
| 495 | nmdc:mga03683_482575_c1 | 3300050489 | Bacteria | 599 |
| 496 | nmdc:mga03683_606388_c1 | 3300050489 | Bacteria | 536 |
| 497 | nmdc:mga03683_7058_c1 | 3300050489 | Bacteria | 3878 |
| 498 | nmdc:mga03n38_387605_c1 | 3300050490 | Bacteria | 767 |
| 499 | nmdc:mga03n38_414323_c1 | 3300050490 | Bacteria | 744 |
| 500 | nmdc:mga03n38_807444_c1 | 3300050490 | Bacteria | 546 |
| 501 | nmdc:mga00v17_15127_c1 | 3300050491 | Bacteria | 4326 |
| 502 | nmdc:mga0yw44_36333_c1 | 3300050492 | Bacteria | 2902 |
| 503 | nmdc:mga0yw44_78157_c1 | 3300050492 | Bacteria | 2069 |
| 504 | nmdc:mga0k408_105757_c1 | 3300050493 | Bacteria | 1662 |
| 505 | nmdc:mga0k408_202243_c1 | 3300050493 | Bacteria | 1186 |
| 506 | nmdc:mga0k408_213_c1 | 3300050493 | Bacteria | 31180 |
| 507 | nmdc:mga0k408_259002_c1 | 3300050493 | Bacteria | 1039 |
| 508 | nmdc:mga0k408_26112_c1 | 3300050493 | Bacteria | 3311 |
| 509 | nmdc:mga0k408_2734_c1 | 3300050493 | Bacteria | 9371 |
| 510 | nmdc:mga0k408_288819_c1 | 3300050493 | Bacteria | 979 |
| 511 | nmdc:mga0k408_4322_c1 | 3300050493 | Bacteria | 7542 |
| 512 | nmdc:mga0k408_433646_c1 | 3300050493 | Bacteria | 781 |
| 513 | nmdc:mga0k408_442693_c1 | 3300050493 | Bacteria | 772 |
| 514 | nmdc:mga0k408_492795_c1 | 3300050493 | Bacteria | 726 |
| 515 | nmdc:mga0k408_59469_c1 | 3300050493 | Bacteria | 2220 |
| 516 | nmdc:mga0k408_73079_c1 | 3300050493 | Bacteria | 2003 |
| 517 | nmdc:mga06z11_103140_c1 | 3300050494 | Bacteria | 1568 |
| 518 | nmdc:mga06z11_194999_c1 | 3300050494 | Bacteria | 1174 |
| 519 | nmdc:mga06z11_5202_c1 | 3300050494 | Bacteria | 5200 |
| 520 | nmdc:mga06z11_906526_c1 | 3300050494 | Bacteria | 537 |
| 521 | nmdc:mga04h51_434274_c1 | 3300050495 | Bacteria | 554 |
| 522 | nmdc:mga04h51_68953_c1 | 3300050495 | Bacteria | 1230 |
| 523 | nmdc:mga07m45_1209_c1 | 3300050496 | Bacteria | 11695 |
| 524 | nmdc:mga07m45_142814_c1 | 3300050496 | Bacteria | 1387 |
| 525 | nmdc:mga07m45_17182_c2 | 3300050496 | Bacteria | 1990 |
| 526 | nmdc:mga07m45_19599_c1 | 3300050496 | Bacteria | 3667 |
| 527 | nmdc:mga07m45_246016_c1 | 3300050496 | Bacteria | 1041 |
| 528 | nmdc:mga07m45_277342_c1 | 3300050496 | Bacteria | 975 |
| 529 | nmdc:mga07m45_378891_c1 | 3300050496 | Bacteria | 822 |
| 530 | nmdc:mga07m45_477169_c1 | 3300050496 | Bacteria | 723 |
| 531 | nmdc:mga07m45_7359_c1 | 3300050496 | Bacteria | 5622 |
| 532 | nmdc:mga07m45_769_c1 | 3300050496 | Bacteria | 13783 |
| 533 | nmdc:mga07m45_847_c1 | 3300050496 | Bacteria | 13276 |
| 534 | nmdc:mga07m45_9115_c1 | 3300050496 | Bacteria | 5127 |
| 535 | nmdc:mga09592_20553_c1 | 3300050508 | Bacteria | 5431 |
| 536 | nmdc:mga09592_608040_c1 | 3300050508 | Bacteria | 936 |
| 537 | nmdc:mga0qj67_308676_c1 | 3300050509 | Bacteria | 1281 |
| 538 | nmdc:mga08y16_517723_c1 | 3300050511 | Bacteria | 1210 |
| 539 | nmdc:mga08y16_725833_c1 | 3300050511 | Bacteria | 991 |
| 540 | nmdc:mga0sz30_74644_c1 | 3300050516 | Bacteria | 1463 |
| 541 | Ga0500578_0470340 | 3300053086 | Bacteria | 712 |
| 542 | Ga0500644_0053501 | 3300053088 | Bacteria | 1394 |
| 543 | Ga0500641_0087128 | 3300053096 | Bacteria | 1330 |
| 544 | Ga0500650_0312279 | 3300053098 | Bacteria | 694 |
| 545 | Ga0500562_026047 | 3300053108 | Bacteria | 1532 |
| 546 | Ga0500594_0053068 | 3300053118 | Bacteria | 1147 |
| 547 | Ga0500594_0152195 | 3300053118 | Bacteria | 744 |
| 548 | Ga0500607_047273 | 3300053121 | Bacteria | 2304 |
| 549 | Ga0500618_027589 | 3300053125 | Bacteria | 1350 |
| 550 | Ga0500559_0012676 | 3300053136 | Bacteria | 3578 |
| 551 | Ga0500559_0107388 | 3300053136 | Bacteria | 1291 |
| 552 | Ga0500559_0235912 | 3300053136 | Bacteria | 862 |
| 553 | Ga0500559_0597099 | 3300053136 | Bacteria | 500 |
| 554 | Ga0500561_0297333 | 3300053137 | Bacteria | 515 |
| 555 | Ga0500568_0010664 | 3300053139 | Bacteria | 4293 |
| 556 | Ga0500568_0159761 | 3300053139 | Bacteria | 832 |
| 557 | Ga0500577_0339546 | 3300053142 | Bacteria | 656 |
| 558 | Ga0500586_122938 | 3300053145 | Bacteria | 902 |
| 559 | Ga0500590_131561 | 3300053148 | Bacteria | 1157 |
| 560 | Ga0500616_0116533 | 3300053153 | Bacteria | 1282 |
| 561 | Ga0500620_041657 | 3300053155 | Bacteria | 1510 |
| 562 | Ga0500622_0090798 | 3300053156 | Bacteria | 1516 |
| 563 | Ga0500634_0055091 | 3300053161 | Bacteria | 2129 |
| 564 | Ga0500645_016733 | 3300053730 | Bacteria | 2306 |
| 565 | Ga0590071_009699 | 3300059421 | Bacteria | 2259 |
| 566 | Ga0501082_1496217 | 3300060353 | Bacteria | 590 |
| 567 | Ga0466962_0341192 | 3300061719 | Bacteria | 745 |
| 568 | Ga0466962_0531282 | 3300061719 | Bacteria | 597 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041456 | Ga0451795_0489275 | Ga0451795_0489275_334_603 | 80 |
| 2 | 3300005354 | Ga0070675_100375145 | Ga0070675_1003751452 | 85 |
| 3 | 3300005356 | Ga0070674_100952629 | Ga0070674_1009526292 | 85 |
| 4 | 3300005456 | Ga0070678_100040897 | Ga0070678_1000408973 | 85 |
| 5 | 3300005543 | Ga0070672_100528850 | Ga0070672_1005288502 | 85 |
| 6 | 3300005548 | Ga0070665_100059434 | Ga0070665_1000594344 | 85 |
| 7 | 3300006048 | Ga0075363_100147872 | Ga0075363_1001478722 | 85 |
| 8 | 3300006237 | Ga0097621_101608169 | Ga0097621_1016081692 | 85 |
| 9 | 3300034817 | Ga0373948_0091304 | Ga0373948_0091304_19_294 | 85 |
| 10 | 3300035691 | Ga0373931_0172706 | Ga0373931_0172706_42_317 | 85 |
| 11 | 3300042876 | Ga0451577_0967917 | Ga0451577_0967917_341_613 | 85 |
| 12 | 3300044683 | Ga0466965_0348504 | Ga0466965_0348504_107_373 | 85 |
| 13 | 3300049570 | Ga0501033_0866648 | Ga0501033_0866648_138_404 | 85 |
| 14 | 3300049581 | Ga0501047_0888307 | Ga0501047_0888307_53_319 | 85 |
| 15 | 3300049823 | Ga0501044_0362476 | Ga0501044_0362476_134_400 | 85 |
| 16 | 3300050489 | nmdc:mga03683_482575_c1 | nmdc:mga03683_482575_c1_37_312 | 85 |
| 17 | 3300050490 | nmdc:mga03n38_414323_c1 | nmdc:mga03n38_414323_c1_343_618 | 85 |
| 18 | 3300050496 | nmdc:mga07m45_277342_c1 | nmdc:mga07m45_277342_c1_283_558 | 85 |
| 19 | 3300060353 | Ga0501082_1496217 | Ga0501082_1496217_150_416 | 85 |
| 20 | 3300005295 | Ga0065707_10420912 | Ga0065707_104209122 | 87 |
| 21 | 3300005330 | Ga0070690_100241180 | Ga0070690_1002411802 | 87 |
| 22 | 3300005333 | Ga0070677_10560153 | Ga0070677_105601532 | 87 |
| 23 | 3300005347 | Ga0070668_101013468 | Ga0070668_1010134682 | 87 |
| 24 | 3300005364 | Ga0070673_102024709 | Ga0070673_1020247092 | 87 |
| 25 | 3300005367 | Ga0070667_100203686 | Ga0070667_1002036863 | 87 |
| 26 | 3300005367 | Ga0070667_100217035 | Ga0070667_1002170352 | 87 |
| 27 | 3300005455 | Ga0070663_100226653 | Ga0070663_1002266532 | 87 |
| 28 | 3300005456 | Ga0070678_100002501 | Ga0070678_1000025017 | 87 |
| 29 | 3300005456 | Ga0070678_100378071 | Ga0070678_1003780712 | 87 |
| 30 | 3300005459 | Ga0068867_100116187 | Ga0068867_1001161874 | 87 |
| 31 | 3300005459 | Ga0068867_101139239 | Ga0068867_1011392392 | 87 |
| 32 | 3300005467 | Ga0070706_100000700 | Ga0070706_10000070024 | 87 |
| 33 | 3300005471 | Ga0070698_100796762 | Ga0070698_1007967622 | 87 |
| 34 | 3300005548 | Ga0070665_102248670 | Ga0070665_1022486701 | 87 |
| 35 | 3300005615 | Ga0070702_101473544 | Ga0070702_1014735441 | 87 |
| 36 | 3300005618 | Ga0068864_100375946 | Ga0068864_1003759462 | 87 |
| 37 | 3300005718 | Ga0068866_10133847 | Ga0068866_101338471 | 87 |
| 38 | 3300005841 | Ga0068863_101064235 | Ga0068863_1010642352 | 87 |
| 39 | 3300005841 | Ga0068863_101273972 | Ga0068863_1012739721 | 87 |
| 40 | 3300005843 | Ga0068860_100144594 | Ga0068860_1001445942 | 87 |
| 41 | 3300006048 | Ga0075363_100032316 | Ga0075363_1000323164 | 87 |
| 42 | 3300006177 | Ga0075362_10039587 | Ga0075362_100395871 | 87 |
| 43 | 3300006178 | Ga0075367_10001893 | Ga0075367_1000189311 | 87 |
| 44 | 3300006178 | Ga0075367_10440801 | Ga0075367_104408012 | 87 |
| 45 | 3300006195 | Ga0075366_10016581 | Ga0075366_100165812 | 87 |
| 46 | 3300006195 | Ga0075366_10081601 | Ga0075366_100816013 | 87 |
| 47 | 3300006195 | Ga0075366_10386361 | Ga0075366_103863612 | 87 |
| 48 | 3300006195 | Ga0075366_10464950 | Ga0075366_104649502 | 87 |
| 49 | 3300006237 | Ga0097621_100092847 | Ga0097621_1000928474 | 87 |
| 50 | 3300006353 | Ga0075370_10018552 | Ga0075370_100185524 | 87 |
| 51 | 3300006358 | Ga0068871_100101604 | Ga0068871_1001016042 | 87 |
| 52 | 3300006358 | Ga0068871_100962461 | Ga0068871_1009624612 | 87 |
| 53 | 3300009148 | Ga0105243_10594657 | Ga0105243_105946572 | 87 |
| 54 | 3300009148 | Ga0105243_11385105 | Ga0105243_113851052 | 87 |
| 55 | 3300009176 | Ga0105242_10040790 | Ga0105242_100407904 | 87 |
| 56 | 3300009176 | Ga0105242_12790020 | Ga0105242_127900202 | 87 |
| 57 | 3300009177 | Ga0105248_11050995 | Ga0105248_110509952 | 87 |
| 58 | 3300009553 | Ga0105249_10070627 | Ga0105249_100706272 | 87 |
| 59 | 3300009553 | Ga0105249_11394989 | Ga0105249_113949892 | 87 |
| 60 | 3300013308 | Ga0157375_10375145 | Ga0157375_103751452 | 87 |
| 61 | 3300014325 | Ga0163163_11655891 | Ga0163163_116558912 | 87 |
| 62 | 3300014497 | Ga0182008_10163152 | Ga0182008_101631522 | 87 |
| 63 | 3300014968 | Ga0157379_10924213 | Ga0157379_109242132 | 87 |
| 64 | 3300014969 | Ga0157376_10079988 | Ga0157376_100799883 | 87 |
| 65 | 3300017792 | Ga0163161_10024999 | Ga0163161_100249994 | 87 |
| 66 | 3300017792 | Ga0163161_10945538 | Ga0163161_109455382 | 87 |
| 67 | 3300025273 | Ga0209673_1018116 | Ga0209673_10181162 | 87 |
| 68 | 3300025294 | Ga0209025_1005205 | Ga0209025_10052052 | 87 |
| 69 | 3300025925 | Ga0207650_10444755 | Ga0207650_104447551 | 87 |
| 70 | 3300025926 | Ga0207659_10259706 | Ga0207659_102597063 | 87 |
| 71 | 3300025931 | Ga0207644_10199913 | Ga0207644_101999132 | 87 |
| 72 | 3300025934 | Ga0207686_10089949 | Ga0207686_100899492 | 87 |
| 73 | 3300025935 | Ga0207709_11788719 | Ga0207709_117887192 | 87 |
| 74 | 3300025937 | Ga0207669_10004596 | Ga0207669_100045965 | 87 |
| 75 | 3300025940 | Ga0207691_10277074 | Ga0207691_102770743 | 87 |
| 76 | 3300025941 | Ga0207711_10160331 | Ga0207711_101603312 | 87 |
| 77 | 3300025972 | Ga0207668_10552187 | Ga0207668_105521872 | 87 |
| 78 | 3300025986 | Ga0207658_10054381 | Ga0207658_100543815 | 87 |
| 79 | 3300025986 | Ga0207658_11057474 | Ga0207658_110574742 | 87 |
| 80 | 3300026088 | Ga0207641_12018990 | Ga0207641_120189901 | 87 |
| 81 | 3300026088 | Ga0207641_12043259 | Ga0207641_120432592 | 87 |
| 82 | 3300026089 | Ga0207648_10145032 | Ga0207648_101450322 | 87 |
| 83 | 3300026089 | Ga0207648_10489116 | Ga0207648_104891162 | 87 |
| 84 | 3300026121 | Ga0207683_10004243 | Ga0207683_100042431 | 87 |
| 85 | 3300027907 | Ga0207428_10830146 | Ga0207428_108301462 | 87 |
| 86 | 3300028379 | Ga0268266_11784421 | Ga0268266_117844212 | 87 |
| 87 | 3300028380 | Ga0268265_10045754 | Ga0268265_100457544 | 87 |
| 88 | 3300028381 | Ga0268264_11356619 | Ga0268264_113566192 | 87 |
| 89 | 3300031731 | Ga0307405_11473784 | Ga0307405_114737842 | 87 |
| 90 | 3300032004 | Ga0307414_10671515 | Ga0307414_106715152 | 87 |
| 91 | 3300037418 | Ga0395900_0032376 | Ga0395900_0032376_3726_3992 | 87 |
| 92 | 3300037418 | Ga0395900_0400919 | Ga0395900_0400919_1037_1303 | 87 |
| 93 | 3300037466 | Ga0395898_0035122 | Ga0395898_0035122_3498_3764 | 87 |
| 94 | 3300037471 | Ga0395905_0009324 | Ga0395905_0009324_5987_6253 | 87 |
| 95 | 3300037471 | Ga0395905_0051309 | Ga0395905_0051309_3187_3453 | 87 |
| 96 | 3300038443 | Ga0395901_0055050 | Ga0395901_0055050_726_992 | 87 |
| 97 | 3300038443 | Ga0395901_0133122 | Ga0395901_0133122_1514_1780 | 87 |
| 98 | 3300041441 | Ga0451787_580972 | Ga0451787_580972_256_522 | 87 |
| 99 | 3300041451 | Ga0451791_1838390 | Ga0451791_1838390_677_973 | 87 |
| 100 | 3300041498 | Ga0451841_0609462 | Ga0451841_0609462_216_482 | 87 |
| 101 | 3300044712 | Ga0453684_0073443 | Ga0453684_0073443_2116_2385 | 87 |
| 102 | 3300044719 | Ga0466971_0193211 | Ga0466971_0193211_445_711 | 87 |
| 103 | 3300045049 | Ga0466959_0389704 | Ga0466959_0389704_615_881 | 87 |
| 104 | 3300045051 | Ga0451576_0052498 | Ga0451576_0052498_2243_2512 | 87 |
| 105 | 3300045836 | Ga0466958_0225498 | Ga0466958_0225498_346_612 | 87 |
| 106 | 3300046539 | Ga0495621_0008804 | Ga0495621_0008804_1317_1583 | 87 |
| 107 | 3300050489 | nmdc:mga03683_7058_c1 | nmdc:mga03683_7058_c1_40_306 | 87 |
| 108 | 3300050493 | nmdc:mga0k408_288819_c1 | nmdc:mga0k408_288819_c1_324_590 | 87 |
| 109 | 3300050493 | nmdc:mga0k408_433646_c1 | nmdc:mga0k408_433646_c1_324_590 | 87 |
| 110 | 3300050493 | nmdc:mga0k408_492795_c1 | nmdc:mga0k408_492795_c1_262_528 | 87 |
| 111 | 3300050494 | nmdc:mga06z11_906526_c1 | nmdc:mga06z11_906526_c1_149_415 | 87 |
| 112 | 3300050511 | nmdc:mga08y16_517723_c1 | nmdc:mga08y16_517723_c1_520_786 | 87 |
| 113 | 3300061719 | Ga0466962_0341192 | Ga0466962_0341192_167_433 | 87 |
| 114 | 3300005327 | Ga0070658_10189382 | Ga0070658_101893823 | 88 |
| 115 | 3300005336 | Ga0070680_100257070 | Ga0070680_1002570702 | 88 |
| 116 | 3300005336 | Ga0070680_101659497 | Ga0070680_1016594971 | 88 |
| 117 | 3300005339 | Ga0070660_100011683 | Ga0070660_1000116837 | 88 |
| 118 | 3300005341 | Ga0070691_10211487 | Ga0070691_102114872 | 88 |
| 119 | 3300005344 | Ga0070661_101494736 | Ga0070661_1014947362 | 88 |
| 120 | 3300005356 | Ga0070674_100012613 | Ga0070674_1000126133 | 88 |
| 121 | 3300005458 | Ga0070681_10278353 | Ga0070681_102783533 | 88 |
| 122 | 3300005530 | Ga0070679_100071451 | Ga0070679_1000714513 | 88 |
| 123 | 3300005530 | Ga0070679_100108545 | Ga0070679_1001085451 | 88 |
| 124 | 3300005563 | Ga0068855_100022812 | Ga0068855_1000228125 | 88 |
| 125 | 3300006178 | Ga0075367_10781875 | Ga0075367_107818751 | 88 |
| 126 | 3300006358 | Ga0068871_100262078 | Ga0068871_1002620782 | 88 |
| 127 | 3300006946 | Ga0079104_1027475 | Ga0079104_10274752 | 88 |
| 128 | 3300006948 | Ga0099826_10582353 | Ga0099826_105823532 | 88 |
| 129 | 3300009093 | Ga0105240_10005767 | Ga0105240_1000576713 | 88 |
| 130 | 3300009551 | Ga0105238_10028874 | Ga0105238_100288747 | 88 |
| 131 | 3300013297 | Ga0157378_12020785 | Ga0157378_120207852 | 88 |
| 132 | 3300013306 | Ga0163162_11239855 | Ga0163162_112398552 | 88 |
| 133 | 3300025909 | Ga0207705_10574485 | Ga0207705_105744852 | 88 |
| 134 | 3300025912 | Ga0207707_10875930 | Ga0207707_108759301 | 88 |
| 135 | 3300025917 | Ga0207660_10684877 | Ga0207660_106848772 | 88 |
| 136 | 3300025919 | Ga0207657_10037495 | Ga0207657_100374957 | 88 |
| 137 | 3300025919 | Ga0207657_11118319 | Ga0207657_111183192 | 88 |
| 138 | 3300025921 | Ga0207652_10058562 | Ga0207652_100585623 | 88 |
| 139 | 3300025924 | Ga0207694_10200773 | Ga0207694_102007732 | 88 |
| 140 | 3300025929 | Ga0207664_10151267 | Ga0207664_101512672 | 88 |
| 141 | 3300025949 | Ga0207667_10078799 | Ga0207667_100787993 | 88 |
| 142 | 3300026078 | Ga0207702_11788108 | Ga0207702_117881082 | 88 |
| 143 | 3300028794 | Ga0307515_10167093 | Ga0307515_101670932 | 88 |
| 144 | 3300031456 | Ga0307513_10185683 | Ga0307513_101856833 | 88 |
| 145 | 3300031548 | Ga0307408_100051410 | Ga0307408_1000514102 | 88 |
| 146 | 3300031548 | Ga0307408_100184612 | Ga0307408_1001846122 | 88 |
| 147 | 3300031731 | Ga0307405_10505413 | Ga0307405_105054132 | 88 |
| 148 | 3300031911 | Ga0307412_10558109 | Ga0307412_105581092 | 88 |
| 149 | 3300032002 | Ga0307416_100216767 | Ga0307416_1002167674 | 88 |
| 150 | 3300032126 | Ga0307415_101611695 | Ga0307415_1016116951 | 88 |
| 151 | 3300036401 | Ga0373937_0215739 | Ga0373937_0215739_1084_1350 | 88 |
| 152 | 3300037312 | Ga0395899_0168512 | Ga0395899_0168512_388_657 | 88 |
| 153 | 3300037466 | Ga0395898_0023156 | Ga0395898_0023156_4972_5241 | 88 |
| 154 | 3300037471 | Ga0395905_0004208 | Ga0395905_0004208_8619_8885 | 88 |
| 155 | 3300038443 | Ga0395901_0457891 | Ga0395901_0457891_369_635 | 88 |
| 156 | 3300042876 | Ga0451577_1453105 | Ga0451577_1453105_210_494 | 88 |
| 157 | 3300044712 | Ga0453684_0184107 | Ga0453684_0184107_2085_2351 | 88 |
| 158 | 3300048905 | Ga0496102_0037706 | Ga0496102_0037706_1735_2001 | 88 |
| 159 | 3300049575 | Ga0501039_0897324 | Ga0501039_0897324_310_576 | 88 |
| 160 | 3300049661 | Ga0501217_089409 | Ga0501217_089409_317_583 | 88 |
| 161 | 3300049765 | Ga0501268_091137 | Ga0501268_091137_365_631 | 88 |
| 162 | 3300053139 | Ga0500568_0159761 | Ga0500568_0159761_494_760 | 88 |
| 163 | 3300053142 | Ga0500577_0339546 | Ga0500577_0339546_260_529 | 88 |
| 164 | 3300053145 | Ga0500586_122938 | Ga0500586_122938_204_473 | 88 |
| 165 | 3300053153 | Ga0500616_0116533 | Ga0500616_0116533_670_939 | 88 |
| 166 | 3300053161 | Ga0500634_0055091 | Ga0500634_0055091_953_1219 | 88 |
| 167 | iso_pu_bacteria | 2643221644 | 2644244845 | 88 |
| 168 | 3300005295 | Ga0065707_10537994 | Ga0065707_105379941 | 89 |
| 169 | 3300005339 | Ga0070660_100000354 | Ga0070660_10000035421 | 89 |
| 170 | 3300005344 | Ga0070661_100003595 | Ga0070661_10000359510 | 89 |
| 171 | 3300005353 | Ga0070669_100291715 | Ga0070669_1002917152 | 89 |
| 172 | 3300005354 | Ga0070675_100223409 | Ga0070675_1002234093 | 89 |
| 173 | 3300005366 | Ga0070659_100000846 | Ga0070659_10000084622 | 89 |
| 174 | 3300005455 | Ga0070663_101466481 | Ga0070663_1014664812 | 89 |
| 175 | 3300005457 | Ga0070662_100001973 | Ga0070662_1000019739 | 89 |
| 176 | 3300005530 | Ga0070679_100727819 | Ga0070679_1007278192 | 89 |
| 177 | 3300005548 | Ga0070665_101141059 | Ga0070665_1011410591 | 89 |
| 178 | 3300005616 | Ga0068852_100229803 | Ga0068852_1002298032 | 89 |
| 179 | 3300005843 | Ga0068860_100302219 | Ga0068860_1003022193 | 89 |
| 180 | 3300006051 | Ga0075364_10523274 | Ga0075364_105232742 | 89 |
| 181 | 3300006177 | Ga0075362_10351383 | Ga0075362_103513832 | 89 |
| 182 | 3300006195 | Ga0075366_10013712 | Ga0075366_100137123 | 89 |
| 183 | 3300009094 | Ga0111539_13082756 | Ga0111539_130827561 | 89 |
| 184 | 3300009553 | Ga0105249_10875767 | Ga0105249_108757672 | 89 |
| 185 | 3300013306 | Ga0163162_12089884 | Ga0163162_120898842 | 89 |
| 186 | 3300014325 | Ga0163163_10389797 | Ga0163163_103897972 | 89 |
| 187 | 3300014326 | Ga0157380_10302114 | Ga0157380_103021142 | 89 |
| 188 | 3300014497 | Ga0182008_10003005 | Ga0182008_1000300513 | 89 |
| 189 | 3300014968 | Ga0157379_10088429 | Ga0157379_100884293 | 89 |
| 190 | 3300021384 | Ga0213876_10537746 | Ga0213876_105377462 | 89 |
| 191 | 3300025919 | Ga0207657_10005778 | Ga0207657_100057783 | 89 |
| 192 | 3300025920 | Ga0207649_10010407 | Ga0207649_100104074 | 89 |
| 193 | 3300025922 | Ga0207646_10408677 | Ga0207646_104086772 | 89 |
| 194 | 3300025932 | Ga0207690_10003760 | Ga0207690_100037605 | 89 |
| 195 | 3300028381 | Ga0268264_10298458 | Ga0268264_102984583 | 89 |
| 196 | 3300030734 | Ga0316179_1109249 | Ga0316179_11092492 | 89 |
| 197 | 3300030735 | Ga0316178_1010462 | Ga0316178_10104622 | 89 |
| 198 | 3300030742 | Ga0316183_1067419 | Ga0316183_10674194 | 89 |
| 199 | 3300031251 | Ga0265327_10249184 | Ga0265327_102491842 | 89 |
| 200 | 3300031507 | Ga0307509_10472816 | Ga0307509_104728162 | 89 |
| 201 | 3300031730 | Ga0307516_10649421 | Ga0307516_106494212 | 89 |
| 202 | 3300031731 | Ga0307405_10098893 | Ga0307405_100988933 | 89 |
| 203 | 3300031731 | Ga0307405_10444329 | Ga0307405_104443292 | 89 |
| 204 | 3300031852 | Ga0307410_11123998 | Ga0307410_111239981 | 89 |
| 205 | 3300031995 | Ga0307409_102575018 | Ga0307409_1025750182 | 89 |
| 206 | 3300032004 | Ga0307414_11079933 | Ga0307414_110799332 | 89 |
| 207 | 3300037418 | Ga0395900_0036136 | Ga0395900_0036136_182_454 | 89 |
| 208 | 3300037471 | Ga0395905_0134600 | Ga0395905_0134600_18_290 | 89 |
| 209 | 3300039437 | Ga0436365_0305753 | Ga0436365_0305753_193_465 | 89 |
| 210 | 3300041486 | Ga0451807_2264388 | Ga0451807_2264388_236_505 | 89 |
| 211 | 3300041999 | Ga0439433_0068286 | Ga0439433_0068286_411_680 | 89 |
| 212 | 3300042157 | Ga0439458_0113594 | Ga0439458_0113594_247_516 | 89 |
| 213 | 3300042876 | Ga0451577_2011662 | Ga0451577_2011662_186_455 | 89 |
| 214 | 3300045051 | Ga0451576_1735305 | Ga0451576_1735305_49_318 | 89 |
| 215 | 3300046664 | Ga0495659_0347184 | Ga0495659_0347184_206_496 | 89 |
| 216 | 3300050489 | nmdc:mga03683_606388_c1 | nmdc:mga03683_606388_c1_101_370 | 89 |
| 217 | 3300050493 | nmdc:mga0k408_73079_c1 | nmdc:mga0k408_73079_c1_262_531 | 89 |
| 218 | 3300050511 | nmdc:mga08y16_725833_c1 | nmdc:mga08y16_725833_c1_627_896 | 89 |
| 219 | 3300053088 | Ga0500644_0053501 | Ga0500644_0053501_404_676 | 89 |
| 220 | 3300053096 | Ga0500641_0087128 | Ga0500641_0087128_373_642 | 89 |
| 221 | 3300053108 | Ga0500562_026047 | Ga0500562_026047_558_830 | 89 |
| 222 | 3300053118 | Ga0500594_0152195 | Ga0500594_0152195_260_535 | 89 |
| 223 | 3300053137 | Ga0500561_0297333 | Ga0500561_0297333_218_487 | 89 |
| 224 | 3300053730 | Ga0500645_016733 | Ga0500645_016733_432_701 | 89 |
| 225 | iso_pu_bacteria | 2842747753 | 2842752555 | 89 |
| 226 | iso_pu_bacteria | 2929520902 | 2929522829 | 89 |
| 227 | iso_pu_bacteria | 2945972063 | 2945975574 | 89 |
| 228 | 3300006048 | Ga0075363_100509999 | Ga0075363_1005099992 | 90 |
| 229 | 3300006195 | Ga0075366_10001135 | Ga0075366_100011352 | 90 |
| 230 | 3300006195 | Ga0075366_10098006 | Ga0075366_100980062 | 90 |
| 231 | 3300006353 | Ga0075370_10000133 | Ga0075370_100001337 | 90 |
| 232 | 3300006353 | Ga0075370_10018072 | Ga0075370_100180722 | 90 |
| 233 | 3300006353 | Ga0075370_10031408 | Ga0075370_100314083 | 90 |
| 234 | 3300006353 | Ga0075370_10541309 | Ga0075370_105413092 | 90 |
| 235 | 3300009176 | Ga0105242_10626225 | Ga0105242_106262252 | 90 |
| 236 | 3300010375 | Ga0105239_11237757 | Ga0105239_112377572 | 90 |
| 237 | 3300013306 | Ga0163162_10381931 | Ga0163162_103819312 | 90 |
| 238 | 3300014325 | Ga0163163_11403514 | Ga0163163_114035142 | 90 |
| 239 | 3300014326 | Ga0157380_11989588 | Ga0157380_119895882 | 90 |
| 240 | 3300014497 | Ga0182008_10010313 | Ga0182008_100103135 | 90 |
| 241 | 3300015261 | Ga0182006_1023558 | Ga0182006_10235583 | 90 |
| 242 | 3300015262 | Ga0182007_10004805 | Ga0182007_100048052 | 90 |
| 243 | 3300025903 | Ga0207680_10357255 | Ga0207680_103572552 | 90 |
| 244 | 3300025931 | Ga0207644_11746402 | Ga0207644_117464022 | 90 |
| 245 | 3300025933 | Ga0207706_10005101 | Ga0207706_1000510111 | 90 |
| 246 | 3300026023 | Ga0207677_10666631 | Ga0207677_106666312 | 90 |
| 247 | 3300028380 | Ga0268265_10244673 | Ga0268265_102446732 | 90 |
| 248 | 3300028786 | Ga0307517_10191648 | Ga0307517_101916481 | 90 |
| 249 | 3300028786 | Ga0307517_10224930 | Ga0307517_102249302 | 90 |
| 250 | 3300028794 | Ga0307515_10102481 | Ga0307515_101024813 | 90 |
| 251 | 3300028794 | Ga0307515_10393770 | Ga0307515_103937702 | 90 |
| 252 | 3300030522 | Ga0307512_10305016 | Ga0307512_103050162 | 90 |
| 253 | 3300031456 | Ga0307513_10315173 | Ga0307513_103151732 | 90 |
| 254 | 3300031548 | Ga0307408_100081760 | Ga0307408_1000817604 | 90 |
| 255 | 3300031616 | Ga0307508_10246616 | Ga0307508_102466162 | 90 |
| 256 | 3300031649 | Ga0307514_10080793 | Ga0307514_100807932 | 90 |
| 257 | 3300031731 | Ga0307405_10179159 | Ga0307405_101791592 | 90 |
| 258 | 3300031901 | Ga0307406_10031294 | Ga0307406_100312944 | 90 |
| 259 | 3300031901 | Ga0307406_11199806 | Ga0307406_111998062 | 90 |
| 260 | 3300031911 | Ga0307412_10556509 | Ga0307412_105565092 | 90 |
| 261 | 3300031911 | Ga0307412_11143730 | Ga0307412_111437302 | 90 |
| 262 | 3300031911 | Ga0307412_11576310 | Ga0307412_115763101 | 90 |
| 263 | 3300032002 | Ga0307416_100202898 | Ga0307416_1002028982 | 90 |
| 264 | 3300032002 | Ga0307416_100495964 | Ga0307416_1004959643 | 90 |
| 265 | 3300032002 | Ga0307416_100918242 | Ga0307416_1009182422 | 90 |
| 266 | 3300033180 | Ga0307510_10224231 | Ga0307510_102242313 | 90 |
| 267 | 3300035242 | Ga0373962_0057386 | Ga0373962_0057386_354_629 | 90 |
| 268 | 3300037853 | Ga0436364_1129729 | Ga0436364_1129729_53_325 | 90 |
| 269 | 3300041443 | Ga0451789_0579583 | Ga0451789_0579583_81_353 | 90 |
| 270 | 3300041443 | Ga0451789_1281024 | Ga0451789_1281024_300_581 | 90 |
| 271 | 3300041451 | Ga0451791_1266385 | Ga0451791_1266385_47_319 | 90 |
| 272 | 3300041460 | Ga0451802_1640339 | Ga0451802_1640339_124_405 | 90 |
| 273 | 3300041494 | Ga0451837_0439785 | Ga0451837_0439785_297_569 | 90 |
| 274 | 3300041509 | Ga0451843_1692436 | Ga0451843_1692436_287_595 | 90 |
| 275 | 3300042157 | Ga0439458_0057676 | Ga0439458_0057676_643_921 | 90 |
| 276 | 3300044683 | Ga0466965_0108421 | Ga0466965_0108421_554_829 | 90 |
| 277 | 3300046525 | Ga0495663_0272364 | Ga0495663_0272364_77_358 | 90 |
| 278 | 3300046538 | Ga0495609_0062134 | Ga0495609_0062134_1264_1545 | 90 |
| 279 | 3300046660 | Ga0495625_0064915 | Ga0495625_0064915_2116_2397 | 90 |
| 280 | 3300047469 | Ga0495673_0364319 | Ga0495673_0364319_11_292 | 90 |
| 281 | 3300048903 | Ga0496100_0038094 | Ga0496100_0038094_468_761 | 90 |
| 282 | 3300048905 | Ga0496102_0048128 | Ga0496102_0048128_746_1039 | 90 |
| 283 | 3300048906 | Ga0496103_0039550 | Ga0496103_0039550_1486_1779 | 90 |
| 284 | 3300048907 | Ga0496104_0100676 | Ga0496104_0100676_1059_1352 | 90 |
| 285 | 3300048908 | Ga0496105_0047749 | Ga0496105_0047749_2369_2662 | 90 |
| 286 | 3300048909 | Ga0496106_0049724 | Ga0496106_0049724_2054_2347 | 90 |
| 287 | 3300048910 | Ga0496107_0321518 | Ga0496107_0321518_445_738 | 90 |
| 288 | 3300048910 | Ga0496107_0372979 | Ga0496107_0372979_32_325 | 90 |
| 289 | 3300048911 | Ga0496108_0385672 | Ga0496108_0385672_348_641 | 90 |
| 290 | 3300048912 | Ga0496109_1017406 | Ga0496109_1017406_45_338 | 90 |
| 291 | 3300048913 | Ga0496110_0366592 | Ga0496110_0366592_467_760 | 90 |
| 292 | 3300049515 | Ga0501292_025139 | Ga0501292_025139_337_630 | 90 |
| 293 | 3300049521 | Ga0501298_037990 | Ga0501298_037990_72_365 | 90 |
| 294 | 3300049653 | Ga0501206_009574 | Ga0501206_009574_955_1248 | 90 |
| 295 | 3300049762 | Ga0501265_009467 | Ga0501265_009467_177_470 | 90 |
| 296 | 3300049777 | Ga0501281_17434 | Ga0501281_17434_70_363 | 90 |
| 297 | 3300050490 | nmdc:mga03n38_807444_c1 | nmdc:mga03n38_807444_c1_264_536 | 90 |
| 298 | 3300050493 | nmdc:mga0k408_105757_c1 | nmdc:mga0k408_105757_c1_1139_1423 | 90 |
| 299 | 3300050493 | nmdc:mga0k408_259002_c1 | nmdc:mga0k408_259002_c1_616_888 | 90 |
| 300 | 3300050493 | nmdc:mga0k408_2734_c1 | nmdc:mga0k408_2734_c1_546_827 | 90 |
| 301 | 3300050496 | nmdc:mga07m45_1209_c1 | nmdc:mga07m45_1209_c1_10649_10933 | 90 |
| 302 | 3300050496 | nmdc:mga07m45_142814_c1 | nmdc:mga07m45_142814_c1_361_669 | 90 |
| 303 | 3300050496 | nmdc:mga07m45_477169_c1 | nmdc:mga07m45_477169_c1_392_664 | 90 |
| 304 | 3300050496 | nmdc:mga07m45_847_c1 | nmdc:mga07m45_847_c1_12898_13179 | 90 |
| 305 | 3300050496 | nmdc:mga07m45_9115_c1 | nmdc:mga07m45_9115_c1_3831_4103 | 90 |
| 306 | 3300053139 | Ga0500568_0010664 | Ga0500568_0010664_1734_2015 | 90 |
| 307 | 3300059421 | Ga0590071_009699 | Ga0590071_009699_647_919 | 90 |
| 308 | iso_pu_bacteria | 2945945610 | 2945945954 | 90 |
| 309 | 3300005327 | Ga0070658_10386016 | Ga0070658_103860162 | 91 |
| 310 | 3300005328 | Ga0070676_11448723 | Ga0070676_114487232 | 91 |
| 311 | 3300005330 | Ga0070690_100917644 | Ga0070690_1009176442 | 91 |
| 312 | 3300005333 | Ga0070677_10310172 | Ga0070677_103101722 | 91 |
| 313 | 3300005333 | Ga0070677_10539574 | Ga0070677_105395742 | 91 |
| 314 | 3300005334 | Ga0068869_100135993 | Ga0068869_1001359933 | 91 |
| 315 | 3300005335 | Ga0070666_10413270 | Ga0070666_104132702 | 91 |
| 316 | 3300005337 | Ga0070682_100266161 | Ga0070682_1002661612 | 91 |
| 317 | 3300005338 | Ga0068868_100522906 | Ga0068868_1005229062 | 91 |
| 318 | 3300005339 | Ga0070660_101051185 | Ga0070660_1010511852 | 91 |
| 319 | 3300005340 | Ga0070689_100392442 | Ga0070689_1003924422 | 91 |
| 320 | 3300005347 | Ga0070668_100118282 | Ga0070668_1001182823 | 91 |
| 321 | 3300005354 | Ga0070675_100001027 | Ga0070675_1000010275 | 91 |
| 322 | 3300005354 | Ga0070675_100444581 | Ga0070675_1004445813 | 91 |
| 323 | 3300005366 | Ga0070659_100232449 | Ga0070659_1002324491 | 91 |
| 324 | 3300005367 | Ga0070667_100002153 | Ga0070667_10000215310 | 91 |
| 325 | 3300005438 | Ga0070701_10519980 | Ga0070701_105199802 | 91 |
| 326 | 3300005456 | Ga0070678_100234279 | Ga0070678_1002342792 | 91 |
| 327 | 3300005456 | Ga0070678_101387395 | Ga0070678_1013873952 | 91 |
| 328 | 3300005457 | Ga0070662_100089754 | Ga0070662_1000897544 | 91 |
| 329 | 3300005459 | Ga0068867_100865244 | Ga0068867_1008652442 | 91 |
| 330 | 3300005459 | Ga0068867_100930765 | Ga0068867_1009307651 | 91 |
| 331 | 3300005539 | Ga0068853_100037877 | Ga0068853_1000378775 | 91 |
| 332 | 3300005548 | Ga0070665_100407372 | Ga0070665_1004073723 | 91 |
| 333 | 3300005563 | Ga0068855_100136450 | Ga0068855_1001364503 | 91 |
| 334 | 3300005577 | Ga0068857_100032539 | Ga0068857_1000325395 | 91 |
| 335 | 3300005578 | Ga0068854_100124186 | Ga0068854_1001241864 | 91 |
| 336 | 3300005617 | Ga0068859_100909238 | Ga0068859_1009092383 | 91 |
| 337 | 3300005617 | Ga0068859_102289782 | Ga0068859_1022897822 | 91 |
| 338 | 3300005841 | Ga0068863_100892422 | Ga0068863_1008924222 | 91 |
| 339 | 3300005842 | Ga0068858_101152333 | Ga0068858_1011523332 | 91 |
| 340 | 3300005843 | Ga0068860_100437468 | Ga0068860_1004374683 | 91 |
| 341 | 3300006038 | Ga0075365_10778261 | Ga0075365_107782612 | 91 |
| 342 | 3300006042 | Ga0075368_10026642 | Ga0075368_100266422 | 91 |
| 343 | 3300006048 | Ga0075363_100140039 | Ga0075363_1001400393 | 91 |
| 344 | 3300006051 | Ga0075364_10066367 | Ga0075364_100663674 | 91 |
| 345 | 3300006051 | Ga0075364_10638315 | Ga0075364_106383152 | 91 |
| 346 | 3300006177 | Ga0075362_10006678 | Ga0075362_100066784 | 91 |
| 347 | 3300006177 | Ga0075362_10049615 | Ga0075362_100496151 | 91 |
| 348 | 3300006177 | Ga0075362_10111742 | Ga0075362_101117422 | 91 |
| 349 | 3300006178 | Ga0075367_10023179 | Ga0075367_100231795 | 91 |
| 350 | 3300006186 | Ga0075369_10022389 | Ga0075369_100223893 | 91 |
| 351 | 3300006186 | Ga0075369_10067475 | Ga0075369_100674753 | 91 |
| 352 | 3300006195 | Ga0075366_10020149 | Ga0075366_100201493 | 91 |
| 353 | 3300006195 | Ga0075366_10191090 | Ga0075366_101910902 | 91 |
| 354 | 3300006195 | Ga0075366_10565077 | Ga0075366_105650772 | 91 |
| 355 | 3300006237 | Ga0097621_102190406 | Ga0097621_1021904061 | 91 |
| 356 | 3300006353 | Ga0075370_10001450 | Ga0075370_1000145014 | 91 |
| 357 | 3300006353 | Ga0075370_10010864 | Ga0075370_100108644 | 91 |
| 358 | 3300006353 | Ga0075370_10455059 | Ga0075370_104550592 | 91 |
| 359 | 3300006353 | Ga0075370_10466502 | Ga0075370_104665022 | 91 |
| 360 | 3300006353 | Ga0075370_10793026 | Ga0075370_107930261 | 91 |
| 361 | 3300006931 | Ga0097620_100909225 | Ga0097620_1009092253 | 91 |
| 362 | 3300006931 | Ga0097620_102290545 | Ga0097620_1022905452 | 91 |
| 363 | 3300009093 | Ga0105240_10302814 | Ga0105240_103028142 | 91 |
| 364 | 3300009094 | Ga0111539_11968237 | Ga0111539_119682371 | 91 |
| 365 | 3300009098 | Ga0105245_12278214 | Ga0105245_122782142 | 91 |
| 366 | 3300009177 | Ga0105248_10119058 | Ga0105248_101190583 | 91 |
| 367 | 3300009545 | Ga0105237_10005313 | Ga0105237_1000531313 | 91 |
| 368 | 3300009551 | Ga0105238_11005752 | Ga0105238_110057521 | 91 |
| 369 | 3300010375 | Ga0105239_10101058 | Ga0105239_101010585 | 91 |
| 370 | 3300013308 | Ga0157375_10240126 | Ga0157375_102401263 | 91 |
| 371 | 3300013308 | Ga0157375_11218252 | Ga0157375_112182522 | 91 |
| 372 | 3300014326 | Ga0157380_10556801 | Ga0157380_105568012 | 91 |
| 373 | 3300014968 | Ga0157379_10174942 | Ga0157379_101749423 | 91 |
| 374 | 3300017792 | Ga0163161_10209265 | Ga0163161_102092653 | 91 |
| 375 | 3300025256 | Ga0209759_1001977 | Ga0209759_10019775 | 91 |
| 376 | 3300025893 | Ga0207682_10384251 | Ga0207682_103842512 | 91 |
| 377 | 3300025907 | Ga0207645_10048479 | Ga0207645_100484792 | 91 |
| 378 | 3300025907 | Ga0207645_10052162 | Ga0207645_100521623 | 91 |
| 379 | 3300025913 | Ga0207695_10372588 | Ga0207695_103725883 | 91 |
| 380 | 3300025914 | Ga0207671_10099308 | Ga0207671_100993084 | 91 |
| 381 | 3300025919 | Ga0207657_11501069 | Ga0207657_115010692 | 91 |
| 382 | 3300025923 | Ga0207681_10375818 | Ga0207681_103758181 | 91 |
| 383 | 3300025925 | Ga0207650_10375931 | Ga0207650_103759312 | 91 |
| 384 | 3300025925 | Ga0207650_10946980 | Ga0207650_109469801 | 91 |
| 385 | 3300025926 | Ga0207659_10245191 | Ga0207659_102451913 | 91 |
| 386 | 3300025926 | Ga0207659_10635188 | Ga0207659_106351883 | 91 |
| 387 | 3300025927 | Ga0207687_10313050 | Ga0207687_103130502 | 91 |
| 388 | 3300025933 | Ga0207706_10058552 | Ga0207706_100585525 | 91 |
| 389 | 3300025933 | Ga0207706_11151867 | Ga0207706_111518671 | 91 |
| 390 | 3300025935 | Ga0207709_10147683 | Ga0207709_101476832 | 91 |
| 391 | 3300025940 | Ga0207691_10042442 | Ga0207691_100424423 | 91 |
| 392 | 3300025942 | Ga0207689_10026426 | Ga0207689_100264265 | 91 |
| 393 | 3300025949 | Ga0207667_10135305 | Ga0207667_101353053 | 91 |
| 394 | 3300025981 | Ga0207640_10238457 | Ga0207640_102384573 | 91 |
| 395 | 3300025981 | Ga0207640_10357000 | Ga0207640_103570002 | 91 |
| 396 | 3300025986 | Ga0207658_10001079 | Ga0207658_1000107913 | 91 |
| 397 | 3300026023 | Ga0207677_10568457 | Ga0207677_105684572 | 91 |
| 398 | 3300026041 | Ga0207639_10098896 | Ga0207639_100988965 | 91 |
| 399 | 3300026089 | Ga0207648_10220707 | Ga0207648_102207074 | 91 |
| 400 | 3300026116 | Ga0207674_10029917 | Ga0207674_100299175 | 91 |
| 401 | 3300026121 | Ga0207683_11006933 | Ga0207683_110069332 | 91 |
| 402 | 3300027866 | Ga0209813_10037472 | Ga0209813_100374723 | 91 |
| 403 | 3300028379 | Ga0268266_10087578 | Ga0268266_100875784 | 91 |
| 404 | 3300028379 | Ga0268266_11490230 | Ga0268266_114902301 | 91 |
| 405 | 3300028380 | Ga0268265_11596099 | Ga0268265_115960991 | 91 |
| 406 | 3300028381 | Ga0268264_10136557 | Ga0268264_101365572 | 91 |
| 407 | 3300028381 | Ga0268264_10629152 | Ga0268264_106291521 | 91 |
| 408 | 3300030522 | Ga0307512_10201555 | Ga0307512_102015552 | 91 |
| 409 | 3300031456 | Ga0307513_10004582 | Ga0307513_1000458212 | 91 |
| 410 | 3300031649 | Ga0307514_10000928 | Ga0307514_1000092810 | 91 |
| 411 | 3300031730 | Ga0307516_10087584 | Ga0307516_100875842 | 91 |
| 412 | 3300035117 | Ga0373953_0126769 | Ga0373953_0126769_510_785 | 91 |
| 413 | 3300037068 | Ga0373925_0019503 | Ga0373925_0019503_47_322 | 91 |
| 414 | 3300041509 | Ga0451843_1258370 | Ga0451843_1258370_821_1096 | 91 |
| 415 | 3300042012 | Ga0439455_0073213 | Ga0439455_0073213_275_559 | 91 |
| 416 | 3300044673 | Ga0453683_0001887 | Ga0453683_0001887_2517_2810 | 91 |
| 417 | 3300045051 | Ga0451576_0036711 | Ga0451576_0036711_720_1013 | 91 |
| 418 | 3300046457 | Ga0495590_0014877 | Ga0495590_0014877_157_444 | 91 |
| 419 | 3300046474 | Ga0495605_0247092 | Ga0495605_0247092_287_574 | 91 |
| 420 | 3300046491 | Ga0495584_0663400 | Ga0495584_0663400_153_440 | 91 |
| 421 | 3300046519 | Ga0495632_0010535 | Ga0495632_0010535_2302_2589 | 91 |
| 422 | 3300046522 | Ga0495643_0074203 | Ga0495643_0074203_411_704 | 91 |
| 423 | 3300046542 | Ga0495597_0016788 | Ga0495597_0016788_574_867 | 91 |
| 424 | 3300046542 | Ga0495597_0167068 | Ga0495597_0167068_423_710 | 91 |
| 425 | 3300046615 | Ga0495656_0240054 | Ga0495656_0240054_320_595 | 91 |
| 426 | 3300046660 | Ga0495625_0040040 | Ga0495625_0040040_722_1009 | 91 |
| 427 | 3300046694 | Ga0495649_0005271 | Ga0495649_0005271_6133_6420 | 91 |
| 428 | 3300046810 | Ga0495660_0114748 | Ga0495660_0114748_567_854 | 91 |
| 429 | 3300047443 | Ga0495687_012354 | Ga0495687_012354_2608_2901 | 91 |
| 430 | 3300047443 | Ga0495687_044055 | Ga0495687_044055_133_420 | 91 |
| 431 | 3300047469 | Ga0495673_0148519 | Ga0495673_0148519_14_301 | 91 |
| 432 | 3300048090 | Ga0495615_0007612 | Ga0495615_0007612_1660_1935 | 91 |
| 433 | 3300048091 | Ga0495626_0094233 | Ga0495626_0094233_848_1141 | 91 |
| 434 | 3300048091 | Ga0495626_0095827 | Ga0495626_0095827_217_504 | 91 |
| 435 | 3300048091 | Ga0495626_0157371 | Ga0495626_0157371_467_754 | 91 |
| 436 | 3300048917 | Ga0496114_0374778 | Ga0496114_0374778_428_727 | 91 |
| 437 | 3300049758 | Ga0501241_125768 | Ga0501241_125768_177_479 | 91 |
| 438 | 3300049822 | Ga0501035_0124140 | Ga0501035_0124140_1557_1832 | 91 |
| 439 | 3300050490 | nmdc:mga03n38_387605_c1 | nmdc:mga03n38_387605_c1_112_405 | 91 |
| 440 | 3300050491 | nmdc:mga00v17_15127_c1 | nmdc:mga00v17_15127_c1_2318_2611 | 91 |
| 441 | 3300050492 | nmdc:mga0yw44_78157_c1 | nmdc:mga0yw44_78157_c1_313_600 | 91 |
| 442 | 3300050493 | nmdc:mga0k408_202243_c1 | nmdc:mga0k408_202243_c1_307_597 | 91 |
| 443 | 3300050493 | nmdc:mga0k408_213_c1 | nmdc:mga0k408_213_c1_19584_19871 | 91 |
| 444 | 3300050493 | nmdc:mga0k408_26112_c1 | nmdc:mga0k408_26112_c1_2957_3247 | 91 |
| 445 | 3300050493 | nmdc:mga0k408_4322_c1 | nmdc:mga0k408_4322_c1_5597_5890 | 91 |
| 446 | 3300050493 | nmdc:mga0k408_442693_c1 | nmdc:mga0k408_442693_c1_379_669 | 91 |
| 447 | 3300050493 | nmdc:mga0k408_59469_c1 | nmdc:mga0k408_59469_c1_344_625 | 91 |
| 448 | 3300050494 | nmdc:mga06z11_103140_c1 | nmdc:mga06z11_103140_c1_226_507 | 91 |
| 449 | 3300050494 | nmdc:mga06z11_194999_c1 | nmdc:mga06z11_194999_c1_139_432 | 91 |
| 450 | 3300050494 | nmdc:mga06z11_5202_c1 | nmdc:mga06z11_5202_c1_76_363 | 91 |
| 451 | 3300050495 | nmdc:mga04h51_434274_c1 | nmdc:mga04h51_434274_c1_192_479 | 91 |
| 452 | 3300050495 | nmdc:mga04h51_68953_c1 | nmdc:mga04h51_68953_c1_528_818 | 91 |
| 453 | 3300050496 | nmdc:mga07m45_19599_c1 | nmdc:mga07m45_19599_c1_2010_2303 | 91 |
| 454 | 3300050496 | nmdc:mga07m45_246016_c1 | nmdc:mga07m45_246016_c1_573_863 | 91 |
| 455 | 3300050496 | nmdc:mga07m45_378891_c1 | nmdc:mga07m45_378891_c1_103_393 | 91 |
| 456 | 3300050496 | nmdc:mga07m45_7359_c1 | nmdc:mga07m45_7359_c1_1620_1901 | 91 |
| 457 | 3300050496 | nmdc:mga07m45_769_c1 | nmdc:mga07m45_769_c1_2888_3175 | 91 |
| 458 | 3300050516 | nmdc:mga0sz30_74644_c1 | nmdc:mga0sz30_74644_c1_1086_1373 | 91 |
| 459 | 3300053086 | Ga0500578_0470340 | Ga0500578_0470340_142_429 | 91 |
| 460 | 3300053098 | Ga0500650_0312279 | Ga0500650_0312279_273_560 | 91 |
| 461 | 3300003544 | Ga0007417J51691_1110541 | Ga0007417J51691_11105412 | 92 |
| 462 | 3300003761 | Ga0055535_1007416 | Ga0055535_10074162 | 92 |
| 463 | 3300005331 | Ga0070670_101744585 | Ga0070670_1017445852 | 92 |
| 464 | 3300005354 | Ga0070675_100341061 | Ga0070675_1003410611 | 92 |
| 465 | 3300005365 | Ga0070688_101487132 | Ga0070688_1014871322 | 92 |
| 466 | 3300005459 | Ga0068867_101063080 | Ga0068867_1010630802 | 92 |
| 467 | 3300005841 | Ga0068863_100191568 | Ga0068863_1001915681 | 92 |
| 468 | 3300005841 | Ga0068863_101283499 | Ga0068863_1012834992 | 92 |
| 469 | 3300005844 | Ga0068862_100663517 | Ga0068862_1006635171 | 92 |
| 470 | 3300006038 | Ga0075365_10066115 | Ga0075365_100661154 | 92 |
| 471 | 3300006186 | Ga0075369_10340690 | Ga0075369_103406902 | 92 |
| 472 | 3300006237 | Ga0097621_100663252 | Ga0097621_1006632522 | 92 |
| 473 | 3300006358 | Ga0068871_100399973 | Ga0068871_1003999732 | 92 |
| 474 | 3300006846 | Ga0075430_100013420 | Ga0075430_1000134204 | 92 |
| 475 | 3300006880 | Ga0075429_100001318 | Ga0075429_10000131817 | 92 |
| 476 | 3300009545 | Ga0105237_10068698 | Ga0105237_100686984 | 92 |
| 477 | 3300011119 | Ga0105246_11157157 | Ga0105246_111571572 | 92 |
| 478 | 3300014325 | Ga0163163_11132473 | Ga0163163_111324732 | 92 |
| 479 | 3300014969 | Ga0157376_11403641 | Ga0157376_114036412 | 92 |
| 480 | 3300014969 | Ga0157376_11559935 | Ga0157376_115599352 | 92 |
| 481 | 3300025291 | Ga0209675_1038104 | Ga0209675_10381041 | 92 |
| 482 | 3300025299 | Ga0209256_1000049 | Ga0209256_100004947 | 92 |
| 483 | 3300025923 | Ga0207681_10336926 | Ga0207681_103369261 | 92 |
| 484 | 3300025927 | Ga0207687_10904539 | Ga0207687_109045391 | 92 |
| 485 | 3300025961 | Ga0207712_10484676 | Ga0207712_104846762 | 92 |
| 486 | 3300026095 | Ga0207676_11421137 | Ga0207676_114211372 | 92 |
| 487 | 3300027682 | Ga0209971_1135612 | Ga0209971_11356121 | 92 |
| 488 | 3300031507 | Ga0307509_10051823 | Ga0307509_100518235 | 92 |
| 489 | 3300031616 | Ga0307508_10136659 | Ga0307508_101366593 | 92 |
| 490 | 3300031730 | Ga0307516_10002259 | Ga0307516_1000225918 | 92 |
| 491 | 3300031911 | Ga0307412_10008057 | Ga0307412_100080579 | 92 |
| 492 | 3300033179 | Ga0307507_10318660 | Ga0307507_103186601 | 92 |
| 493 | 3300041413 | Ga0439465_0177572 | Ga0439465_0177572_267_545 | 92 |
| 494 | 3300041997 | Ga0439431_0002851 | Ga0439431_0002851_1612_1890 | 92 |
| 495 | 3300042014 | Ga0439457_098107 | Ga0439457_098107_235_630 | 92 |
| 496 | 3300042121 | Ga0450919_001154 | Ga0450919_001154_2059_2337 | 92 |
| 497 | 3300042134 | Ga0450898_017534 | Ga0450898_017534_466_825 | 92 |
| 498 | 3300042156 | Ga0439446_0017968 | Ga0439446_0017968_1030_1371 | 92 |
| 499 | 3300042435 | Ga0439434_0214505 | Ga0439434_0214505_272_550 | 92 |
| 500 | 3300042438 | Ga0439459_0095371 | Ga0439459_0095371_88_465 | 92 |
| 501 | 3300042531 | Ga0450918_000077 | Ga0450918_000077_19042_19320 | 92 |
| 502 | 3300044712 | Ga0453684_0081347 | Ga0453684_0081347_2389_2667 | 92 |
| 503 | 3300046462 | Ga0495651_0815238 | Ga0495651_0815238_210_488 | 92 |
| 504 | 3300046539 | Ga0495621_0240630 | Ga0495621_0240630_49_366 | 92 |
| 505 | 3300048917 | Ga0496114_0447338 | Ga0496114_0447338_755_1033 | 92 |
| 506 | 3300048925 | Ga0496122_0000331 | Ga0496122_0000331_69051_69365 | 92 |
| 507 | 3300048926 | Ga0496123_0001132 | Ga0496123_0001132_34154_34468 | 92 |
| 508 | 3300049679 | Ga0501249_002182 | Ga0501249_002182_2477_2779 | 92 |
| 509 | 3300049759 | Ga0501262_000434 | Ga0501262_000434_2388_2690 | 92 |
| 510 | 3300050492 | nmdc:mga0yw44_36333_c1 | nmdc:mga0yw44_36333_c1_1730_2023 | 92 |
| 511 | 3300050496 | nmdc:mga07m45_17182_c2 | nmdc:mga07m45_17182_c2_924_1202 | 92 |
| 512 | 3300050508 | nmdc:mga09592_20553_c1 | nmdc:mga09592_20553_c1_2066_2380 | 92 |
| 513 | 3300053118 | Ga0500594_0053068 | Ga0500594_0053068_696_983 | 92 |
| 514 | 3300053125 | Ga0500618_027589 | Ga0500618_027589_442_750 | 92 |
| 515 | 3300053136 | Ga0500559_0012676 | Ga0500559_0012676_2569_2856 | 92 |
| 516 | 3300053136 | Ga0500559_0235912 | Ga0500559_0235912_103_381 | 92 |
| 517 | 3300053148 | Ga0500590_131561 | Ga0500590_131561_741_1022 | 92 |
| 518 | 3300053155 | Ga0500620_041657 | Ga0500620_041657_1008_1286 | 92 |
| 519 | 3300006058 | Ga0075432_10007264 | Ga0075432_100072646 | 93 |
| 520 | 3300025242 | Ga0209258_100489 | Ga0209258_1004896 | 93 |
| 521 | 3300025923 | Ga0207681_10011235 | Ga0207681_100112351 | 93 |
| 522 | 3300025940 | Ga0207691_10265054 | Ga0207691_102650543 | 93 |
| 523 | 3300027907 | Ga0207428_10398673 | Ga0207428_103986732 | 93 |
| 524 | 3300028794 | Ga0307515_10079492 | Ga0307515_100794924 | 93 |
| 525 | 3300031456 | Ga0307513_10002473 | Ga0307513_1000247311 | 93 |
| 526 | 3300031456 | Ga0307513_10616172 | Ga0307513_106161722 | 93 |
| 527 | 3300037471 | Ga0395905_0097823 | Ga0395905_0097823_1315_1596 | 93 |
| 528 | 3300041443 | Ga0451789_1132921 | Ga0451789_1132921_47_355 | 93 |
| 529 | 3300044683 | Ga0466965_0082018 | Ga0466965_0082018_1220_1501 | 93 |
| 530 | 3300044706 | Ga0466964_0468125 | Ga0466964_0468125_46_327 | 93 |
| 531 | 3300046454 | Ga0495592_0329311 | Ga0495592_0329311_582_875 | 93 |
| 532 | 3300048920 | Ga0496117_0093107 | Ga0496117_0093107_108_425 | 93 |
| 533 | 3300048928 | Ga0496125_0403710 | Ga0496125_0403710_314_607 | 93 |
| 534 | 3300053136 | Ga0500559_0107388 | Ga0500559_0107388_922_1227 | 93 |
| 535 | 3300053156 | Ga0500622_0090798 | Ga0500622_0090798_159_464 | 93 |
| 536 | 3300061719 | Ga0466962_0531282 | Ga0466962_0531282_20_301 | 93 |
| 537 | 3300003792 | Ga0055540_1006805 | Ga0055540_10068055 | 94 |
| 538 | 3300003794 | Ga0055531_10001090 | Ga0055531_1000109018 | 94 |
| 539 | 3300009176 | Ga0105242_13024558 | Ga0105242_130245581 | 94 |
| 540 | 3300025273 | Ga0209673_1020479 | Ga0209673_10204794 | 94 |
| 541 | 3300025303 | Ga0209051_1000456 | Ga0209051_10004565 | 94 |
| 542 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015835 | 94 |
| 543 | 3300044683 | Ga0466965_0104705 | Ga0466965_0104705_863_1165 | 94 |
| 544 | 3300046539 | Ga0495621_0091217 | Ga0495621_0091217_559_867 | 94 |
| 545 | 3300046615 | Ga0495656_0002859 | Ga0495656_0002859_1637_1945 | 94 |
| 546 | 3300048090 | Ga0495615_0143056 | Ga0495615_0143056_290_598 | 94 |
| 547 | 3300050508 | nmdc:mga09592_608040_c1 | nmdc:mga09592_608040_c1_466_768 | 94 |
| 548 | 3300050509 | nmdc:mga0qj67_308676_c1 | nmdc:mga0qj67_308676_c1_363_665 | 94 |
| 549 | 3300009553 | Ga0105249_10205185 | Ga0105249_102051853 | 95 |
| 550 | 3300037471 | Ga0395905_0152398 | Ga0395905_0152398_777_1088 | 95 |
| 551 | 3300005338 | Ga0068868_101452412 | Ga0068868_1014524122 | 96 |
| 552 | 3300005367 | Ga0070667_100145138 | Ga0070667_1001451382 | 96 |
| 553 | 3300026023 | Ga0207677_11019856 | Ga0207677_110198561 | 96 |
| 554 | 3300026142 | Ga0207698_10706613 | Ga0207698_107066132 | 96 |
| 555 | 3300053121 | Ga0500607_047273 | Ga0500607_047273_615_905 | 96 |
| 556 | 3300053136 | Ga0500559_0597099 | Ga0500559_0597099_176_466 | 96 |
| 557 | 3300031995 | Ga0307409_100376534 | Ga0307409_1003765343 | 97 |
| 558 | 3300037418 | Ga0395900_0595942 | Ga0395900_0595942_67_396 | 97 |
| 559 | 3300037471 | Ga0395905_0170283 | Ga0395905_0170283_504_833 | 97 |
| 560 | 3300005295 | Ga0065707_10337456 | Ga0065707_103374562 | 98 |
| 561 | 3300005365 | Ga0070688_100417019 | Ga0070688_1004170192 | 98 |
| 562 | 3300005563 | Ga0068855_100060040 | Ga0068855_1000600404 | 98 |
| 563 | 3300005616 | Ga0068852_100187498 | Ga0068852_1001874982 | 98 |
| 564 | 3300005617 | Ga0068859_101970645 | Ga0068859_1019706451 | 98 |
| 565 | 3300006931 | Ga0097620_101970483 | Ga0097620_1019704831 | 98 |
| 566 | 3300025949 | Ga0207667_10056831 | Ga0207667_100568312 | 98 |
| 567 | 3300026118 | Ga0207675_102076351 | Ga0207675_1020763512 | 98 |
| 568 | 3300026142 | Ga0207698_10169719 | Ga0207698_101697192 | 98 |
| 569 | 3300049686 | Ga0501257_275022 | Ga0501257_275022_104_409 | 98 |
| 570 | 3300001979 | JGI24740J21852_10009214 | JGI24740J21852_100092143 | 99 |
| 571 | 3300026078 | Ga0207702_10478014 | Ga0207702_104780142 | 99 |
| 572 | 3300031456 | Ga0307513_10469354 | Ga0307513_104693542 | 99 |
| 573 | 3300049823 | Ga0501044_0399715 | Ga0501044_0399715_414_725 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar