metagRoot

F465118

General Info

Members	Datasets	Scaffolds	Average Seq Length
572	392	459	135

Family's Representative Sequence

Representative Sequence	3300048921\|Ga0496118_0092536\|Ga0496118_0092536_565_1047
Length	160
Sequence	MLARLLPGSDADGFSKRSTQTRAERLTTVAGERNLNALLKDMKPEMQPGIFVFCTIPPNDSVPAAVNPLLTFREQEGTTLVIQREEAEAAGLRYAFASRMITLTVHSALDAVGFLAAITAHLAEAGISVNAVSAFHHDHLFVPADRADDAMAALREMSRT

Samples

	Sample ID	Description	Type	Environment
1	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
2	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
3	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
4	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
5	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
6	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
7	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
8	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
9	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
10	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
11	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
12	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
13	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
14	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
15	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
16	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
17	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
18	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
19	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
20	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
21	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
22	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
23	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
24	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
25	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
26	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
27	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
28	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
29	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
30	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
31	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
32	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
33	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
34	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
35	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
36	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
37	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
38	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
39	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
40	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
41	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
42	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
43	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
44	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
45	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
46	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
47	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
48	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
49	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
50	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
51	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
52	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
53	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
54	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
55	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
56	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
57	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
58	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
59	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
60	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
61	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
62	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
63	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
64	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
65	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
66	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
67	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
68	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
69	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
70	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
71	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
72	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
73	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
74	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
75	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
76	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
77	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
78	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
79	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
80	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
81	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
82	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
83	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
84	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
85	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
86	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
87	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
88	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
89	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
90	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
91	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
92	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
93	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
94	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
95	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
96	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
97	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
98	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
99	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
100	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
101	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
102	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
103	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
104	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
105	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
106	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
107	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
108	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
109	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
110	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
111	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
112	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
113	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
114	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
115	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
116	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
117	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
118	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
119	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
120	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
121	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
122	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
123	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
124	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
125	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
126	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
127	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
128	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
129	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
130	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
131	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
132	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
133	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
134	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
135	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
136	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
137	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
138	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
139	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
140	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
141	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
142	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
143	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
144	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
145	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
146	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
147	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
148	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
149	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
150	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
151	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
152	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
153	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
154	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
155	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
156	3300012503	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R	Metagenome	Rhizosphere
157	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
158	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
159	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
160	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
161	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
162	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
163	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
164	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
165	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
166	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
167	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
168	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
169	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
170	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
171	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
177	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
178	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
214	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
215	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
216	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
217	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
220	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
221	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
222	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
223	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
224	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
225	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
226	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
227	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
228	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
229	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
230	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
231	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
232	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
233	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
234	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
235	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
236	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
237	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
238	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
239	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
240	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
241	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
242	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
243	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
244	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
245	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
246	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
247	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
248	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
249	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
250	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
251	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
252	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
253	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
254	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
255	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
256	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
257	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
258	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
259	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
260	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
261	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
262	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
263	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
264	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
265	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
266	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
267	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
268	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
269	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
270	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
271	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
272	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
273	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
274	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
275	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
276	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
277	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
278	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
279	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
280	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
281	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
282	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
283	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
284	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
285	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
286	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
287	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
288	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
289	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
290	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
291	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
292	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
293	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
294	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
295	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
296	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
297	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
298	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
299	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
300	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
301	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
302	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
303	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
304	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
305	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
306	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
307	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
308	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
309	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
310	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
311	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
312	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
313	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
314	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
315	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
316	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
317	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
318	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
319	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
320	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
321	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
322	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
323	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
324	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
325	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
326	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
327	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
328	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
329	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
330	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
331	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
332	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
333	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
334	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
335	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
336	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
337	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
338	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
339	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
340	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
341	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
342	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
343	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
344	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
345	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
346	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
347	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
348	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
349	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
350	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
351	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
352	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
353	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
354	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
355	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
356	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
357	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
358	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
359	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
360	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
361	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
362	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
363	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
364	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
365	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
366	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
367	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
368	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
369	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
370	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
371	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
372	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
373	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
374	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
375	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
376	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
377	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
378	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
379	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
380	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
381	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
382	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
383	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
384	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
385	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
386	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
387	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
388	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
389	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
390	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
391	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
392	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	80.24
Metatranscriptomes	0
Isolates	19.76

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	16.78
Nodule	18.01
Rhizoplane	5.42
Rhizosphere	50
Stem	0
Stem Tuber	0
Unclassified	9.79

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25153J46596_10008105	3300003215	Bacteria	5067
2	JGI25153J46596_10016221	3300003215	Bacteria	2996
3	rootL2_10204127	3300003322	Bacteria	3787
4	JGI25160J50197_1016400	3300003354	Bacteria	2388
5	JGI25161J50226_1018532	3300003374	Bacteria	721
6	Ga0055543_1003298	3300004625	Bacteria	4843
7	Ga0065165_1011695	3300005262	Bacteria	3629
8	Ga0068869_100275064	3300005334	Bacteria	1352
9	Ga0070666_10653830	3300005335	Bacteria	769
10	Ga0070668_100023532	3300005347	Bacteria	4659
11	Ga0070668_100047565	3300005347	Bacteria	3298
12	Ga0070671_100125720	3300005355	Bacteria	2158
13	Ga0070659_100386336	3300005366	Bacteria	1180
14	Ga0070659_101545960	3300005366	Bacteria	592
15	Ga0070667_100146495	3300005367	Bacteria	2071
16	Ga0070663_100123233	3300005455	Bacteria	1960
17	Ga0070685_10547704	3300005466	Unclassified	825
18	Ga0070684_100461995	3300005535	Bacteria	1174
19	Ga0068853_100091338	3300005539	Bacteria	2678
20	Ga0070665_100013085	3300005548	Bacteria	8354
21	Ga0070665_100161660	3300005548	Bacteria	2241
22	Ga0070665_100434685	3300005548	Bacteria	1322
23	Ga0068855_100285096	3300005563	Bacteria	1833
24	Ga0068855_101240996	3300005563	Bacteria	774
25	Ga0068857_100142034	3300005577	Bacteria	2170
26	Ga0068854_100890415	3300005578	Bacteria	782
27	Ga0068854_101005012	3300005578	Bacteria	739
28	Ga0068856_100040769	3300005614	Bacteria	4561
29	Ga0068852_100878984	3300005616	Bacteria	913
30	Ga0068852_101644921	3300005616	Bacteria	665
31	Ga0068859_100422006	3300005617	Bacteria	1430
32	Ga0068859_100600581	3300005617	Bacteria	1194
33	Ga0068864_101422088	3300005618	Bacteria	696
34	Ga0068861_100086500	3300005719	Bacteria	2464
35	Ga0068861_100314943	3300005719	Bacteria	1361
36	Ga0068858_100187143	3300005842	Bacteria	1956
37	Ga0068858_100304226	3300005842	Bacteria	1522
38	Ga0068858_100358216	3300005842	Bacteria	1398
39	Ga0068862_100295122	3300005844	Bacteria	1490
40	Ga0081539_10202997	3300005985	Bacteria	914
41	Ga0075365_10093448	3300006038	Bacteria	2052
42	Ga0075368_10001996	3300006042	Bacteria	6582
43	Ga0075364_10010862	3300006051	Bacteria	5515
44	Ga0075364_10081744	3300006051	Bacteria	2136
45	Ga0075362_10033912	3300006177	Bacteria	2223
46	Ga0075367_10148589	3300006178	Bacteria	1454
47	Ga0075367_10310651	3300006178	Bacteria	993
48	Ga0075369_10135804	3300006186	Bacteria	1120
49	Ga0075366_10019514	3300006195	Bacteria	3924
50	Ga0075366_10362926	3300006195	Bacteria	890
51	Ga0075366_10404983	3300006195	Bacteria	840
52	Ga0075370_10032495	3300006353	Bacteria	2918
53	Ga0075370_10140888	3300006353	Bacteria	1409
54	Ga0075370_10198831	3300006353	Bacteria	1182
55	Ga0075370_10282278	3300006353	Unclassified	986
56	Ga0097620_100421939	3300006931	Bacteria	1430
57	Ga0097620_100600550	3300006931	Bacteria	1194
58	Ga0099824_1009133	3300006942	Bacteria	12334
59	Ga0099822_1047009	3300006943	Bacteria	1987
60	Ga0099823_1075044	3300006944	Bacteria	1415
61	Ga0099823_1078452	3300006944	Bacteria	1323
62	Ga0105250_10049017	3300009092	Bacteria	1693
63	Ga0105240_10357495	3300009093	Bacteria	1655
64	Ga0105240_10380226	3300009093	Bacteria	1595
65	Ga0105247_10049784	3300009101	Bacteria	2577
66	Ga0105247_10271614	3300009101	Bacteria	1166
67	Ga0105247_10286254	3300009101	Bacteria	1138
68	Ga0105243_10964843	3300009148	Bacteria	852
69	Ga0105243_12531563	3300009148	Bacteria	552
70	Ga0105241_10043696	3300009174	Bacteria	3394
71	Ga0105241_10202014	3300009174	Bacteria	1661
72	Ga0105242_10579861	3300009176	Bacteria	1080
73	Ga0105248_10825114	3300009177	Bacteria	1047
74	Ga0105237_10063112	3300009545	Bacteria	3702
75	Ga0105237_10480210	3300009545	Bacteria	1249
76	Ga0105237_10661909	3300009545	Bacteria	1051
77	Ga0105237_10691191	3300009545	Bacteria	1027
78	Ga0105237_10827141	3300009545	Bacteria	933
79	Ga0105238_10105988	3300009551	Bacteria	2793
80	Ga0105238_10130167	3300009551	Bacteria	2495
81	Ga0105238_10725565	3300009551	Bacteria	1007
82	Ga0105238_10969798	3300009551	Bacteria	870
83	Ga0105238_11704139	3300009551	Bacteria	661
84	Ga0105238_12784861	3300009551	Bacteria	525
85	Ga0105249_10391716	3300009553	Bacteria	1418
86	Ga0099796_10007149	3300010159	Bacteria	2906
87	Ga0105239_10221275	3300010375	Bacteria	2123
88	Ga0105239_10323918	3300010375	Bacteria	1738
89	Ga0105239_10599199	3300010375	Bacteria	1257
90	Ga0105239_10713845	3300010375	Bacteria	1147
91	Ga0105239_10826752	3300010375	Bacteria	1062
92	Ga0105239_10892511	3300010375	Bacteria	1020
93	Ga0105239_11149572	3300010375	Bacteria	894
94	Ga0105239_11862212	3300010375	Bacteria	697
95	Ga0105246_10009041	3300011119	Bacteria	6135
96	Ga0105246_10505599	3300011119	Bacteria	1027
97	Ga0157313_1015713	3300012503	Bacteria	715
98	Ga0157371_10006741	3300013102	Bacteria	9390
99	Ga0157374_10120941	3300013296	Bacteria	2527
100	Ga0157378_10094547	3300013297	Bacteria	2721
101	Ga0157372_10722399	3300013307	Bacteria	1159
102	Ga0157372_12260304	3300013307	Bacteria	625
103	Ga0157375_10096697	3300013308	Bacteria	3026
104	Ga0163163_10080599	3300014325	Bacteria	3255
105	Ga0182008_10833870	3300014497	Bacteria	538
106	Ga0157377_10083887	3300014745	Bacteria	1868
107	Ga0157379_10037027	3300014968	Bacteria	4350
108	Ga0157376_10459738	3300014969	Bacteria	1243
109	Ga0157376_10513759	3300014969	Bacteria	1179
110	Ga0157376_11178844	3300014969	Bacteria	794
111	Ga0214544_1000009	3300021320	Bacteria	285865
112	Ga0214542_1000002	3300021321	Bacteria	720798
113	Ga0214545_1000002	3300021324	Bacteria	727485
114	Ga0214545_1027033	3300021324	Bacteria	2988
115	Ga0214543_1000013	3300021327	Bacteria	329117
116	Ga0209563_101839	3300025230	Bacteria	5213
117	Ga0209677_104294	3300025253	Bacteria	4175
118	Ga0209148_1000493	3300025254	Bacteria	40546
119	Ga0209233_1007301	3300025261	Bacteria	3508
120	Ga0209233_1013483	3300025261	Bacteria	2333
121	Ga0209455_1002659	3300025272	Bacteria	6735
122	Ga0209673_1030233	3300025273	Bacteria	1709
123	Ga0209564_1005987	3300025295	Bacteria	6725
124	Ga0209758_1001986	3300025297	Bacteria	22053
125	Ga0209758_1004612	3300025297	Bacteria	11314
126	Ga0209758_1006923	3300025297	Bacteria	7911
127	Ga0209758_1051453	3300025297	Bacteria	1434
128	Ga0209758_1124953	3300025297	Bacteria	689
129	Ga0209758_1182065	3300025297	Bacteria	504
130	Ga0207426_1000382	3300025302	Bacteria	76034
131	Ga0209051_1073384	3300025303	Bacteria	1019
132	Ga0209257_1050502	3300025304	Bacteria	1177
133	Ga0207697_10156228	3300025315	Bacteria	994
134	Ga0207656_10121168	3300025321	Bacteria	1218
135	Ga0207696_1083087	3300025711	Bacteria	883
136	Ga0207680_10257846	3300025903	Bacteria	1206
137	Ga0207680_10938325	3300025903	Bacteria	620
138	Ga0207647_10004348	3300025904	Bacteria	10505
139	Ga0207705_10485379	3300025909	Bacteria	959
140	Ga0207654_10141150	3300025911	Bacteria	1536
141	Ga0207695_10000342	3300025913	Bacteria	108393
142	Ga0207695_10596120	3300025913	Bacteria	986
143	Ga0207671_10079239	3300025914	Bacteria	2461
144	Ga0207671_10118554	3300025914	Bacteria	2021
145	Ga0207671_10368690	3300025914	Bacteria	1140
146	Ga0207671_10447695	3300025914	Bacteria	1028
147	Ga0207671_10525907	3300025914	Bacteria	943
148	Ga0207657_10424795	3300025919	Bacteria	1044
149	Ga0207649_10381379	3300025920	Bacteria	1051
150	Ga0207694_10095951	3300025924	Bacteria	2345
151	Ga0207694_10578530	3300025924	Bacteria	944
152	Ga0207694_10644092	3300025924	Bacteria	893
153	Ga0207694_11503656	3300025924	Bacteria	568
154	Ga0207650_10805149	3300025925	Bacteria	796
155	Ga0207687_10091580	3300025927	Bacteria	2218
156	Ga0207687_10501761	3300025927	Bacteria	1013
157	Ga0207644_10009627	3300025931	Bacteria	6346
158	Ga0207690_10114057	3300025932	Bacteria	1951
159	Ga0207690_10245758	3300025932	Bacteria	1380
160	Ga0207690_11379156	3300025932	Bacteria	589
161	Ga0207706_10375945	3300025933	Bacteria	1233
162	Ga0207706_10782560	3300025933	Bacteria	811
163	Ga0207709_10139511	3300025935	Bacteria	1664
164	Ga0207711_10314851	3300025941	Bacteria	1445
165	Ga0207689_10230477	3300025942	Bacteria	1531
166	Ga0207679_10148814	3300025945	Bacteria	1903
167	Ga0207668_10052736	3300025972	Bacteria	2815
168	Ga0207640_10837967	3300025981	Bacteria	799
169	Ga0207658_10152390	3300025986	Bacteria	1885
170	Ga0207703_10288677	3300026035	Bacteria	1492
171	Ga0207703_10602106	3300026035	Bacteria	1040
172	Ga0207703_11029411	3300026035	Bacteria	790
173	Ga0207678_10248031	3300026067	Bacteria	1525
174	Ga0207702_10308229	3300026078	Bacteria	1505
175	Ga0207676_10119973	3300026095	Bacteria	2216
176	Ga0207674_10278326	3300026116	Bacteria	1621
177	Ga0207675_100144430	3300026118	Bacteria	2262
178	Ga0207698_10271940	3300026142	Bacteria	1562
179	Ga0207698_10550410	3300026142	Bacteria	1131
180	Ga0207698_10804653	3300026142	Bacteria	942
181	Ga0209389_1000068	3300027296	Bacteria	98954
182	Ga0209389_1000092	3300027296	Bacteria	82555
183	Ga0209589_1000115	3300027357	Bacteria	82537
184	Ga0209489_100340	3300027361	Bacteria	82555
185	Ga0209489_121754	3300027361	Bacteria	1520
186	Ga0209489_121756	3300027361	Bacteria	1519
187	Ga0209700_100117	3300027363	Bacteria	115595
188	Ga0268266_10008749	3300028379	Bacteria	8973
189	Ga0268266_10434275	3300028379	Bacteria	1246
190	Ga0268265_10583809	3300028380	Bacteria	1065
191	Ga0265337_1020977	3300028556	Bacteria	2041
192	Ga0265326_10001784	3300028558	Bacteria	7430
193	Ga0265319_1003723	3300028563	Bacteria	7836
194	Ga0265334_10001623	3300028573	Bacteria	10807
195	Ga0265318_10013035	3300028577	Bacteria	3523
196	Ga0265323_10000888	3300028653	Bacteria	15825
197	Ga0265322_10004001	3300028654	Bacteria	4413
198	Ga0265336_10000475	3300028666	Bacteria	23763
199	Ga0307515_10000830	3300028794	Bacteria	71111
200	Ga0265338_10000393	3300028800	Bacteria	78303
201	Ga0265324_10007609	3300029957	Bacteria	4373
202	Ga0307508_10000047	3300031616	Bacteria	137805
203	Ga0307518_10392282	3300031838	Bacteria	780
204	Ga0307510_10006695	3300033180	Bacteria	13738
205	Ga0307510_10195722	3300033180	Bacteria	1563
206	Ga0395905_0004959	3300037471	Bacteria	13717
207	Ga0395905_0122774	3300037471	Bacteria	2442
208	Ga0395901_0317352	3300038443	Bacteria	1613
209	Ga0395901_0879676	3300038443	Bacteria	879
210	Ga0436365_0737175	3300039437	Bacteria	913
211	Ga0451797_0038016	3300041453	Bacteria	574
212	Ga0451802_1904797	3300041460	Bacteria	529
213	Ga0451804_0923639	3300041463	Bacteria	1065
214	Ga0451853_2133933	3300041512	Bacteria	610
215	Ga0451577_0108474	3300042876	Bacteria	2482
216	Ga0466972_0301508	3300044658	Bacteria	749
217	Ga0466965_0014667	3300044683	Bacteria	3710
218	Ga0466966_0016888	3300044684	Bacteria	4823
219	Ga0466961_0000600	3300044693	Bacteria	22699
220	Ga0466961_0117087	3300044693	Bacteria	1674
221	Ga0466959_0000651	3300045049	Bacteria	20259
222	Ga0466958_0427855	3300045836	Bacteria	856
223	Ga0466967_0196931	3300045976	Bacteria	1906
224	Ga0466967_0197528	3300045976	Bacteria	1904
225	Ga0466967_0269037	3300045976	Bacteria	1633
226	Ga0495592_0118480	3300046454	Bacteria	1865
227	Ga0495651_0027204	3300046462	Bacteria	4455
228	Ga0495651_0194939	3300046462	Bacteria	1422
229	Ga0495653_0115062	3300046463	Bacteria	1926
230	Ga0495653_0223389	3300046463	Bacteria	1265
231	Ga0495605_0086656	3300046474	Bacteria	1457
232	Ga0495605_0138819	3300046474	Bacteria	1092
233	Ga0495664_0025046	3300046477	Bacteria	3472
234	Ga0495583_0113509	3300046506	Bacteria	1146
235	Ga0495606_0056602	3300046507	Bacteria	2530
236	Ga0495606_0193160	3300046507	Bacteria	1165
237	Ga0495608_0177585	3300046511	Bacteria	1348
238	Ga0495616_0212048	3300046513	Bacteria	847
239	Ga0495618_0112702	3300046514	Bacteria	1741
240	Ga0495618_0417172	3300046514	Bacteria	819
241	Ga0495632_0040813	3300046519	Bacteria	2335
242	Ga0495643_0025108	3300046522	Bacteria	3375
243	Ga0495648_0095915	3300046524	Bacteria	1649
244	Ga0495648_0406048	3300046524	Bacteria	607
245	Ga0495652_0031411	3300046529	Bacteria	4651
246	Ga0495652_0185995	3300046529	Bacteria	1589
247	Ga0495640_0247766	3300046533	Bacteria	1117
248	Ga0495587_0017086	3300046536	Bacteria	4511
249	Ga0495597_0020813	3300046542	Bacteria	3052
250	Ga0495645_0016664	3300046543	Bacteria	5253
251	Ga0495622_0013223	3300046557	Bacteria	3830
252	Ga0495622_0127626	3300046557	Bacteria	1159
253	Ga0495622_0416755	3300046557	Bacteria	577
254	Ga0495668_0145603	3300046616	Bacteria	1297
255	Ga0495611_0520350	3300046648	Bacteria	540
256	Ga0495625_0117500	3300046660	Bacteria	1813
257	Ga0495625_0412349	3300046660	Bacteria	842
258	Ga0495635_0043024	3300046663	Bacteria	3117
259	Ga0495635_0061467	3300046663	Bacteria	2580
260	Ga0495661_0140894	3300046665	Bacteria	1312
261	Ga0495588_0602309	3300046674	Bacteria	575
262	Ga0495657_0018448	3300046675	Bacteria	5050
263	Ga0495599_0056099	3300046678	Bacteria	2465
264	Ga0495646_0021313	3300046680	Bacteria	4097
265	Ga0495613_0036323	3300046689	Bacteria	3653
266	Ga0495613_0056866	3300046689	Bacteria	2873
267	Ga0495649_0086736	3300046694	Bacteria	1670
268	Ga0495600_0001088	3300046809	Bacteria	14770
269	Ga0495600_0288934	3300046809	Bacteria	1036
270	Ga0495604_0003796	3300047317	Bacteria	12028
271	Ga0495604_0007121	3300047317	Bacteria	8867
272	Ga0495604_0411034	3300047317	Bacteria	890
273	Ga0495674_0040509	3300047319	Bacteria	4167
274	Ga0495676_0874048	3300047321	Bacteria	577
275	Ga0495680_0011888	3300047322	Bacteria	7681
276	Ga0495683_0158566	3300047323	Bacteria	1048
277	Ga0495687_008900	3300047443	Bacteria	5684
278	Ga0495687_034832	3300047443	Bacteria	2270
279	Ga0495675_0008826	3300047444	Bacteria	6257
280	Ga0495673_0245162	3300047469	Bacteria	656
281	Ga0495686_0175137	3300047472	Bacteria	1246
282	Ga0495686_0215319	3300047472	Bacteria	1095
283	Ga0495686_0713274	3300047472	Bacteria	511
284	Ga0495593_0039939	3300047673	Bacteria	2528
285	Ga0495602_0015956	3300048088	Bacteria	7562
286	Ga0495602_0393204	3300048088	Bacteria	990
287	Ga0496100_0512773	3300048903	Bacteria	925
288	Ga0496100_1168364	3300048903	Bacteria	607
289	Ga0496100_1522167	3300048903	Bacteria	528
290	Ga0496101_0349745	3300048904	Bacteria	1161
291	Ga0496102_0348222	3300048905	Bacteria	1395
292	Ga0496102_1046858	3300048905	Bacteria	736
293	Ga0496103_0020278	3300048906	Bacteria	3993
294	Ga0496104_0002807	3300048907	Bacteria	15011
295	Ga0496104_0185355	3300048907	Bacteria	1992
296	Ga0496104_0206865	3300048907	Bacteria	1874
297	Ga0496105_0005551	3300048908	Bacteria	9578
298	Ga0496105_0187957	3300048908	Bacteria	1690
299	Ga0496105_0294512	3300048908	Bacteria	1306
300	Ga0496107_0670034	3300048910	Bacteria	764
301	Ga0496109_0200017	3300048912	Bacteria	1878
302	Ga0496110_0081368	3300048913	Bacteria	2887
303	Ga0496110_0306853	3300048913	Bacteria	1446
304	Ga0496110_1550342	3300048913	Bacteria	572
305	Ga0496111_0288171	3300048914	Bacteria	1218
306	Ga0496111_0478040	3300048914	Bacteria	918
307	Ga0496112_0087400	3300048915	Bacteria	3084
308	Ga0496112_0105891	3300048915	Bacteria	2782
309	Ga0496112_0273525	3300048915	Bacteria	1637
310	Ga0496113_0131877	3300048916	Bacteria	1961
311	Ga0496113_0526345	3300048916	Bacteria	949
312	Ga0496114_0560517	3300048917	Bacteria	1009
313	Ga0496115_0512928	3300048918	Bacteria	962
314	Ga0496115_0744298	3300048918	Bacteria	767
315	Ga0496116_0035485	3300048919	Bacteria	3502
316	Ga0496117_0134286	3300048920	Bacteria	1494
317	Ga0496117_0466844	3300048920	Bacteria	620
318	Ga0496118_0083707	3300048921	Bacteria	2229
319	Ga0496118_0092536	3300048921	Bacteria	2075
320	Ga0496118_0217764	3300048921	Bacteria	1114
321	Ga0496119_0001979	3300048922	Bacteria	23271
322	Ga0496119_0062975	3300048922	Bacteria	2208
323	Ga0496120_0007623	3300048923	Bacteria	8022
324	Ga0496120_0120705	3300048923	Bacteria	1356
325	Ga0496120_0341321	3300048923	Bacteria	675
326	Ga0496121_0025316	3300048924	Bacteria	5636
327	Ga0496121_0100852	3300048924	Bacteria	2228
328	Ga0496121_0395304	3300048924	Bacteria	907
329	Ga0496124_0195238	3300048927	Bacteria	1545
330	Ga0496124_0655516	3300048927	Bacteria	673
331	Ga0496125_0095370	3300048928	Bacteria	2213
332	Ga0496125_0105831	3300048928	Bacteria	2055
333	Ga0496125_0170160	3300048928	Bacteria	1466
334	Ga0496126_0008618	3300048929	Bacteria	10965
335	Ga0496126_0161530	3300048929	Bacteria	1914
336	Ga0496126_0265467	3300048929	Bacteria	1426
337	Ga0496126_0301571	3300048929	Bacteria	1322
338	Ga0495682_0131383	3300049460	Bacteria	895
339	Ga0501031_0092762	3300049568	Bacteria	1970
340	Ga0501032_0013616	3300049569	Bacteria	5777
341	Ga0501032_0087594	3300049569	Bacteria	2067
342	Ga0501032_0205952	3300049569	Bacteria	1283
343	Ga0501033_0000826	3300049570	Bacteria	28262
344	Ga0501033_0076192	3300049570	Bacteria	2462
345	Ga0501033_0253540	3300049570	Bacteria	1246
346	Ga0501033_0305356	3300049570	Bacteria	1119
347	Ga0501033_1065320	3300049570	Bacteria	538
348	Ga0501034_0016581	3300049571	Bacteria	7553
349	Ga0501034_0041010	3300049571	Unclassified	4683
350	Ga0501034_0290988	3300049571	Bacteria	1571
351	Ga0501034_0819468	3300049571	Bacteria	822
352	Ga0501036_0024739	3300049572	Bacteria	5062
353	Ga0501036_0067465	3300049572	Bacteria	3026
354	Ga0501036_0423699	3300049572	Bacteria	1109
355	Ga0501037_0185685	3300049573	Bacteria	1473
356	Ga0501037_0269850	3300049573	Bacteria	1187
357	Ga0501038_0012981	3300049574	Bacteria	7599
358	Ga0501038_0441744	3300049574	Bacteria	1001
359	Ga0501038_0458212	3300049574	Bacteria	979
360	Ga0501038_0740911	3300049574	Bacteria	733
361	Ga0501039_0026315	3300049575	Unclassified	4470
362	Ga0501039_0120981	3300049575	Bacteria	2051
363	Ga0501042_0202815	3300049578	Unclassified	1430
364	Ga0501042_0227480	3300049578	Bacteria	1345
365	Ga0501043_0007382	3300049579	Bacteria	8723
366	Ga0501043_0214640	3300049579	Bacteria	1490
367	Ga0501043_0349495	3300049579	Bacteria	1123
368	Ga0501043_0403801	3300049579	Bacteria	1032
369	Ga0501046_0012730	3300049580	Bacteria	7154
370	Ga0501046_0018481	3300049580	Bacteria	5799
371	Ga0501047_0060631	3300049581	Unclassified	3650
372	Ga0501047_0392742	3300049581	Bacteria	1220
373	Ga0501048_0087091	3300049582	Bacteria	2203
374	Ga0501048_0223860	3300049582	Bacteria	1335
375	Ga0501067_0037763	3300049583	Unclassified	2682
376	Ga0501068_0226495	3300049584	Bacteria	1188
377	Ga0501069_0138433	3300049585	Bacteria	1396
378	Ga0501070_0049040	3300049586	Unclassified	3506
379	Ga0501071_0058074	3300049587	Unclassified	2797
380	Ga0501071_0186998	3300049587	Bacteria	1553
381	Ga0501073_0152481	3300049589	Bacteria	1601
382	Ga0501073_1138926	3300049589	Bacteria	536
383	Ga0501074_0001573	3300049590	Bacteria	15440
384	Ga0501079_0047854	3300049741	Unclassified	3300
385	Ga0501080_0012973	3300049742	Bacteria	7650
386	Ga0501080_0243203	3300049742	Bacteria	1642
387	Ga0501080_0912145	3300049742	Bacteria	765
388	Ga0501083_0156726	3300049744	Bacteria	1490
389	Ga0501035_0024593	3300049822	Bacteria	5522
390	Ga0501035_0435542	3300049822	Bacteria	1086
391	Ga0501035_0518364	3300049822	Bacteria	979
392	Ga0501035_0713858	3300049822	Bacteria	807
393	Ga0501035_0835592	3300049822	Bacteria	733
394	Ga0501044_0055259	3300049823	Bacteria	4078
395	Ga0501044_0290487	3300049823	Bacteria	1566
396	Ga0501044_0420516	3300049823	Bacteria	1246
397	Ga0501044_0452980	3300049823	Bacteria	1189
398	Ga0501044_0613891	3300049823	Bacteria	979
399	Ga0501045_0032518	3300049824	Bacteria	3780
400	nmdc:mga03683_35729_c1	3300050489	Bacteria	2017
401	nmdc:mga03n38_20545_c1	3300050490	Bacteria	2644
402	nmdc:mga00v17_17018_c1	3300050491	Bacteria	4106
403	nmdc:mga0yw44_126991_c1	3300050492	Bacteria	1648
404	nmdc:mga0yw44_403681_c1	3300050492	Bacteria	924
405	nmdc:mga0yw44_90734_c1	3300050492	Bacteria	1931
406	nmdc:mga0k408_436254_c1	3300050493	Bacteria	778
407	nmdc:mga0k408_57570_c1	3300050493	Bacteria	2257
408	nmdc:mga0k408_761383_c1	3300050493	Bacteria	565
409	nmdc:mga06z11_172066_c1	3300050494	Bacteria	1244
410	nmdc:mga06z11_189280_c1	3300050494	Bacteria	1191
411	nmdc:mga06z11_335639_c1	3300050494	Bacteria	903
412	nmdc:mga07m45_240635_c1	3300050496	Bacteria	1053
413	nmdc:mga07m45_27185_c1	3300050496	Bacteria	3150
414	nmdc:mga07m45_629812_c1	3300050496	Bacteria	619
415	nmdc:mga0sz30_144310_c1	3300050516	Bacteria	1052
416	nmdc:mga0sz30_195529_c1	3300050516	Bacteria	898
417	nmdc:mga0sz30_332550_c1	3300050516	Bacteria	679
418	Ga0495619_0548356	3300053085	Bacteria	793
419	Ga0500578_0265075	3300053086	Bacteria	1030
420	Ga0500578_0284043	3300053086	Bacteria	986
421	Ga0500643_000025	3300053087	Bacteria	259605
422	Ga0500646_0044372	3300053090	Bacteria	1262
423	Ga0500647_0070248	3300053091	Bacteria	1684
424	Ga0500566_0004992	3300053094	Bacteria	7900
425	Ga0500566_0007941	3300053094	Bacteria	6279
426	Ga0500566_0059838	3300053094	Bacteria	2159
427	Ga0500641_0057693	3300053096	Bacteria	1611
428	Ga0500554_056874	3300053102	Bacteria	1245
429	Ga0500554_164879	3300053102	Bacteria	747
430	Ga0500555_002854	3300053103	Bacteria	4953
431	Ga0500556_0138057	3300053104	Bacteria	957
432	Ga0500569_004265	3300053109	Bacteria	2995
433	Ga0500595_000203	3300053119	Bacteria	40552
434	Ga0500595_038140	3300053119	Bacteria	1563
435	Ga0500607_063027	3300053121	Bacteria	1935
436	Ga0500608_228874	3300053122	Bacteria	744
437	Ga0500614_005866	3300053123	Bacteria	2577
438	Ga0500642_0380267	3300053130	Bacteria	620
439	Ga0500655_084759	3300053133	Bacteria	654
440	Ga0500658_0217030	3300053134	Bacteria	876
441	Ga0500564_251746	3300053138	Bacteria	699
442	Ga0500588_0000211	3300053146	Bacteria	8154
443	Ga0500590_211983	3300053148	Bacteria	808
444	Ga0500603_048829	3300053150	Bacteria	1152
445	Ga0500604_0294992	3300053151	Bacteria	562
446	Ga0500620_014659	3300053155	Bacteria	2195
447	Ga0500622_0347614	3300053156	Bacteria	616
448	Ga0500634_0035707	3300053161	Bacteria	2707
449	Ga0500638_000745	3300053162	Bacteria	8825
450	Ga0500638_237135	3300053162	Bacteria	744
451	Ga0500636_0157230	3300053177	Bacteria	1243
452	Ga0500636_0460941	3300053177	Bacteria	572
453	Ga0500637_0000189	3300053178	Bacteria	22957
454	Ga0500552_018155	3300053733	Bacteria	971
455	Ga0500599_000359	3300053736	Bacteria	4546
456	Ga0500601_000068	3300053737	Bacteria	21333
457	Ga0500661_004768	3300055283	Bacteria	2533
458	Ga0500661_080685	3300055283	Bacteria	602
459	Ga0466962_0011013	3300061719	Bacteria	4354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042876	Ga0451577_0108474	Ga0451577_0108474_1704_2072	118
2	iso_pu_bacteria	2643221660	2644339868	127
3	iso_pu_bacteria	2507262055	2507509553	128
4	iso_pu_bacteria	2508501009	2508543594	128
5	iso_pu_bacteria	2508501042	2508698615	128
6	iso_pu_bacteria	2511231028	2511393569	128
7	iso_pu_bacteria	2513237092	2513624627	128
8	iso_pu_bacteria	2513237095	2513646439	128
9	iso_pu_bacteria	2513237161	2514016692	128
10	iso_pu_bacteria	2517093001	2517108300	128
11	iso_pu_bacteria	2524023205	2524439691	128
12	iso_pu_bacteria	2528768022	2528853416	128
13	iso_pu_bacteria	2617270741	2617376666	128
14	iso_pu_bacteria	2744054633	2745082146	128
15	iso_pu_bacteria	2816332527	2818240368	128
16	iso_pu_bacteria	2824600985	2824606569	128
17	iso_pu_bacteria	2824609381	2824613071	128
18	iso_pu_bacteria	2824653114	2824655795	128
19	iso_pu_bacteria	2824661429	2824667299	128
20	iso_pu_bacteria	2824679649	2824682507	128
21	iso_pu_bacteria	2824732956	2824735725	128
22	iso_pu_bacteria	2824746037	2824751699	128
23	iso_pu_bacteria	2838122688	2838128705	128
24	iso_pu_bacteria	2841957949	2841962418	128
25	iso_pu_bacteria	2841983080	2841989914	128
26	iso_pu_bacteria	2842038055	2842039955	128
27	iso_pu_bacteria	2842045827	2842047100	128
28	iso_pu_bacteria	2844315083	2844318197	128
29	iso_pu_bacteria	2847930680	2847935064	128
30	iso_pu_bacteria	2874628541	2874636463	128
31	iso_pu_bacteria	2876761206	2876761221	128
32	iso_pu_bacteria	2879083081	2879090793	128
33	iso_pu_bacteria	2879099564	2879109523	128
34	iso_pu_bacteria	2888378607	2888383051	128
35	iso_pu_bacteria	2888419890	2888423500	128
36	iso_pu_bacteria	2903727486	2903732981	128
37	iso_pu_bacteria	2904666416	2904669664	128
38	iso_pu_bacteria	2906602504	2906605090	128
39	iso_pu_bacteria	2906643746	2906647731	128
40	iso_pu_bacteria	2908775508	2908779229	128
41	iso_pu_bacteria	2922393267	2922395435	128
42	iso_pu_bacteria	2929615660	2929615727	128
43	iso_pu_bacteria	2929624759	2929630341	128
44	iso_pu_bacteria	2932784394	2932791977	128
45	iso_pu_bacteria	2932801729	2932804391	128
46	iso_pu_bacteria	2932809354	2932814156	128
47	iso_pu_bacteria	2932818245	2932819356	128
48	iso_pu_bacteria	2932828146	2932833933	128
49	iso_pu_bacteria	2933577622	2933578986	128
50	iso_pu_bacteria	2935608549	2935611575	128
51	iso_pu_bacteria	2935616580	2935624232	128
52	iso_pu_bacteria	2935638405	2935644622	128
53	iso_pu_bacteria	2935648319	2935648947	128
54	iso_pu_bacteria	2935656913	2935656971	128
55	iso_pu_bacteria	2935665750	2935673487	128
56	iso_pu_bacteria	2935675223	2935678374	128
57	iso_pu_bacteria	2935684952	2935688197	128
58	iso_pu_bacteria	2935694250	2935698863	128
59	iso_pu_bacteria	2935713505	2935715216	128
60	iso_pu_bacteria	2935722832	2935726219	128
61	iso_pu_bacteria	2935732158	2935734035	128
62	iso_pu_bacteria	2935741537	2935743414	128
63	iso_pu_bacteria	2935750917	2935754548	128
64	iso_pu_bacteria	2935760218	2935765327	128
65	iso_pu_bacteria	2935769743	2935775808	128
66	iso_pu_bacteria	2935785616	2935791455	128
67	iso_pu_bacteria	2935793552	2935799669	128
68	iso_pu_bacteria	2935801545	2935805278	128
69	iso_pu_bacteria	2935810662	2935816576	128
70	iso_pu_bacteria	2935819856	2935821052	128
71	iso_pu_bacteria	2935827899	2935833629	128
72	iso_pu_bacteria	2935837841	2935839685	128
73	iso_pu_bacteria	2935847175	2935850688	128
74	iso_pu_bacteria	2935855204	2935862734	128
75	iso_pu_bacteria	2935864058	2935871270	128
76	iso_pu_bacteria	2935873716	2935876225	128
77	iso_pu_bacteria	2935883170	2935888802	128
78	iso_pu_bacteria	2935984226	2935989128	128
79	iso_pu_bacteria	2935992306	2936001601	128
80	iso_pu_bacteria	2936002035	2936007323	128
81	iso_pu_bacteria	2936011229	2936011857	128
82	iso_pu_bacteria	2936019824	2936020452	128
83	iso_pu_bacteria	2936028420	2936029146	128
84	iso_pu_bacteria	2936037263	2936043162	128
85	iso_pu_bacteria	2936046547	2936047175	128
86	iso_pu_bacteria	2936055302	2936061403	128
87	iso_pu_bacteria	2940556831	2940560075	128
88	iso_pu_bacteria	2941538514	2941540374	128
89	iso_pu_bacteria	3005483717	3005490033	128
90	iso_pu_bacteria	3005506211	3005511688	128
91	iso_pu_bacteria	3005587118	3005590820	128
92	iso_pu_bacteria	3005710791	3005713973	128
93	iso_pu_bacteria	3005718088	3005721426	128
94	iso_pu_bacteria	8016511872	8016514496	128
95	iso_pu_bacteria	8016630954	8016632087	128
96	iso_pu_bacteria	8017057580	8017061930	128
97	iso_pu_bacteria	8019576017	8019581466	128
98	iso_pu_bacteria	8019586578	8019589094	128
99	iso_pu_bacteria	8019608314	8019616419	128
100	iso_pu_bacteria	8019648815	8019657301	128
101	iso_pu_bacteria	8055742211	8055747375	128
102	iso_pu_bacteria	8056967851	8056972553	128
103	iso_pu_bacteria	2935908558	2935913943	129
104	iso_pu_bacteria	2935916978	2935920067	129
105	iso_pu_bacteria	2935926038	2935930406	129
106	iso_pu_bacteria	2935934488	2935939621	129
107	iso_pu_bacteria	2935942939	2935946570	129
108	iso_pu_bacteria	2935951376	2935955591	129
109	iso_pu_bacteria	2935967501	2935972699	129
110	iso_pu_bacteria	3005594810	3005598256	129
111	iso_pu_bacteria	8006926726	8006930022	129
112	iso_pu_bacteria	8019687851	8019688966	129
113	3300009551	Ga0105238_10725565	Ga0105238_107255652	130
114	3300003322	rootL2_10204127	rootL2_102041274	131
115	3300005466	Ga0070685_10547704	Ga0070685_105477042	131
116	3300006195	Ga0075366_10404983	Ga0075366_104049831	131
117	3300006353	Ga0075370_10282278	Ga0075370_102822781	131
118	3300013102	Ga0157371_10006741	Ga0157371_100067419	131
119	3300013307	Ga0157372_12260304	Ga0157372_122603041	131
120	3300028794	Ga0307515_10000830	Ga0307515_1000083019	131
121	3300031616	Ga0307508_10000047	Ga0307508_1000004785	131
122	3300037471	Ga0395905_0004959	Ga0395905_0004959_8207_8641	131
123	3300037471	Ga0395905_0122774	Ga0395905_0122774_1502_1936	131
124	3300039437	Ga0436365_0737175	Ga0436365_0737175_15_410	131
125	3300041460	Ga0451802_1904797	Ga0451802_1904797_23_433	131
126	3300048924	Ga0496121_0395304	Ga0496121_0395304_465_869	131
127	3300048929	Ga0496126_0161530	Ga0496126_0161530_150_554	131
128	3300050492	nmdc:mga0yw44_403681_c1	nmdc:mga0yw44_403681_c1_107_511	131
129	3300050493	nmdc:mga0k408_436254_c1	nmdc:mga0k408_436254_c1_59_484	131
130	3300053091	Ga0500647_0070248	Ga0500647_0070248_1171_1572	131
131	3300003215	JGI25153J46596_10008105	JGI25153J46596_100081054	132
132	3300003215	JGI25153J46596_10016221	JGI25153J46596_100162212	132
133	3300003354	JGI25160J50197_1016400	JGI25160J50197_10164003	132
134	3300003374	JGI25161J50226_1018532	JGI25161J50226_10185321	132
135	3300004625	Ga0055543_1003298	Ga0055543_10032986	132
136	3300005262	Ga0065165_1011695	Ga0065165_10116954	132
137	3300005334	Ga0068869_100275064	Ga0068869_1002750642	132
138	3300005335	Ga0070666_10653830	Ga0070666_106538302	132
139	3300005347	Ga0070668_100023532	Ga0070668_1000235326	132
140	3300005347	Ga0070668_100047565	Ga0070668_1000475653	132
141	3300005355	Ga0070671_100125720	Ga0070671_1001257203	132
142	3300005366	Ga0070659_100386336	Ga0070659_1003863362	132
143	3300005366	Ga0070659_101545960	Ga0070659_1015459602	132
144	3300005367	Ga0070667_100146495	Ga0070667_1001464953	132
145	3300005455	Ga0070663_100123233	Ga0070663_1001232333	132
146	3300005535	Ga0070684_100461995	Ga0070684_1004619952	132
147	3300005539	Ga0068853_100091338	Ga0068853_1000913384	132
148	3300005548	Ga0070665_100013085	Ga0070665_1000130856	132
149	3300005548	Ga0070665_100161660	Ga0070665_1001616603	132
150	3300005548	Ga0070665_100434685	Ga0070665_1004346853	132
151	3300005563	Ga0068855_100285096	Ga0068855_1002850962	132
152	3300005563	Ga0068855_101240996	Ga0068855_1012409962	132
153	3300005577	Ga0068857_100142034	Ga0068857_1001420342	132
154	3300005578	Ga0068854_100890415	Ga0068854_1008904152	132
155	3300005578	Ga0068854_101005012	Ga0068854_1010050122	132
156	3300005614	Ga0068856_100040769	Ga0068856_1000407696	132
157	3300005616	Ga0068852_100878984	Ga0068852_1008789842	132
158	3300005616	Ga0068852_101644921	Ga0068852_1016449212	132
159	3300005617	Ga0068859_100422006	Ga0068859_1004220062	132
160	3300005617	Ga0068859_100600581	Ga0068859_1006005811	132
161	3300005618	Ga0068864_101422088	Ga0068864_1014220881	132
162	3300005719	Ga0068861_100086500	Ga0068861_1000865002	132
163	3300005719	Ga0068861_100314943	Ga0068861_1003149431	132
164	3300005842	Ga0068858_100187143	Ga0068858_1001871434	132
165	3300005842	Ga0068858_100304226	Ga0068858_1003042262	132
166	3300005842	Ga0068858_100358216	Ga0068858_1003582162	132
167	3300005844	Ga0068862_100295122	Ga0068862_1002951223	132
168	3300005985	Ga0081539_10202997	Ga0081539_102029972	132
169	3300006038	Ga0075365_10093448	Ga0075365_100934483	132
170	3300006042	Ga0075368_10001996	Ga0075368_100019968	132
171	3300006051	Ga0075364_10010862	Ga0075364_100108624	132
172	3300006051	Ga0075364_10081744	Ga0075364_100817443	132
173	3300006177	Ga0075362_10033912	Ga0075362_100339124	132
174	3300006178	Ga0075367_10148589	Ga0075367_101485892	132
175	3300006178	Ga0075367_10310651	Ga0075367_103106512	132
176	3300006186	Ga0075369_10135804	Ga0075369_101358042	132
177	3300006195	Ga0075366_10019514	Ga0075366_100195145	132
178	3300006195	Ga0075366_10362926	Ga0075366_103629262	132
179	3300006353	Ga0075370_10032495	Ga0075370_100324955	132
180	3300006353	Ga0075370_10140888	Ga0075370_101408883	132
181	3300006353	Ga0075370_10198831	Ga0075370_101988313	132
182	3300006931	Ga0097620_100421939	Ga0097620_1004219392	132
183	3300006931	Ga0097620_100600550	Ga0097620_1006005501	132
184	3300006942	Ga0099824_1009133	Ga0099824_100913315	132
185	3300006943	Ga0099822_1047009	Ga0099822_10470093	132
186	3300006944	Ga0099823_1075044	Ga0099823_10750441	132
187	3300006944	Ga0099823_1078452	Ga0099823_10784521	132
188	3300009092	Ga0105250_10049017	Ga0105250_100490172	132
189	3300009093	Ga0105240_10357495	Ga0105240_103574953	132
190	3300009093	Ga0105240_10380226	Ga0105240_103802262	132
191	3300009101	Ga0105247_10049784	Ga0105247_100497844	132
192	3300009101	Ga0105247_10271614	Ga0105247_102716142	132
193	3300009101	Ga0105247_10286254	Ga0105247_102862543	132
194	3300009148	Ga0105243_10964843	Ga0105243_109648432	132
195	3300009148	Ga0105243_12531563	Ga0105243_125315632	132
196	3300009174	Ga0105241_10043696	Ga0105241_100436962	132
197	3300009174	Ga0105241_10202014	Ga0105241_102020143	132
198	3300009176	Ga0105242_10579861	Ga0105242_105798611	132
199	3300009177	Ga0105248_10825114	Ga0105248_108251141	132
200	3300009545	Ga0105237_10063112	Ga0105237_100631126	132
201	3300009545	Ga0105237_10480210	Ga0105237_104802103	132
202	3300009545	Ga0105237_10661909	Ga0105237_106619092	132
203	3300009545	Ga0105237_10691191	Ga0105237_106911912	132
204	3300009545	Ga0105237_10827141	Ga0105237_108271412	132
205	3300009551	Ga0105238_10105988	Ga0105238_101059883	132
206	3300009551	Ga0105238_10130167	Ga0105238_101301673	132
207	3300009551	Ga0105238_10969798	Ga0105238_109697982	132
208	3300009551	Ga0105238_11704139	Ga0105238_117041391	132
209	3300009551	Ga0105238_12784861	Ga0105238_127848611	132
210	3300009553	Ga0105249_10391716	Ga0105249_103917161	132
211	3300010159	Ga0099796_10007149	Ga0099796_100071491	132
212	3300010375	Ga0105239_10221275	Ga0105239_102212753	132
213	3300010375	Ga0105239_10323918	Ga0105239_103239182	132
214	3300010375	Ga0105239_10599199	Ga0105239_105991993	132
215	3300010375	Ga0105239_10713845	Ga0105239_107138453	132
216	3300010375	Ga0105239_10826752	Ga0105239_108267522	132
217	3300010375	Ga0105239_10892511	Ga0105239_108925112	132
218	3300010375	Ga0105239_11149572	Ga0105239_111495722	132
219	3300010375	Ga0105239_11862212	Ga0105239_118622122	132
220	3300011119	Ga0105246_10009041	Ga0105246_100090416	132
221	3300011119	Ga0105246_10505599	Ga0105246_105055993	132
222	3300012503	Ga0157313_1015713	Ga0157313_10157132	132
223	3300013296	Ga0157374_10120941	Ga0157374_101209412	132
224	3300013297	Ga0157378_10094547	Ga0157378_100945473	132
225	3300013307	Ga0157372_10722399	Ga0157372_107223991	132
226	3300013308	Ga0157375_10096697	Ga0157375_100966973	132
227	3300014325	Ga0163163_10080599	Ga0163163_100805994	132
228	3300014497	Ga0182008_10833870	Ga0182008_108338701	132
229	3300014745	Ga0157377_10083887	Ga0157377_100838873	132
230	3300014968	Ga0157379_10037027	Ga0157379_100370275	132
231	3300014969	Ga0157376_10459738	Ga0157376_104597383	132
232	3300014969	Ga0157376_10513759	Ga0157376_105137593	132
233	3300014969	Ga0157376_11178844	Ga0157376_111788442	132
234	3300021320	Ga0214544_1000009	Ga0214544_10000093	132
235	3300021321	Ga0214542_1000002	Ga0214542_1000002444	132
236	3300021324	Ga0214545_1000002	Ga0214545_1000002276	132
237	3300021324	Ga0214545_1027033	Ga0214545_10270334	132
238	3300021327	Ga0214543_1000013	Ga0214543_100001346	132
239	3300025230	Ga0209563_101839	Ga0209563_1018395	132
240	3300025253	Ga0209677_104294	Ga0209677_1042946	132
241	3300025254	Ga0209148_1000493	Ga0209148_100049317	132
242	3300025261	Ga0209233_1007301	Ga0209233_10073012	132
243	3300025261	Ga0209233_1013483	Ga0209233_10134833	132
244	3300025272	Ga0209455_1002659	Ga0209455_10026592	132
245	3300025273	Ga0209673_1030233	Ga0209673_10302332	132
246	3300025295	Ga0209564_1005987	Ga0209564_10059873	132
247	3300025297	Ga0209758_1001986	Ga0209758_100198617	132
248	3300025297	Ga0209758_1004612	Ga0209758_100461210	132
249	3300025297	Ga0209758_1006923	Ga0209758_10069236	132
250	3300025297	Ga0209758_1051453	Ga0209758_10514532	132
251	3300025297	Ga0209758_1124953	Ga0209758_11249532	132
252	3300025297	Ga0209758_1182065	Ga0209758_11820652	132
253	3300025302	Ga0207426_1000382	Ga0207426_100038222	132
254	3300025303	Ga0209051_1073384	Ga0209051_10733843	132
255	3300025304	Ga0209257_1050502	Ga0209257_10505023	132
256	3300025315	Ga0207697_10156228	Ga0207697_101562283	132
257	3300025321	Ga0207656_10121168	Ga0207656_101211681	132
258	3300025711	Ga0207696_1083087	Ga0207696_10830872	132
259	3300025903	Ga0207680_10257846	Ga0207680_102578463	132
260	3300025903	Ga0207680_10938325	Ga0207680_109383252	132
261	3300025904	Ga0207647_10004348	Ga0207647_100043487	132
262	3300025909	Ga0207705_10485379	Ga0207705_104853792	132
263	3300025911	Ga0207654_10141150	Ga0207654_101411502	132
264	3300025913	Ga0207695_10000342	Ga0207695_1000034291	132
265	3300025913	Ga0207695_10596120	Ga0207695_105961202	132
266	3300025914	Ga0207671_10079239	Ga0207671_100792391	132
267	3300025914	Ga0207671_10118554	Ga0207671_101185543	132
268	3300025914	Ga0207671_10368690	Ga0207671_103686902	132
269	3300025914	Ga0207671_10447695	Ga0207671_104476952	132
270	3300025914	Ga0207671_10525907	Ga0207671_105259073	132
271	3300025919	Ga0207657_10424795	Ga0207657_104247952	132
272	3300025920	Ga0207649_10381379	Ga0207649_103813791	132
273	3300025924	Ga0207694_10095951	Ga0207694_100959511	132
274	3300025924	Ga0207694_10578530	Ga0207694_105785302	132
275	3300025924	Ga0207694_10644092	Ga0207694_106440921	132
276	3300025924	Ga0207694_11503656	Ga0207694_115036562	132
277	3300025925	Ga0207650_10805149	Ga0207650_108051491	132
278	3300025927	Ga0207687_10091580	Ga0207687_100915803	132
279	3300025927	Ga0207687_10501761	Ga0207687_105017612	132
280	3300025931	Ga0207644_10009627	Ga0207644_100096277	132
281	3300025932	Ga0207690_10114057	Ga0207690_101140573	132
282	3300025932	Ga0207690_10245758	Ga0207690_102457582	132
283	3300025932	Ga0207690_11379156	Ga0207690_113791561	132
284	3300025933	Ga0207706_10375945	Ga0207706_103759453	132
285	3300025933	Ga0207706_10782560	Ga0207706_107825602	132
286	3300025935	Ga0207709_10139511	Ga0207709_101395113	132
287	3300025941	Ga0207711_10314851	Ga0207711_103148512	132
288	3300025942	Ga0207689_10230477	Ga0207689_102304773	132
289	3300025945	Ga0207679_10148814	Ga0207679_101488142	132
290	3300025972	Ga0207668_10052736	Ga0207668_100527361	132
291	3300025981	Ga0207640_10837967	Ga0207640_108379672	132
292	3300025986	Ga0207658_10152390	Ga0207658_101523904	132
293	3300026035	Ga0207703_10288677	Ga0207703_102886772	132
294	3300026035	Ga0207703_10602106	Ga0207703_106021062	132
295	3300026035	Ga0207703_11029411	Ga0207703_110294112	132
296	3300026067	Ga0207678_10248031	Ga0207678_102480312	132
297	3300026078	Ga0207702_10308229	Ga0207702_103082292	132
298	3300026095	Ga0207676_10119973	Ga0207676_101199731	132
299	3300026116	Ga0207674_10278326	Ga0207674_102783262	132
300	3300026118	Ga0207675_100144430	Ga0207675_1001444302	132
301	3300026142	Ga0207698_10271940	Ga0207698_102719402	132
302	3300026142	Ga0207698_10550410	Ga0207698_105504102	132
303	3300026142	Ga0207698_10804653	Ga0207698_108046532	132
304	3300027296	Ga0209389_1000068	Ga0209389_100006819	132
305	3300027296	Ga0209389_1000092	Ga0209389_100009237	132
306	3300027357	Ga0209589_1000115	Ga0209589_100011537	132
307	3300027361	Ga0209489_100340	Ga0209489_10034037	132
308	3300027361	Ga0209489_121754	Ga0209489_1217541	132
309	3300027361	Ga0209489_121756	Ga0209489_1217561	132
310	3300027363	Ga0209700_100117	Ga0209700_10011784	132
311	3300028379	Ga0268266_10008749	Ga0268266_100087496	132
312	3300028379	Ga0268266_10434275	Ga0268266_104342752	132
313	3300028380	Ga0268265_10583809	Ga0268265_105838092	132
314	3300028556	Ga0265337_1020977	Ga0265337_10209773	132
315	3300028558	Ga0265326_10001784	Ga0265326_100017844	132
316	3300028563	Ga0265319_1003723	Ga0265319_10037232	132
317	3300028573	Ga0265334_10001623	Ga0265334_100016236	132
318	3300028577	Ga0265318_10013035	Ga0265318_100130353	132
319	3300028653	Ga0265323_10000888	Ga0265323_100008882	132
320	3300028654	Ga0265322_10004001	Ga0265322_100040015	132
321	3300028666	Ga0265336_10000475	Ga0265336_1000047515	132
322	3300028800	Ga0265338_10000393	Ga0265338_1000039339	132
323	3300029957	Ga0265324_10007609	Ga0265324_100076094	132
324	3300031838	Ga0307518_10392282	Ga0307518_103922821	132
325	3300033180	Ga0307510_10006695	Ga0307510_1000669514	132
326	3300033180	Ga0307510_10195722	Ga0307510_101957223	132
327	3300038443	Ga0395901_0317352	Ga0395901_0317352_960_1367	132
328	3300038443	Ga0395901_0879676	Ga0395901_0879676_148_546	132
329	3300041453	Ga0451797_0038016	Ga0451797_0038016_128_535	132
330	3300041463	Ga0451804_0923639	Ga0451804_0923639_527_934	132
331	3300041512	Ga0451853_2133933	Ga0451853_2133933_105_512	132
332	3300044658	Ga0466972_0301508	Ga0466972_0301508_151_567	132
333	3300044683	Ga0466965_0014667	Ga0466965_0014667_1306_1707	132
334	3300044684	Ga0466966_0016888	Ga0466966_0016888_3733_4179	132
335	3300044693	Ga0466961_0000600	Ga0466961_0000600_3978_4424	132
336	3300044693	Ga0466961_0117087	Ga0466961_0117087_1042_1449	132
337	3300045049	Ga0466959_0000651	Ga0466959_0000651_8096_8542	132
338	3300045836	Ga0466958_0427855	Ga0466958_0427855_265_711	132
339	3300045976	Ga0466967_0196931	Ga0466967_0196931_386_787	132
340	3300045976	Ga0466967_0197528	Ga0466967_0197528_1442_1849	132
341	3300045976	Ga0466967_0269037	Ga0466967_0269037_1053_1457	132
342	3300046454	Ga0495592_0118480	Ga0495592_0118480_926_1333	132
343	3300046462	Ga0495651_0027204	Ga0495651_0027204_2253_2660	132
344	3300046462	Ga0495651_0194939	Ga0495651_0194939_953_1357	132
345	3300046463	Ga0495653_0115062	Ga0495653_0115062_734_1141	132
346	3300046463	Ga0495653_0223389	Ga0495653_0223389_680_1084	132
347	3300046474	Ga0495605_0086656	Ga0495605_0086656_751_1158	132
348	3300046474	Ga0495605_0138819	Ga0495605_0138819_608_1009	132
349	3300046477	Ga0495664_0025046	Ga0495664_0025046_1667_2074	132
350	3300046506	Ga0495583_0113509	Ga0495583_0113509_403_804	132
351	3300046507	Ga0495606_0056602	Ga0495606_0056602_667_1068	132
352	3300046507	Ga0495606_0193160	Ga0495606_0193160_126_527	132
353	3300046511	Ga0495608_0177585	Ga0495608_0177585_722_1126	132
354	3300046513	Ga0495616_0212048	Ga0495616_0212048_29_430	132
355	3300046514	Ga0495618_0112702	Ga0495618_0112702_540_944	132
356	3300046514	Ga0495618_0417172	Ga0495618_0417172_35_442	132
357	3300046519	Ga0495632_0040813	Ga0495632_0040813_660_1067	132
358	3300046522	Ga0495643_0025108	Ga0495643_0025108_2438_2845	132
359	3300046524	Ga0495648_0095915	Ga0495648_0095915_403_804	132
360	3300046524	Ga0495648_0406048	Ga0495648_0406048_141_542	132
361	3300046529	Ga0495652_0031411	Ga0495652_0031411_1875_2282	132
362	3300046529	Ga0495652_0185995	Ga0495652_0185995_93_497	132
363	3300046533	Ga0495640_0247766	Ga0495640_0247766_167_571	132
364	3300046536	Ga0495587_0017086	Ga0495587_0017086_3394_3801	132
365	3300046542	Ga0495597_0020813	Ga0495597_0020813_2471_2878	132
366	3300046543	Ga0495645_0016664	Ga0495645_0016664_1159_1566	132
367	3300046557	Ga0495622_0013223	Ga0495622_0013223_789_1193	132
368	3300046557	Ga0495622_0127626	Ga0495622_0127626_327_776	132
369	3300046557	Ga0495622_0416755	Ga0495622_0416755_132_533	132
370	3300046616	Ga0495668_0145603	Ga0495668_0145603_567_968	132
371	3300046648	Ga0495611_0520350	Ga0495611_0520350_109_516	132
372	3300046660	Ga0495625_0117500	Ga0495625_0117500_480_881	132
373	3300046660	Ga0495625_0412349	Ga0495625_0412349_412_819	132
374	3300046663	Ga0495635_0043024	Ga0495635_0043024_354_758	132
375	3300046663	Ga0495635_0061467	Ga0495635_0061467_34_441	132
376	3300046665	Ga0495661_0140894	Ga0495661_0140894_336_743	132
377	3300046674	Ga0495588_0602309	Ga0495588_0602309_95_496	132
378	3300046675	Ga0495657_0018448	Ga0495657_0018448_715_1119	132
379	3300046678	Ga0495599_0056099	Ga0495599_0056099_2025_2432	132
380	3300046680	Ga0495646_0021313	Ga0495646_0021313_1535_1942	132
381	3300046689	Ga0495613_0036323	Ga0495613_0036323_827_1234	132
382	3300046689	Ga0495613_0056866	Ga0495613_0056866_1765_2169	132
383	3300046694	Ga0495649_0086736	Ga0495649_0086736_803_1204	132
384	3300046809	Ga0495600_0001088	Ga0495600_0001088_11348_11755	132
385	3300046809	Ga0495600_0288934	Ga0495600_0288934_37_441	132
386	3300047317	Ga0495604_0003796	Ga0495604_0003796_9668_10075	132
387	3300047317	Ga0495604_0007121	Ga0495604_0007121_1918_2322	132
388	3300047317	Ga0495604_0411034	Ga0495604_0411034_38_436	132
389	3300047319	Ga0495674_0040509	Ga0495674_0040509_2983_3390	132
390	3300047321	Ga0495676_0874048	Ga0495676_0874048_70_471	132
391	3300047322	Ga0495680_0011888	Ga0495680_0011888_5847_6254	132
392	3300047323	Ga0495683_0158566	Ga0495683_0158566_536_943	132
393	3300047443	Ga0495687_008900	Ga0495687_008900_2596_3003	132
394	3300047443	Ga0495687_034832	Ga0495687_034832_1479_1886	132
395	3300047444	Ga0495675_0008826	Ga0495675_0008826_2229_2636	132
396	3300047469	Ga0495673_0245162	Ga0495673_0245162_39_440	132
397	3300047472	Ga0495686_0175137	Ga0495686_0175137_686_1093	132
398	3300047472	Ga0495686_0215319	Ga0495686_0215319_633_1082	132
399	3300047472	Ga0495686_0713274	Ga0495686_0713274_80_481	132
400	3300047673	Ga0495593_0039939	Ga0495593_0039939_2023_2427	132
401	3300048088	Ga0495602_0015956	Ga0495602_0015956_5312_5719	132
402	3300048088	Ga0495602_0393204	Ga0495602_0393204_539_943	132
403	3300048903	Ga0496100_0512773	Ga0496100_0512773_177_578	132
404	3300048903	Ga0496100_1168364	Ga0496100_1168364_162_569	132
405	3300048903	Ga0496100_1522167	Ga0496100_1522167_13_420	132
406	3300048904	Ga0496101_0349745	Ga0496101_0349745_319_726	132
407	3300048905	Ga0496102_0348222	Ga0496102_0348222_811_1218	132
408	3300048905	Ga0496102_1046858	Ga0496102_1046858_246_647	132
409	3300048906	Ga0496103_0020278	Ga0496103_0020278_574_981	132
410	3300048907	Ga0496104_0002807	Ga0496104_0002807_1418_1822	132
411	3300048907	Ga0496104_0185355	Ga0496104_0185355_985_1392	132
412	3300048907	Ga0496104_0206865	Ga0496104_0206865_551_958	132
413	3300048908	Ga0496105_0005551	Ga0496105_0005551_5147_5551	132
414	3300048908	Ga0496105_0187957	Ga0496105_0187957_95_496	132
415	3300048908	Ga0496105_0294512	Ga0496105_0294512_269_676	132
416	3300048910	Ga0496107_0670034	Ga0496107_0670034_128_535	132
417	3300048912	Ga0496109_0200017	Ga0496109_0200017_348_755	132
418	3300048913	Ga0496110_0081368	Ga0496110_0081368_998_1405	132
419	3300048913	Ga0496110_0306853	Ga0496110_0306853_449_850	132
420	3300048913	Ga0496110_1550342	Ga0496110_1550342_101_508	132
421	3300048914	Ga0496111_0288171	Ga0496111_0288171_111_518	132
422	3300048914	Ga0496111_0478040	Ga0496111_0478040_202_603	132
423	3300048915	Ga0496112_0087400	Ga0496112_0087400_1920_2327	132
424	3300048915	Ga0496112_0105891	Ga0496112_0105891_418_819	132
425	3300048915	Ga0496112_0273525	Ga0496112_0273525_820_1227	132
426	3300048916	Ga0496113_0131877	Ga0496113_0131877_43_450	132
427	3300048916	Ga0496113_0526345	Ga0496113_0526345_274_675	132
428	3300048917	Ga0496114_0560517	Ga0496114_0560517_297_704	132
429	3300048918	Ga0496115_0512928	Ga0496115_0512928_464_868	132
430	3300048918	Ga0496115_0744298	Ga0496115_0744298_204_605	132
431	3300048919	Ga0496116_0035485	Ga0496116_0035485_2474_2875	132
432	3300048920	Ga0496117_0134286	Ga0496117_0134286_216_617	132
433	3300048920	Ga0496117_0466844	Ga0496117_0466844_75_485	132
434	3300048921	Ga0496118_0083707	Ga0496118_0083707_373_771	132
435	3300048921	Ga0496118_0092536	Ga0496118_0092536_565_1047	132
436	3300048921	Ga0496118_0217764	Ga0496118_0217764_115_516	132
437	3300048922	Ga0496119_0001979	Ga0496119_0001979_465_869	132
438	3300048922	Ga0496119_0062975	Ga0496119_0062975_1553_1960	132
439	3300048923	Ga0496120_0007623	Ga0496120_0007623_4009_4413	132
440	3300048923	Ga0496120_0120705	Ga0496120_0120705_541_948	132
441	3300048923	Ga0496120_0341321	Ga0496120_0341321_76_483	132
442	3300048924	Ga0496121_0025316	Ga0496121_0025316_4066_4467	132
443	3300048924	Ga0496121_0100852	Ga0496121_0100852_1214_1618	132
444	3300048927	Ga0496124_0195238	Ga0496124_0195238_1114_1521	132
445	3300048927	Ga0496124_0655516	Ga0496124_0655516_18_422	132
446	3300048928	Ga0496125_0095370	Ga0496125_0095370_12_416	132
447	3300048928	Ga0496125_0105831	Ga0496125_0105831_914_1354	132
448	3300048928	Ga0496125_0170160	Ga0496125_0170160_291_698	132
449	3300048929	Ga0496126_0008618	Ga0496126_0008618_9890_10294	132
450	3300048929	Ga0496126_0265467	Ga0496126_0265467_559_966	132
451	3300048929	Ga0496126_0301571	Ga0496126_0301571_405_887	132
452	3300049460	Ga0495682_0131383	Ga0495682_0131383_57_458	132
453	3300049568	Ga0501031_0092762	Ga0501031_0092762_542_967	132
454	3300049569	Ga0501032_0013616	Ga0501032_0013616_2081_2545	132
455	3300049569	Ga0501032_0087594	Ga0501032_0087594_342_767	132
456	3300049569	Ga0501032_0205952	Ga0501032_0205952_239_643	132
457	3300049570	Ga0501033_0000826	Ga0501033_0000826_13905_14369	132
458	3300049570	Ga0501033_0076192	Ga0501033_0076192_1841_2245	132
459	3300049570	Ga0501033_0253540	Ga0501033_0253540_470_895	132
460	3300049570	Ga0501033_0305356	Ga0501033_0305356_84_509	132
461	3300049570	Ga0501033_1065320	Ga0501033_1065320_30_455	132
462	3300049571	Ga0501034_0016581	Ga0501034_0016581_6658_7083	132
463	3300049571	Ga0501034_0041010	Ga0501034_0041010_3328_3792	132
464	3300049571	Ga0501034_0290988	Ga0501034_0290988_470_895	132
465	3300049571	Ga0501034_0819468	Ga0501034_0819468_217_621	132
466	3300049572	Ga0501036_0024739	Ga0501036_0024739_747_1211	132
467	3300049572	Ga0501036_0067465	Ga0501036_0067465_1469_1894	132
468	3300049572	Ga0501036_0423699	Ga0501036_0423699_68_493	132
469	3300049573	Ga0501037_0185685	Ga0501037_0185685_359_823	132
470	3300049573	Ga0501037_0269850	Ga0501037_0269850_277_702	132
471	3300049574	Ga0501038_0012981	Ga0501038_0012981_1726_2190	132
472	3300049574	Ga0501038_0441744	Ga0501038_0441744_352_777	132
473	3300049574	Ga0501038_0458212	Ga0501038_0458212_84_509	132
474	3300049574	Ga0501038_0740911	Ga0501038_0740911_84_509	132
475	3300049575	Ga0501039_0026315	Ga0501039_0026315_967_1431	132
476	3300049575	Ga0501039_0120981	Ga0501039_0120981_199_624	132
477	3300049578	Ga0501042_0202815	Ga0501042_0202815_482_946	132
478	3300049578	Ga0501042_0227480	Ga0501042_0227480_374_799	132
479	3300049579	Ga0501043_0007382	Ga0501043_0007382_4353_4817	132
480	3300049579	Ga0501043_0214640	Ga0501043_0214640_352_777	132
481	3300049579	Ga0501043_0349495	Ga0501043_0349495_352_777	132
482	3300049579	Ga0501043_0403801	Ga0501043_0403801_218_622	132
483	3300049580	Ga0501046_0012730	Ga0501046_0012730_2381_2845	132
484	3300049580	Ga0501046_0018481	Ga0501046_0018481_1304_1729	132
485	3300049581	Ga0501047_0060631	Ga0501047_0060631_654_1118	132
486	3300049581	Ga0501047_0392742	Ga0501047_0392742_310_735	132
487	3300049582	Ga0501048_0087091	Ga0501048_0087091_470_895	132
488	3300049582	Ga0501048_0223860	Ga0501048_0223860_563_1027	132
489	3300049583	Ga0501067_0037763	Ga0501067_0037763_203_667	132
490	3300049584	Ga0501068_0226495	Ga0501068_0226495_187_651	132
491	3300049585	Ga0501069_0138433	Ga0501069_0138433_67_492	132
492	3300049586	Ga0501070_0049040	Ga0501070_0049040_2533_2997	132
493	3300049587	Ga0501071_0058074	Ga0501071_0058074_1095_1559	132
494	3300049587	Ga0501071_0186998	Ga0501071_0186998_379_804	132
495	3300049589	Ga0501073_0152481	Ga0501073_0152481_967_1431	132
496	3300049589	Ga0501073_1138926	Ga0501073_1138926_29_454	132
497	3300049590	Ga0501074_0001573	Ga0501074_0001573_1922_2386	132
498	3300049741	Ga0501079_0047854	Ga0501079_0047854_1667_2131	132
499	3300049742	Ga0501080_0012973	Ga0501080_0012973_1352_1816	132
500	3300049742	Ga0501080_0243203	Ga0501080_0243203_808_1233	132
501	3300049742	Ga0501080_0912145	Ga0501080_0912145_227_640	132
502	3300049744	Ga0501083_0156726	Ga0501083_0156726_239_703	132
503	3300049822	Ga0501035_0024593	Ga0501035_0024593_1152_1616	132
504	3300049822	Ga0501035_0435542	Ga0501035_0435542_246_650	132
505	3300049822	Ga0501035_0518364	Ga0501035_0518364_471_896	132
506	3300049822	Ga0501035_0713858	Ga0501035_0713858_158_583	132
507	3300049822	Ga0501035_0835592	Ga0501035_0835592_225_650	132
508	3300049823	Ga0501044_0055259	Ga0501044_0055259_3444_3908	132
509	3300049823	Ga0501044_0290487	Ga0501044_0290487_218_622	132
510	3300049823	Ga0501044_0420516	Ga0501044_0420516_470_895	132
511	3300049823	Ga0501044_0452980	Ga0501044_0452980_681_1106	132
512	3300049823	Ga0501044_0613891	Ga0501044_0613891_471_896	132
513	3300049824	Ga0501045_0032518	Ga0501045_0032518_1892_2317	132
514	3300050489	nmdc:mga03683_35729_c1	nmdc:mga03683_35729_c1_1147_1554	132
515	3300050490	nmdc:mga03n38_20545_c1	nmdc:mga03n38_20545_c1_1260_1667	132
516	3300050491	nmdc:mga00v17_17018_c1	nmdc:mga00v17_17018_c1_1926_2333	132
517	3300050492	nmdc:mga0yw44_126991_c1	nmdc:mga0yw44_126991_c1_322_723	132
518	3300050492	nmdc:mga0yw44_90734_c1	nmdc:mga0yw44_90734_c1_302_703	132
519	3300050493	nmdc:mga0k408_57570_c1	nmdc:mga0k408_57570_c1_248_655	132
520	3300050493	nmdc:mga0k408_761383_c1	nmdc:mga0k408_761383_c1_52_459	132
521	3300050494	nmdc:mga06z11_172066_c1	nmdc:mga06z11_172066_c1_392_802	132
522	3300050494	nmdc:mga06z11_189280_c1	nmdc:mga06z11_189280_c1_137_544	132
523	3300050494	nmdc:mga06z11_335639_c1	nmdc:mga06z11_335639_c1_144_551	132
524	3300050496	nmdc:mga07m45_240635_c1	nmdc:mga07m45_240635_c1_175_576	132
525	3300050496	nmdc:mga07m45_27185_c1	nmdc:mga07m45_27185_c1_2607_3014	132
526	3300050496	nmdc:mga07m45_629812_c1	nmdc:mga07m45_629812_c1_201_608	132
527	3300050516	nmdc:mga0sz30_144310_c1	nmdc:mga0sz30_144310_c1_435_875	132
528	3300050516	nmdc:mga0sz30_195529_c1	nmdc:mga0sz30_195529_c1_362_772	132
529	3300050516	nmdc:mga0sz30_332550_c1	nmdc:mga0sz30_332550_c1_109_516	132
530	3300053085	Ga0495619_0548356	Ga0495619_0548356_43_447	132
531	3300053086	Ga0500578_0265075	Ga0500578_0265075_340_741	132
532	3300053086	Ga0500578_0284043	Ga0500578_0284043_34_441	132
533	3300053087	Ga0500643_000025	Ga0500643_000025_35641_36048	132
534	3300053090	Ga0500646_0044372	Ga0500646_0044372_73_477	132
535	3300053094	Ga0500566_0004992	Ga0500566_0004992_5612_6019	132
536	3300053094	Ga0500566_0007941	Ga0500566_0007941_4002_4409	132
537	3300053094	Ga0500566_0059838	Ga0500566_0059838_1147_1554	132
538	3300053096	Ga0500641_0057693	Ga0500641_0057693_140_547	132
539	3300053102	Ga0500554_056874	Ga0500554_056874_328_735	132
540	3300053102	Ga0500554_164879	Ga0500554_164879_228_635	132
541	3300053103	Ga0500555_002854	Ga0500555_002854_1818_2225	132
542	3300053104	Ga0500556_0138057	Ga0500556_0138057_521_925	132
543	3300053109	Ga0500569_004265	Ga0500569_004265_2266_2664	132
544	3300053119	Ga0500595_000203	Ga0500595_000203_5937_6344	132
545	3300053119	Ga0500595_038140	Ga0500595_038140_218_700	132
546	3300053121	Ga0500607_063027	Ga0500607_063027_768_1175	132
547	3300053122	Ga0500608_228874	Ga0500608_228874_158_565	132
548	3300053123	Ga0500614_005866	Ga0500614_005866_1301_1708	132
549	3300053130	Ga0500642_0380267	Ga0500642_0380267_42_446	132
550	3300053133	Ga0500655_084759	Ga0500655_084759_235_633	132
551	3300053134	Ga0500658_0217030	Ga0500658_0217030_65_472	132
552	3300053138	Ga0500564_251746	Ga0500564_251746_268_675	132
553	3300053146	Ga0500588_0000211	Ga0500588_0000211_1944_2348	132
554	3300053148	Ga0500590_211983	Ga0500590_211983_98_502	132
555	3300053150	Ga0500603_048829	Ga0500603_048829_500_907	132
556	3300053151	Ga0500604_0294992	Ga0500604_0294992_10_417	132
557	3300053155	Ga0500620_014659	Ga0500620_014659_1283_1690	132
558	3300053156	Ga0500622_0347614	Ga0500622_0347614_152_556	132
559	3300053161	Ga0500634_0035707	Ga0500634_0035707_70_477	132
560	3300053162	Ga0500638_000745	Ga0500638_000745_5334_5741	132
561	3300053162	Ga0500638_237135	Ga0500638_237135_260_667	132
562	3300053177	Ga0500636_0157230	Ga0500636_0157230_10_414	132
563	3300053177	Ga0500636_0460941	Ga0500636_0460941_85_483	132
564	3300053178	Ga0500637_0000189	Ga0500637_0000189_12821_13228	132
565	3300053733	Ga0500552_018155	Ga0500552_018155_472_921	132
566	3300053736	Ga0500599_000359	Ga0500599_000359_102_506	132
567	3300053737	Ga0500601_000068	Ga0500601_000068_16255_16653	132
568	3300055283	Ga0500661_004768	Ga0500661_004768_1510_1914	132
569	3300055283	Ga0500661_080685	Ga0500661_080685_44_442	132
570	3300061719	Ga0466962_0011013	Ga0466962_0011013_1155_1556	132
571	iso_pu_bacteria	2513237104	2513717645	132
572	iso_pu_bacteria	2802429603	2805920284	132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10000

ACT_3

ACT domain

30

99

0.97 PF13840

ACT_7

ACT domain

96

156

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1zvp-assembly1.cif.gz_A	crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein	0.9227	7	129
1zvp-assembly2.cif.gz_B	crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein	0.8952	2	129
1zvp-assembly2.cif.gz_C	crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein	0.8865	7	126
1zvp-assembly2.cif.gz_B	crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein	0.8755	2	129
1zvp-assembly1.cif.gz_D	crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein	0.8707	7	126

ID	Description	Score	Start	End	Superfamily
1zvpB00	Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like	0.8952	2	129	3.30.2130.10
af_Q58341_1_185_3.30.2130.30	Alpha Beta;2-Layer Sandwich;VC0802-like;	0.8865	90	125	3.30.2130.30
1zvpB00	Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like	0.8755	2	129	3.30.2130.10
2dtjA01	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain	0.8444	70	129	3.30.70.260
2zhoB02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain	0.8355	82	128	3.30.70.260

ID	Description	Score	Start	End	GO Terms
AF-A0A0M8MSE3-F1-model_v4	DUF2241 domain-containing protein	0.9782	5	129	GO:0006520 GO:0019752
AF-A0A1E1JY68-F1-model_v4	Related to COG3602 family protein	0.9777	1	129	GO:0006520 GO:0019752
AF-A0A7R6YG32-F1-model_v4	deleted	0.9772	2	129
AF-A0A3S9CE79-F1-model_v4	ACT domain-containing protein	0.9749	1	129	GO:0004072
AF-A0A0F0HKV9-F1-model_v4	Acetyltransferase	0.9742	40	129	GO:0004072

Feature Viewer

pLDDT	pTM	Quality
92.42	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F465118

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF10000

ACT_3

ACT domain

30

99

0.97

PF13840

ACT_7

ACT domain

96

156

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map