F465005

General Info

Members Datasets Scaffolds Average Seq Length
571 322 502 324

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_10461_c1|nmdc:mga03n38_10461_c1_151_1266
Length 371
Sequence MACDRPDARRSAALNFPAGQTLRLRARSGFENGRVILAIQKAAPMPQALISRRRFTLAATAAAIIPMPALAQGTWPSKPIRIIVPYTPGGFTDQMARLVQVGLQSRLGQPVVIDNKPGANSLIGVDAIAKAAPDGTTFGVVIAAYAANTTLYPKLPYDPQKDLTGVSLMGVSPLLAAVNVDAPFKTARELIAYARANPGKVSFGSSGNGSAAHLTTELWKSLTQTYMIHIPYRGAVPALTDLMGGQIQLFFDAPTGLINQAKAGKVRLIGVAGDKRLPAVPDVPTFIEQGFAGFTGSTWAGMLAPAGTPRDIVKRMSEEVARIIKSDETRAKLDAMGTFPAGSTPEEFDAFIAAETAKWAKVIRTAGVKAE

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221570 Acidovorax sp. Root568 Isolate Unclassified
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
10 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
11 2643221652 Acidovorax sp. Root402 Isolate Unclassified
12 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
13 2643221658 Variovorax sp. Root411 Isolate Unclassified
14 2643221672 Variovorax sp. Root434 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221736 Bosea sp. Root483D1 Isolate Unclassified
17 2721755523 Delftia sp. HK171 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543019 Variovorax sp. GV040 Isolate Unclassified
22 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2818991467 Bosea vestrisii 3192 Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
27 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
28 2841760612 Bosea sp. Tri-49 Isolate Nodule
29 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
30 2842677519 Variovorax sp. R-72495 Isolate Unclassified
31 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
32 2842733646 Variovorax sp. R-72446 Isolate Unclassified
33 2842747753 Variovorax sp. R-72060 Isolate Unclassified
34 2844104063 Bosea sp. Tri-39 Isolate Nodule
35 2851182111 Bosea sp. Tri-44 Isolate Nodule
36 2851246043 Bosea sp. Tri-54 Isolate Nodule
37 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
38 2885198086 Variovorax sp. 679 Isolate Unclassified
39 2885211737 Variovorax sp. 553 Isolate Unclassified
40 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
41 2904456579 Variovorax sp. 2002 Isolate Unclassified
42 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
43 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
44 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
45 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
46 2928070936 Variovorax gossypii 1167 Isolate Unclassified
47 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
48 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
49 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
50 2929520902 Variovorax beijingensis 502 Isolate Unclassified
51 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
52 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
53 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
54 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
55 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
56 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
57 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
58 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
59 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
60 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
61 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
62 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
63 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
64 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
67 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
68 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
69 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
70 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
100 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
118 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
119 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
192 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
193 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
194 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
207 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
208 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
211 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
212 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
276 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
290 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
291 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
295 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
296 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
297 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
298 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
299 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
300 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
301 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
302 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
303 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
304 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
305 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
306 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
310 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
313 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
314 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
317 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
318 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
319 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
322 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.22
Metatranscriptomes 0.7
Isolates 12.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 39.75
Nodule 2.45
Rhizoplane 2.63
Rhizosphere 40.98
Stem 0
Stem Tuber 0
Unclassified 14.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000062 3300002704 Bacteria 70719
2 JGI25156J39149_1000012 3300002705 Bacteria 194393
3 JGI25154J39366_1000029 3300002738 Bacteria 194393
4 JGI25157J39369_1000014 3300002741 Bacteria 194393
5 JGI25152J39213_1000673 3300002773 Bacteria 17796
6 JGI25150J39212_1000503 3300002774 Bacteria 16237
7 JGI25159J45721_1000505 3300002987 Bacteria 17796
8 JGI25159J45721_1001997 3300002987 Bacteria 8115
9 JGI25159J45721_1005379 3300002987 Bacteria 4028
10 JGI25151J46595_10001271 3300003187 Bacteria 17818
11 JGI25151J46595_10001929 3300003187 Bacteria 13151
12 JGI25151J46595_10004683 3300003187 Bacteria 7194
13 JGI25153J46596_10000930 3300003215 Bacteria 17796
14 rootH1_10174792 3300003323 Bacteria 1661
15 JGI25160J50197_1000732 3300003354 Bacteria 17980
16 JGI25160J50197_1018065 3300003354 Bacteria 2210
17 JGI25161J50226_1000898 3300003374 Bacteria 10728
18 JGI25161J50226_1003193 3300003374 Bacteria 3861
19 Ga0006562J51391_1125836 3300003578 Bacteria 8135
20 Ga0006562J51391_1125839 3300003578 Bacteria 4150
21 Ga0006562J51391_1183337 3300003578 Bacteria 1810
22 Ga0055526_1000184 3300003771 Bacteria 54504
23 Ga0055526_1001027 3300003771 Bacteria 20402
24 Ga0055526_1002078 3300003771 Bacteria 13756
25 Ga0055537_1000006 3300003773 Bacteria 147020
26 Ga0055537_1000036 3300003773 Bacteria 96045
27 Ga0055537_1000683 3300003773 Bacteria 17796
28 Ga0055537_1014642 3300003773 Bacteria 1413
29 Ga0055524_1000032 3300003775 Bacteria 182182
30 Ga0055524_1000326 3300003775 Bacteria 44488
31 Ga0055524_1000828 3300003775 Bacteria 20395
32 Ga0055524_1001149 3300003775 Bacteria 15943
33 Ga0055536_1000875 3300003781 Bacteria 19566
34 Ga0055536_1001160 3300003781 Bacteria 16475
35 Ga0055536_1002042 3300003781 Bacteria 11558
36 Ga0055536_1002368 3300003781 Bacteria 10652
37 Ga0055536_1023771 3300003781 Bacteria 1793
38 Ga0055534_1000018 3300003784 Bacteria 138136
39 Ga0055534_1000048 3300003784 Bacteria 94388
40 Ga0055534_1000535 3300003784 Bacteria 20395
41 Ga0055534_1001805 3300003784 Bacteria 8041
42 Ga0055534_1001837 3300003784 Bacteria 7925
43 Ga0055534_1007558 3300003784 Bacteria 2573
44 Ga0055528_1000903 3300003790 Bacteria 20020
45 Ga0055528_1001096 3300003790 Bacteria 17796
46 Ga0055528_1024195 3300003790 Bacteria 1828
47 Ga0055528_1030796 3300003790 Bacteria 1413
48 Ga0055530_10000086 3300003791 Bacteria 80109
49 Ga0055530_10007519 3300003791 Bacteria 4567
50 Ga0055540_1000073 3300003792 Bacteria 117148
51 Ga0055540_1000894 3300003792 Bacteria 19665
52 Ga0055540_1001765 3300003792 Bacteria 12335
53 Ga0055540_1003761 3300003792 Bacteria 7157
54 Ga0055540_1004096 3300003792 Bacteria 6751
55 Ga0055540_1004991 3300003792 Bacteria 5769
56 Ga0055531_10001217 3300003794 Bacteria 19681
57 Ga0055531_10002312 3300003794 Bacteria 12878
58 Ga0055531_10004635 3300003794 Bacteria 8258
59 Ga0055531_10038210 3300003794 Bacteria 1444
60 Ga0055543_1000964 3300004625 Bacteria 13096
61 Ga0055543_1002819 3300004625 Bacteria 5495
62 Ga0065165_1000150 3300005262 Bacteria 121992
63 Ga0065165_1001252 3300005262 Bacteria 28771
64 Ga0065165_1006153 3300005262 Bacteria 6415
65 Ga0065165_1007800 3300005262 Bacteria 5158
66 Ga0065165_1010337 3300005262 Bacteria 4047
67 Ga0065165_1031593 3300005262 Bacteria 1671
68 Ga0065714_10007015 3300005288 Bacteria 4249
69 Ga0065704_10088799 3300005289 Bacteria 2910
70 Ga0070658_10090874 3300005327 Bacteria 2516
71 Ga0070676_10021421 3300005328 Bacteria 3619
72 Ga0070668_100156757 3300005347 Bacteria 1845
73 Ga0070668_100205342 3300005347 Bacteria 1619
74 Ga0070669_100244868 3300005353 Bacteria 1426
75 Ga0070675_100019069 3300005354 Bacteria 5465
76 Ga0070674_100254776 3300005356 Bacteria 1380
77 Ga0070667_100028805 3300005367 Bacteria 4624
78 Ga0070678_100043273 3300005456 Bacteria 3206
79 Ga0070678_100105947 3300005456 Bacteria 2190
80 Ga0068867_100033126 3300005459 Bacteria 3739
81 Ga0068853_100085237 3300005539 Unclassified 2769
82 Ga0070672_100071128 3300005543 Bacteria 2766
83 Ga0070665_100315422 3300005548 Bacteria 1567
84 Ga0070664_100047093 3300005564 Bacteria 3643
85 Ga0068857_100104216 3300005577 Bacteria 2547
86 Ga0068857_100127667 3300005577 Bacteria 2292
87 Ga0068854_100062233 3300005578 Bacteria 2705
88 Ga0070702_100247048 3300005615 Bacteria 1207
89 Ga0068852_100130372 3300005616 Bacteria 2315
90 Ga0068863_100170570 3300005841 Bacteria 2087
91 Ga0068863_100284909 3300005841 Bacteria 1601
92 Ga0068860_100196425 3300005843 Bacteria 1954
93 Ga0068862_100032571 3300005844 Bacteria 4404
94 Ga0075365_10015817 3300006038 Bacteria 4571
95 Ga0075365_10027431 3300006038 Bacteria 3624
96 Ga0075365_10072562 3300006038 Bacteria 2319
97 Ga0075368_10009942 3300006042 Bacteria 3432
98 Ga0075368_10081726 3300006042 Bacteria 1315
99 Ga0075363_100049383 3300006048 Bacteria 2240
100 Ga0075363_100188494 3300006048 Bacteria 1176
101 Ga0075364_10021924 3300006051 Bacteria 4029
102 Ga0075364_10029776 3300006051 Bacteria 3502
103 Ga0075432_10010889 3300006058 Bacteria 3087
104 Ga0075362_10001734 3300006177 Bacteria 7079
105 Ga0075362_10004440 3300006177 Bacteria 5043
106 Ga0075362_10110720 3300006177 Bacteria 1292
107 Ga0075366_10009077 3300006195 Bacteria 5544
108 Ga0075366_10012090 3300006195 Bacteria 4888
109 Ga0075366_10021112 3300006195 Bacteria 3786
110 Ga0075366_10040208 3300006195 Bacteria 2765
111 Ga0075366_10172716 3300006195 Bacteria 1312
112 Ga0097621_100377961 3300006237 Bacteria 1265
113 Ga0075370_10005227 3300006353 Bacteria 6422
114 Ga0075370_10007084 3300006353 Bacteria 5692
115 Ga0075370_10035937 3300006353 Bacteria 2782
116 Ga0075370_10041025 3300006353 Bacteria 2612
117 Ga0075370_10113002 3300006353 Bacteria 1578
118 Ga0075430_100000003 3300006846 Bacteria 134093
119 Ga0075430_100031429 3300006846 Bacteria 4506
120 Ga0075431_100023776 3300006847 Bacteria 6272
121 Ga0068865_100215065 3300006881 Bacteria 1500
122 Ga0068865_100298878 3300006881 Bacteria 1288
123 Ga0075436_100025269 3300006914 Bacteria 4086
124 Ga0079104_1000056 3300006946 Bacteria 166276
125 Ga0079104_1001506 3300006946 Bacteria 15478
126 Ga0099826_10000369 3300006948 Bacteria 20858
127 Ga0105250_10082417 3300009092 Bacteria 1304
128 Ga0105240_10153597 3300009093 Bacteria 2740
129 Ga0114129_10324252 3300009147 Bacteria 2047
130 Ga0114129_10693568 3300009147 Bacteria 1309
131 Ga0105243_10000481 3300009148 Bacteria 40913
132 Ga0105243_10009917 3300009148 Bacteria 7243
133 Ga0105243_10020508 3300009148 Bacteria 5011
134 Ga0105243_10181790 3300009148 Bacteria 1829
135 Ga0105243_10330639 3300009148 Bacteria 1392
136 Ga0105242_10001456 3300009176 Bacteria 18628
137 Ga0105237_10236605 3300009545 Bacteria 1827
138 Ga0105239_10705162 3300010375 Bacteria 1154
139 Ga0157347_1001465 3300012502 Bacteria 1856
140 Ga0157373_10018829 3300013100 Bacteria 5024
141 Ga0157370_10008744 3300013104 Bacteria 10889
142 Ga0157370_10244187 3300013104 Bacteria 1661
143 Ga0157370_10244360 3300013104 Bacteria 1661
144 Ga0157369_10108768 3300013105 Bacteria 2948
145 Ga0163162_10400960 3300013306 Bacteria 1504
146 Ga0163163_10255097 3300014325 Bacteria 1805
147 Ga0157380_10056306 3300014326 Bacteria 3126
148 Ga0157380_10073871 3300014326 Bacteria 2766
149 Ga0182008_10003480 3300014497 Bacteria 9499
150 Ga0182008_10009972 3300014497 Bacteria 5102
151 Ga0182008_10081805 3300014497 Bacteria 1590
152 Ga0182008_10125522 3300014497 Bacteria 1278
153 Ga0182006_1016573 3300015261 Bacteria 3142
154 Ga0182006_1051512 3300015261 Bacteria 1583
155 Ga0182006_1054407 3300015261 Bacteria 1531
156 Ga0182007_10000727 3300015262 Bacteria 18605
157 Ga0182007_10000842 3300015262 Bacteria 17012
158 Ga0182007_10025419 3300015262 Bacteria 2064
159 Ga0182005_1017935 3300015265 Bacteria 1958
160 Ga0183362_10010 3300015683 Bacteria 106392
161 Ga0163161_10000162 3300017792 Bacteria 61742
162 Ga0163161_10000578 3300017792 Bacteria 29487
163 Ga0163161_10016574 3300017792 Bacteria 5147
164 Ga0163161_10058890 3300017792 Bacteria 2792
165 Ga0163161_10066035 3300017792 Bacteria 2641
166 Ga0163161_10135423 3300017792 Bacteria 1862
167 Ga0209435_100002 3300025206 Bacteria 794178
168 Ga0209436_102275 3300025208 Bacteria 5914
169 Ga0207425_1000087 3300025245 Bacteria 93219
170 Ga0207425_1004522 3300025245 Bacteria 4141
171 Ga0207425_1007769 3300025245 Bacteria 2799
172 Ga0209646_1000001 3300025246 Bacteria 3092932
173 Ga0209026_1000040 3300025250 Bacteria 277470
174 Ga0209759_1000001 3300025256 Bacteria 2799452
175 Ga0209129_1000007 3300025258 Bacteria 771325
176 Ga0209129_1004712 3300025258 Bacteria 5178
177 Ga0209129_1009567 3300025258 Bacteria 2532
178 Ga0209565_1000016 3300025263 Bacteria 477707
179 Ga0209565_1000038 3300025263 Bacteria 286433
180 Ga0209565_1000075 3300025263 Bacteria 162259
181 Ga0209565_1004633 3300025263 Bacteria 4144
182 Ga0209673_1000066 3300025273 Bacteria 250037
183 Ga0209673_1000073 3300025273 Bacteria 233645
184 Ga0209673_1000080 3300025273 Bacteria 223503
185 Ga0209673_1001092 3300025273 Bacteria 30491
186 Ga0209673_1002586 3300025273 Bacteria 12245
187 Ga0209130_1000131 3300025284 Bacteria 119977
188 Ga0209130_1000137 3300025284 Bacteria 116784
189 Ga0209130_1000187 3300025284 Bacteria 87082
190 Ga0209130_1001901 3300025284 Bacteria 11798
191 Ga0209130_1004592 3300025284 Bacteria 5172
192 Ga0209130_1015649 3300025284 Bacteria 1861
193 Ga0209675_1000074 3300025291 Bacteria 162260
194 Ga0209675_1000080 3300025291 Bacteria 154613
195 Ga0209675_1000102 3300025291 Bacteria 123742
196 Ga0209675_1001656 3300025291 Bacteria 12393
197 Ga0209675_1013064 3300025291 Bacteria 2626
198 Ga0209675_1017546 3300025291 Bacteria 2041
199 Ga0209676_1000005 3300025292 Bacteria 1076001
200 Ga0209676_1000139 3300025292 Bacteria 177886
201 Ga0209676_1000142 3300025292 Bacteria 175752
202 Ga0209676_1000186 3300025292 Bacteria 142440
203 Ga0209676_1001725 3300025292 Bacteria 18773
204 Ga0209676_1004754 3300025292 Bacteria 7410
205 Ga0209676_1004996 3300025292 Bacteria 7108
206 Ga0209025_1000056 3300025294 Bacteria 316188
207 Ga0209025_1000088 3300025294 Bacteria 255087
208 Ga0209025_1000104 3300025294 Bacteria 226895
209 Ga0209025_1001126 3300025294 Bacteria 38269
210 Ga0209025_1001133 3300025294 Bacteria 38135
211 Ga0209025_1021862 3300025294 Bacteria 3420
212 Ga0209025_1027639 3300025294 Bacteria 2807
213 Ga0209564_1000073 3300025295 Bacteria 288080
214 Ga0209564_1000090 3300025295 Bacteria 249298
215 Ga0209564_1000165 3300025295 Bacteria 160244
216 Ga0209564_1013125 3300025295 Bacteria 3546
217 Ga0209564_1026118 3300025295 Bacteria 1940
218 Ga0209758_1000044 3300025297 Bacteria 398448
219 Ga0209758_1007714 3300025297 Bacteria 7226
220 Ga0209050_1000007 3300025298 Bacteria 1187891
221 Ga0209050_1000250 3300025298 Bacteria 115980
222 Ga0209050_1000942 3300025298 Bacteria 37933
223 Ga0209050_1005650 3300025298 Bacteria 7744
224 Ga0209050_1007601 3300025298 Bacteria 6024
225 Ga0209050_1011058 3300025298 Bacteria 4343
226 Ga0209256_1000020 3300025299 Bacteria 542402
227 Ga0209256_1000022 3300025299 Bacteria 481843
228 Ga0209256_1000049 3300025299 Bacteria 310696
229 Ga0209256_1000110 3300025299 Bacteria 182312
230 Ga0207426_1000001 3300025302 Bacteria 1341301
231 Ga0207426_1000031 3300025302 Bacteria 460699
232 Ga0207426_1006487 3300025302 Bacteria 5078
233 Ga0207426_1008494 3300025302 Bacteria 4140
234 Ga0209051_1000029 3300025303 Bacteria 403675
235 Ga0209051_1000036 3300025303 Bacteria 339863
236 Ga0209051_1000160 3300025303 Bacteria 126473
237 Ga0209051_1000213 3300025303 Bacteria 98755
238 Ga0209051_1000243 3300025303 Bacteria 91605
239 Ga0209051_1001689 3300025303 Bacteria 17720
240 Ga0209051_1010050 3300025303 Bacteria 4816
241 Ga0209257_1000011 3300025304 Bacteria 1112630
242 Ga0209257_1000116 3300025304 Bacteria 228733
243 Ga0209257_1000168 3300025304 Bacteria 171312
244 Ga0209257_1002543 3300025304 Bacteria 17847
245 Ga0209257_1005026 3300025304 Bacteria 9629
246 Ga0209257_1011698 3300025304 Bacteria 4181
247 Ga0207696_1043505 3300025711 Bacteria 1305
248 Ga0207655_1027258 3300025728 Bacteria 2725
249 Ga0207688_10027637 3300025901 Bacteria 3121
250 Ga0207688_10067248 3300025901 Bacteria 2028
251 Ga0207645_10009923 3300025907 Bacteria 6559
252 Ga0207695_10226568 3300025913 Bacteria 1775
253 Ga0207671_10160000 3300025914 Bacteria 1743
254 Ga0207681_10012605 3300025923 Bacteria 5219
255 Ga0207681_10075350 3300025923 Bacteria 2366
256 Ga0207681_10236268 3300025923 Bacteria 1421
257 Ga0207694_10219030 3300025924 Bacteria 1552
258 Ga0207650_10019359 3300025925 Bacteria 4781
259 Ga0207650_10311798 3300025925 Bacteria 1287
260 Ga0207690_10206527 3300025932 Bacteria 1495
261 Ga0207706_10240518 3300025933 Bacteria 1582
262 Ga0207686_10020084 3300025934 Bacteria 3811
263 Ga0207686_10154566 3300025934 Bacteria 1601
264 Ga0207709_10000147 3300025935 Bacteria 97401
265 Ga0207709_10001737 3300025935 Bacteria 14677
266 Ga0207709_10009721 3300025935 Bacteria 5299
267 Ga0207709_10011042 3300025935 Bacteria 4980
268 Ga0207704_10041592 3300025938 Bacteria 2697
269 Ga0207691_10105128 3300025940 Bacteria 2515
270 Ga0207691_10360910 3300025940 Unclassified 1242
271 Ga0207679_10018064 3300025945 Bacteria 4716
272 Ga0207668_10002415 3300025972 Bacteria 10923
273 Ga0207658_10129522 3300025986 Bacteria 2025
274 Ga0207677_10157651 3300026023 Bacteria 1760
275 Ga0207639_10071285 3300026041 Unclassified 2717
276 Ga0207641_10173323 3300026088 Bacteria 1971
277 Ga0207648_10196618 3300026089 Bacteria 1788
278 Ga0207648_10317815 3300026089 Bacteria 1399
279 Ga0207674_10099952 3300026116 Bacteria 2883
280 Ga0207675_100149486 3300026118 Bacteria 2222
281 Ga0207683_10020918 3300026121 Bacteria 5599
282 Ga0207683_10024860 3300026121 Bacteria 5161
283 Ga0207683_10040295 3300026121 Bacteria 4075
284 Ga0207683_10115166 3300026121 Bacteria 2410
285 Ga0209281_1000002 3300027111 Bacteria 1924012
286 Ga0209281_1000125 3300027111 Bacteria 200371
287 Ga0209281_1022292 3300027111 Bacteria 1213
288 Ga0209282_1000221 3300027666 Bacteria 29591
289 Ga0209813_10003569 3300027866 Bacteria 3649
290 Ga0209974_10031352 3300027876 Bacteria 1760
291 Ga0268266_10185496 3300028379 Bacteria 1897
292 Ga0268265_10515486 3300028380 Bacteria 1129
293 Ga0307515_10000014 3300028794 Bacteria 562358
294 Ga0307515_10000137 3300028794 Bacteria 173516
295 Ga0307515_10000215 3300028794 Bacteria 142594
296 Ga0307515_10098521 3300028794 Bacteria 3559
297 Ga0316177_1005798 3300030731 Bacteria 3697
298 Ga0314311_1220690 3300030733 Bacteria 5561
299 Ga0316178_1124753 3300030735 Bacteria 1385
300 Ga0316182_1376612 3300030745 Bacteria 1246
301 Ga0316182_1422663 3300030745 Bacteria 1441
302 Ga0265327_10000108 3300031251 Bacteria 183209
303 Ga0265327_10005212 3300031251 Bacteria 10972
304 Ga0307513_10000006 3300031456 Bacteria 470848
305 Ga0307408_100005066 3300031548 Bacteria 8842
306 Ga0307408_100012595 3300031548 Bacteria 5605
307 Ga0307408_100061238 3300031548 Bacteria 2747
308 Ga0307408_100264739 3300031548 Bacteria 1424
309 Ga0307514_10008357 3300031649 Bacteria 8834
310 Ga0307514_10128952 3300031649 Bacteria 1745
311 Ga0307516_10003345 3300031730 Bacteria 20737
312 Ga0307405_10082415 3300031731 Bacteria 2105
313 Ga0307406_10003384 3300031901 Bacteria 8693
314 Ga0307412_10059103 3300031911 Bacteria 2568
315 Ga0307412_10080912 3300031911 Bacteria 2245
316 Ga0307416_100013165 3300032002 Bacteria 5613
317 Ga0307416_100288398 3300032002 Bacteria 1623
318 Ga0307416_100417801 3300032002 Bacteria 1384
319 Ga0307414_10223961 3300032004 Bacteria 1546
320 Ga0395905_0118094 3300037471 Bacteria 2493
321 Ga0395905_0129895 3300037471 Bacteria 2369
322 Ga0395905_0178069 3300037471 Bacteria 1996
323 Ga0439436_0002888 3300041404 Bacteria 5220
324 Ga0439436_0020790 3300041404 Bacteria 1954
325 Ga0439436_0046801 3300041404 Bacteria 1229
326 Ga0439447_027716 3300041407 Bacteria 1444
327 Ga0439447_037174 3300041407 Bacteria 1201
328 Ga0439466_0011174 3300041411 Bacteria 3323
329 Ga0439431_0000244 3300041997 Bacteria 11026
330 Ga0439431_0011897 3300041997 Bacteria 1994
331 Ga0439431_0017199 3300041997 Bacteria 1698
332 Ga0439433_0010174 3300041999 Bacteria 2053
333 Ga0439433_0018561 3300041999 Bacteria 1549
334 Ga0439442_002325 3300042002 Bacteria 3734
335 Ga0439445_0001130 3300042004 Bacteria 5710
336 Ga0439432_000895 3300042006 Bacteria 11191
337 Ga0439432_009575 3300042006 Bacteria 3376
338 Ga0439449_0000162 3300042007 Bacteria 22807
339 Ga0439449_0003095 3300042007 Bacteria 6480
340 Ga0439449_0008704 3300042007 Bacteria 3852
341 Ga0439449_0023099 3300042007 Bacteria 2328
342 Ga0439452_001519 3300042010 Bacteria 9348
343 Ga0439452_003280 3300042010 Bacteria 5700
344 Ga0439457_002467 3300042014 Bacteria 5275
345 Ga0439462_0028054 3300042015 Bacteria 1487
346 Ga0450919_000791 3300042121 Bacteria 4063
347 Ga0439446_0001692 3300042156 Bacteria 5112
348 Ga0439446_0041847 3300042156 Bacteria 1351
349 Ga0439434_0001507 3300042435 Bacteria 6703
350 Ga0439434_0010366 3300042435 Bacteria 2747
351 Ga0450918_000131 3300042531 Bacteria 16295
352 Ga0450918_007437 3300042531 Bacteria 1936
353 Ga0451577_0213361 3300042876 Bacteria 1744
354 Ga0453684_0295326 3300044712 Unclassified 1843
355 Ga0466960_0089034 3300044901 Bacteria 1570
356 Ga0495638_0008625 3300046460 Bacteria 7211
357 Ga0495650_0004904 3300046471 Bacteria 8940
358 Ga0495650_0023771 3300046471 Bacteria 2909
359 Ga0495639_0004274 3300046475 Bacteria 6127
360 Ga0495607_0160687 3300046501 Bacteria 1142
361 Ga0495616_0006349 3300046513 Bacteria 7167
362 Ga0495620_0005458 3300046515 Bacteria 7087
363 Ga0495631_0000314 3300046518 Bacteria 33596
364 Ga0495637_0002107 3300046520 Bacteria 11187
365 Ga0495643_0016383 3300046522 Bacteria 4353
366 Ga0495621_0007586 3300046539 Bacteria 3220
367 Ga0495656_0000051 3300046615 Bacteria 55112
368 Ga0495668_0045141 3300046616 Unclassified 2449
369 Ga0495625_0000057 3300046660 Bacteria 181623
370 Ga0495661_0118827 3300046665 Bacteria 1463
371 Ga0495588_0010542 3300046674 Bacteria 4302
372 Ga0495588_0053649 3300046674 Bacteria 2079
373 Ga0495588_0066832 3300046674 Bacteria 1866
374 Ga0495588_0175731 3300046674 Bacteria 1132
375 Ga0495658_0121683 3300046683 Bacteria 1579
376 Ga0495671_0003603 3300046692 Bacteria 9450
377 Ga0495671_0009248 3300046692 Bacteria 5508
378 Ga0495660_0076519 3300046810 Bacteria 1763
379 Ga0495676_0024069 3300047321 Bacteria 5276
380 Ga0495676_0134195 3300047321 Bacteria 1783
381 Ga0495686_0005034 3300047472 Bacteria 10611
382 Ga0495593_0003390 3300047673 Bacteria 9548
383 Ga0495614_0013538 3300048089 Bacteria 3576
384 Ga0495614_0058594 3300048089 Bacteria 1654
385 Ga0496100_0004454 3300048903 Bacteria 7431
386 Ga0496101_0023870 3300048904 Bacteria 4228
387 Ga0496102_0027988 3300048905 Bacteria 5036
388 Ga0496103_0051467 3300048906 Bacteria 2549
389 Ga0496104_0019488 3300048907 Bacteria 6209
390 Ga0496105_0005332 3300048908 Bacteria 9743
391 Ga0496106_0009138 3300048909 Bacteria 7322
392 Ga0496109_0141325 3300048912 Bacteria 2251
393 Ga0496111_0036072 3300048914 Bacteria 3536
394 Ga0496111_0124943 3300048914 Bacteria 1901
395 Ga0496114_0079702 3300048917 Bacteria 2765
396 Ga0496114_0197857 3300048917 Bacteria 1759
397 Ga0496116_0013989 3300048919 Bacteria 6429
398 Ga0496116_0123855 3300048919 Bacteria 1489
399 Ga0496117_0010676 3300048920 Bacteria 8319
400 Ga0496118_0027282 3300048921 Bacteria 4838
401 Ga0496119_0044835 3300048922 Bacteria 2779
402 Ga0496121_0014037 3300048924 Bacteria 8550
403 Ga0496121_0054314 3300048924 Bacteria 3348
404 Ga0496121_0088621 3300048924 Bacteria 2425
405 Ga0496121_0176785 3300048924 Bacteria 1545
406 Ga0496122_0000039 3300048925 Bacteria 295352
407 Ga0496122_0010051 3300048925 Bacteria 9833
408 Ga0496122_0031555 3300048925 Bacteria 4407
409 Ga0496122_0045989 3300048925 Bacteria 3385
410 Ga0496122_0069791 3300048925 Bacteria 2515
411 Ga0496122_0082864 3300048925 Bacteria 2226
412 Ga0496122_0144404 3300048925 Bacteria 1482
413 Ga0496123_0000026 3300048926 Bacteria 318040
414 Ga0496123_0000108 3300048926 Bacteria 166102
415 Ga0496123_0021779 3300048926 Bacteria 4968
416 Ga0496124_0035694 3300048927 Bacteria 4348
417 Ga0496124_0137326 3300048927 Bacteria 1934
418 Ga0496125_0012019 3300048928 Bacteria 8618
419 Ga0496125_0132359 3300048928 Bacteria 1753
420 Ga0496126_0188946 3300048929 Bacteria 1746
421 Ga0501321_002860 3300049537 Bacteria 1536
422 Ga0501034_0080760 3300049571 Bacteria 3255
423 Ga0501036_0107817 3300049572 Bacteria 2355
424 Ga0501041_0106142 3300049577 Bacteria 1741
425 Ga0501048_0162575 3300049582 Bacteria 1580
426 Ga0501073_0036971 3300049589 Bacteria 3468
427 Ga0501080_0001360 3300049742 Bacteria 20445
428 Ga0501081_0102342 3300049743 Bacteria 2026
429 Ga0501262_000144 3300049759 Bacteria 8833
430 Ga0501266_000871 3300049763 Bacteria 3931
431 nmdc:mga03683_1156_c2 3300050489 Bacteria 6568
432 nmdc:mga03683_4623_c2 3300050489 Bacteria 2985
433 nmdc:mga03n38_10461_c1 3300050490 Bacteria 1611
434 nmdc:mga03n38_6974_c1 3300050490 Bacteria 3969
435 nmdc:mga00v17_165139_c1 3300050491 Bacteria 1426
436 nmdc:mga00v17_29210_c1 3300050491 Bacteria 3235
437 nmdc:mga00v17_4493_c1 3300050491 Bacteria 7262
438 nmdc:mga0yw44_18373_c1 3300050492 Bacteria 3827
439 nmdc:mga0yw44_90600_c1 3300050492 Bacteria 1932
440 nmdc:mga0k408_14031_c1 3300050493 Bacteria 4405
441 nmdc:mga0k408_19722_c1 3300050493 Bacteria 3771
442 nmdc:mga0k408_250827_c1 3300050493 Bacteria 1057
443 nmdc:mga0k408_94921_c1 3300050493 Bacteria 1754
444 nmdc:mga06z11_101327_c1 3300050494 Bacteria 1580
445 nmdc:mga04h51_4498_c1 3300050495 Bacteria 3476
446 nmdc:mga07m45_1861_c2 3300050496 Bacteria 4839
447 nmdc:mga07m45_29426_c1 3300050496 Bacteria 3037
448 nmdc:mga07m45_32979_c1 3300050496 Bacteria 2874
449 nmdc:mga07m45_6560_c1 3300050496 Bacteria 5891
450 nmdc:mga05p37_725168_c1 3300050507 Bacteria 1100
451 nmdc:mga0qj67_5_c1 3300050509 Bacteria 160703
452 nmdc:mga08x19_3775_c1 3300050514 Bacteria 9016
453 nmdc:mga0sz30_11499_c2 3300050516 Bacteria 2855
454 Ga0500610_0000173 3300053079 Bacteria 19389
455 Ga0500610_0000175 3300053079 Bacteria 19266
456 Ga0500610_0054529 3300053079 Bacteria 2084
457 Ga0500635_0003069 3300053080 Bacteria 4174
458 Ga0500578_0016250 3300053086 Bacteria 4779
459 Ga0500643_002772 3300053087 Bacteria 8773
460 Ga0500643_019032 3300053087 Bacteria 2267
461 Ga0500646_0020310 3300053090 Bacteria 1764
462 Ga0500651_0000090 3300053093 Bacteria 58811
463 Ga0500651_0058311 3300053093 Bacteria 2414
464 Ga0500566_0037643 3300053094 Bacteria 2802
465 Ga0500641_0068533 3300053096 Bacteria 1489
466 Ga0500641_0110044 3300053096 Bacteria 1186
467 Ga0500555_053897 3300053103 Bacteria 1095
468 Ga0500562_000781 3300053108 Bacteria 7761
469 Ga0500562_012500 3300053108 Bacteria 2160
470 Ga0500569_002258 3300053109 Bacteria 3770
471 Ga0500571_000041 3300053110 Bacteria 40237
472 Ga0500571_000329 3300053110 Bacteria 18736
473 Ga0500593_000045 3300053117 Bacteria 43688
474 Ga0500593_000629 3300053117 Bacteria 13546
475 Ga0500595_040068 3300053119 Bacteria 1513
476 Ga0500607_000328 3300053121 Bacteria 44883
477 Ga0500607_000934 3300053121 Bacteria 27960
478 Ga0500607_010671 3300053121 Bacteria 5453
479 Ga0500618_010160 3300053125 Bacteria 2534
480 Ga0500626_063827 3300053128 Bacteria 1645
481 Ga0500655_000214 3300053133 Bacteria 13768
482 Ga0500655_000865 3300053133 Bacteria 5886
483 Ga0500658_0000018 3300053134 Bacteria 141217
484 Ga0500658_0000068 3300053134 Bacteria 48536
485 Ga0500658_0000614 3300053134 Bacteria 14765
486 Ga0500559_0054559 3300053136 Bacteria 1770
487 Ga0500561_0012300 3300053137 Bacteria 1823
488 Ga0500564_048514 3300053138 Bacteria 1945
489 Ga0500564_061714 3300053138 Bacteria 1699
490 Ga0500568_0004019 3300053139 Bacteria 7974
491 Ga0500573_0007244 3300053140 Bacteria 6045
492 Ga0500574_006956 3300053141 Bacteria 2315
493 Ga0500574_026398 3300053141 Bacteria 1523
494 Ga0500577_0037611 3300053142 Bacteria 1742
495 Ga0500590_046824 3300053148 Bacteria 2209
496 Ga0500624_006562 3300053157 Bacteria 1578
497 Ga0500627_0001973 3300053158 Bacteria 5913
498 Ga0500634_0003816 3300053161 Bacteria 6819
499 Ga0500634_0023017 3300053161 Bacteria 3386
500 Ga0500634_0053394 3300053161 Bacteria 2167
501 Ga0500638_014236 3300053162 Bacteria 3624
502 Ga0501082_0135119 3300060353 Bacteria 2140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_725168_c1 nmdc:mga05p37_725168_c1_14_823 267
2 3300048925 Ga0496122_0069791 Ga0496122_0069791_13_846 275
3 3300002773 JGI25152J39213_1000673 JGI25152J39213_100067311 279
4 3300002774 JGI25150J39212_1000503 JGI25150J39212_100050311 279
5 3300002987 JGI25159J45721_1000505 JGI25159J45721_10005055 279
6 3300003187 JGI25151J46595_10001271 JGI25151J46595_1000127111 279
7 3300003215 JGI25153J46596_10000930 JGI25153J46596_1000093011 279
8 3300003354 JGI25160J50197_1000732 JGI25160J50197_100073211 279
9 3300003374 JGI25161J50226_1000898 JGI25161J50226_10008984 279
10 3300003771 Ga0055526_1001027 Ga0055526_100102711 279
11 3300003773 Ga0055537_1000683 Ga0055537_100068311 279
12 3300003775 Ga0055524_1000828 Ga0055524_100082811 279
13 3300003784 Ga0055534_1000535 Ga0055534_100053511 279
14 3300003790 Ga0055528_1001096 Ga0055528_10010965 279
15 3300003794 Ga0055531_10004635 Ga0055531_100046353 279
16 3300004625 Ga0055543_1002819 Ga0055543_10028193 279
17 3300005262 Ga0065165_1001252 Ga0065165_10012525 279
18 3300025208 Ga0209436_102275 Ga0209436_1022753 279
19 3300025245 Ga0207425_1000087 Ga0207425_100008779 279
20 3300025258 Ga0209129_1000007 Ga0209129_1000007719 279
21 3300025263 Ga0209565_1000038 Ga0209565_100003879 279
22 3300025273 Ga0209673_1000080 Ga0209673_1000080181 279
23 3300025284 Ga0209130_1000137 Ga0209130_100013780 279
24 3300025291 Ga0209675_1000102 Ga0209675_100010266 279
25 3300025294 Ga0209025_1000056 Ga0209025_1000056205 279
26 3300025295 Ga0209564_1000073 Ga0209564_1000073241 279
27 3300025297 Ga0209758_1000044 Ga0209758_1000044192 279
28 3300025299 Ga0209256_1000020 Ga0209256_1000020195 279
29 3300025302 Ga0207426_1000001 Ga0207426_1000001830 279
30 3300025304 Ga0209257_1002543 Ga0209257_100254311 279
31 3300053108 Ga0500562_000781 Ga0500562_000781_2960_3829 285
32 3300053142 Ga0500577_0037611 Ga0500577_0037611_25_894 285
33 3300049572 Ga0501036_0107817 Ga0501036_0107817_118_1065 286
34 3300049577 Ga0501041_0106142 Ga0501041_0106142_415_1362 286
35 3300049582 Ga0501048_0162575 Ga0501048_0162575_196_1143 286
36 3300049743 Ga0501081_0102342 Ga0501081_0102342_743_1690 286
37 3300053140 Ga0500573_0007244 Ga0500573_0007244_2394_3398 286
38 3300060353 Ga0501082_0135119 Ga0501082_0135119_452_1399 286
39 iso_pu_bacteria 2643221736 2644742643 287
40 3300005456 Ga0070678_100105947 Ga0070678_1001059472 288
41 3300026121 Ga0207683_10115166 Ga0207683_101151661 288
42 3300005262 Ga0065165_1000150 Ga0065165_100015096 291
43 3300025284 Ga0209130_1000187 Ga0209130_100018710 291
44 3300025294 Ga0209025_1001133 Ga0209025_10011338 291
45 3300025302 Ga0207426_1006487 Ga0207426_10064874 291
46 3300005577 Ga0068857_100127667 Ga0068857_1001276674 292
47 3300006914 Ga0075436_100025269 Ga0075436_1000252695 296
48 3300050514 nmdc:mga08x19_3775_c1 nmdc:mga08x19_3775_c1_5015_6004 296
49 iso_pu_bacteria 2945972063 2945977350 296
50 3300006846 Ga0075430_100031429 Ga0075430_1000314294 297
51 3300006847 Ga0075431_100023776 Ga0075431_1000237763 297
52 3300026089 Ga0207648_10196618 Ga0207648_101966183 298
53 3300003578 Ga0006562J51391_1183337 Ga0006562J51391_11833372 299
54 3300006038 Ga0075365_10027431 Ga0075365_100274313 299
55 3300006048 Ga0075363_100049383 Ga0075363_1000493833 299
56 3300006051 Ga0075364_10021924 Ga0075364_100219243 299
57 3300006058 Ga0075432_10010889 Ga0075432_100108893 299
58 3300006195 Ga0075366_10040208 Ga0075366_100402082 299
59 3300006353 Ga0075370_10041025 Ga0075370_100410253 299
60 3300030735 Ga0316178_1124753 Ga0316178_11247532 299
61 3300031649 Ga0307514_10128952 Ga0307514_101289522 299
62 3300048924 Ga0496121_0014037 Ga0496121_0014037_869_1858 299
63 3300005539 Ga0068853_100085237 Ga0068853_1000852372 302
64 3300009176 Ga0105242_10001456 Ga0105242_1000145612 302
65 3300025934 Ga0207686_10020084 Ga0207686_100200842 302
66 3300026041 Ga0207639_10071285 Ga0207639_100712851 302
67 3300009147 Ga0114129_10324252 Ga0114129_103242522 303
68 3300014497 Ga0182008_10003480 Ga0182008_100034808 304
69 3300015261 Ga0182006_1051512 Ga0182006_10515121 304
70 3300015262 Ga0182007_10000842 Ga0182007_100008425 304
71 3300046674 Ga0495588_0053649 Ga0495588_0053649_1139_2068 304
72 3300046522 Ga0495643_0016383 Ga0495643_0016383_630_1631 305
73 3300048925 Ga0496122_0045989 Ga0496122_0045989_1608_2594 305
74 3300053121 Ga0500607_010671 Ga0500607_010671_722_1732 306
75 3300046660 Ga0495625_0000057 Ga0495625_0000057_178298_179344 307
76 3300006946 Ga0079104_1001506 Ga0079104_10015066 308
77 3300009092 Ga0105250_10082417 Ga0105250_100824172 308
78 3300009148 Ga0105243_10009917 Ga0105243_100099176 308
79 3300025711 Ga0207696_1043505 Ga0207696_10435052 308
80 3300025935 Ga0207709_10001737 Ga0207709_100017376 308
81 3300027111 Ga0209281_1000002 Ga0209281_1000002778 308
82 3300037471 Ga0395905_0118094 Ga0395905_0118094_76_1044 308
83 3300049571 Ga0501034_0080760 Ga0501034_0080760_209_1159 308
84 3300049589 Ga0501073_0036971 Ga0501073_0036971_148_1098 308
85 3300049742 Ga0501080_0001360 Ga0501080_0001360_4510_5460 308
86 3300050490 nmdc:mga03n38_6974_c1 nmdc:mga03n38_6974_c1_1299_2285 308
87 3300050491 nmdc:mga00v17_29210_c1 nmdc:mga00v17_29210_c1_1103_2089 308
88 3300050493 nmdc:mga0k408_14031_c1 nmdc:mga0k408_14031_c1_3385_4371 308
89 iso_pu_bacteria 2929199973 2929200837 308
90 iso_pu_bacteria 8055909800 8055911765 308
91 3300005841 Ga0068863_100170570 Ga0068863_1001705702 309
92 3300026088 Ga0207641_10173323 Ga0207641_101733232 309
93 3300028794 Ga0307515_10000137 Ga0307515_100001374 309
94 3300046683 Ga0495658_0121683 Ga0495658_0121683_452_1498 309
95 3300047321 Ga0495676_0134195 Ga0495676_0134195_629_1675 309
96 3300048928 Ga0496125_0132359 Ga0496125_0132359_765_1712 309
97 3300053110 Ga0500571_000329 Ga0500571_000329_15891_16937 309
98 3300053138 Ga0500564_061714 Ga0500564_061714_262_1308 309
99 3300005288 Ga0065714_10007015 Ga0065714_100070154 310
100 3300009147 Ga0114129_10693568 Ga0114129_106935682 310
101 3300042121 Ga0450919_000791 Ga0450919_000791_1184_2149 310
102 iso_pu_bacteria 2643221644 2644244662 310
103 iso_pu_bacteria 2904449895 2904453076 310
104 3300003775 Ga0055524_1000326 Ga0055524_10003268 311
105 3300003792 Ga0055540_1000073 Ga0055540_100007398 311
106 3300003794 Ga0055531_10038210 Ga0055531_100382102 311
107 3300006946 Ga0079104_1000056 Ga0079104_10000562 311
108 3300025298 Ga0209050_1000942 Ga0209050_10009422 311
109 3300025298 Ga0209050_1005650 Ga0209050_10056505 311
110 3300025299 Ga0209256_1000049 Ga0209256_1000049122 311
111 3300025303 Ga0209051_1000029 Ga0209051_1000029350 311
112 3300025304 Ga0209257_1000168 Ga0209257_1000168146 311
113 3300027111 Ga0209281_1000125 Ga0209281_100012510 311
114 3300031251 Ga0265327_10000108 Ga0265327_10000108134 311
115 3300041404 Ga0439436_0046801 Ga0439436_0046801_57_1028 311
116 3300041999 Ga0439433_0018561 Ga0439433_0018561_57_1028 311
117 3300042007 Ga0439449_0023099 Ga0439449_0023099_731_1702 311
118 3300046471 Ga0495650_0023771 Ga0495650_0023771_1781_2749 311
119 3300048917 Ga0496114_0197857 Ga0496114_0197857_162_1133 311
120 3300050493 nmdc:mga0k408_250827_c1 nmdc:mga0k408_250827_c1_10_981 311
121 3300050493 nmdc:mga0k408_94921_c1 nmdc:mga0k408_94921_c1_636_1607 311
122 3300005328 Ga0070676_10021421 Ga0070676_100214213 312
123 3300005347 Ga0070668_100156757 Ga0070668_1001567572 312
124 3300005354 Ga0070675_100019069 Ga0070675_1000190692 312
125 3300005543 Ga0070672_100071128 Ga0070672_1000711282 312
126 3300005577 Ga0068857_100104216 Ga0068857_1001042162 312
127 3300005615 Ga0070702_100247048 Ga0070702_1002470481 312
128 3300005843 Ga0068860_100196425 Ga0068860_1001964253 312
129 3300014326 Ga0157380_10073871 Ga0157380_100738712 312
130 3300025907 Ga0207645_10009923 Ga0207645_100099233 312
131 3300025925 Ga0207650_10311798 Ga0207650_103117981 312
132 3300025933 Ga0207706_10240518 Ga0207706_102405182 312
133 3300026023 Ga0207677_10157651 Ga0207677_101576512 312
134 3300026116 Ga0207674_10099952 Ga0207674_100999522 312
135 3300030733 Ga0314311_1220690 Ga0314311_12206904 312
136 3300031548 Ga0307408_100012595 Ga0307408_1000125952 312
137 3300031911 Ga0307412_10059103 Ga0307412_100591031 312
138 3300041997 Ga0439431_0017199 Ga0439431_0017199_48_1022 312
139 3300042531 Ga0450918_000131 Ga0450918_000131_5518_6489 312
140 3300053119 Ga0500595_040068 Ga0500595_040068_418_1386 312
141 3300053148 Ga0500590_046824 Ga0500590_046824_528_1505 312
142 iso_pu_bacteria 2839138175 2839138608 312
143 3300002987 JGI25159J45721_1001997 JGI25159J45721_10019972 313
144 3300003187 JGI25151J46595_10001929 JGI25151J46595_100019295 313
145 3300003354 JGI25160J50197_1018065 JGI25160J50197_10180652 313
146 3300003374 JGI25161J50226_1003193 JGI25161J50226_10031931 313
147 3300003771 Ga0055526_1002078 Ga0055526_10020786 313
148 3300003773 Ga0055537_1000036 Ga0055537_100003660 313
149 3300003773 Ga0055537_1014642 Ga0055537_10146421 313
150 3300003775 Ga0055524_1001149 Ga0055524_10011496 313
151 3300003781 Ga0055536_1000875 Ga0055536_100087511 313
152 3300003781 Ga0055536_1001160 Ga0055536_10011607 313
153 3300003781 Ga0055536_1002042 Ga0055536_10020428 313
154 3300003784 Ga0055534_1000018 Ga0055534_100001824 313
155 3300003784 Ga0055534_1007558 Ga0055534_10075582 313
156 3300003790 Ga0055528_1000903 Ga0055528_10009033 313
157 3300003790 Ga0055528_1024195 Ga0055528_10241951 313
158 3300003790 Ga0055528_1030796 Ga0055528_10307962 313
159 3300003791 Ga0055530_10000086 Ga0055530_1000008651 313
160 3300003791 Ga0055530_10007519 Ga0055530_100075193 313
161 3300003792 Ga0055540_1000894 Ga0055540_100089411 313
162 3300003792 Ga0055540_1004096 Ga0055540_10040965 313
163 3300003792 Ga0055540_1004991 Ga0055540_10049914 313
164 3300003794 Ga0055531_10001217 Ga0055531_100012177 313
165 3300003794 Ga0055531_10002312 Ga0055531_100023128 313
166 3300004625 Ga0055543_1000964 Ga0055543_10009645 313
167 3300005262 Ga0065165_1006153 Ga0065165_10061533 313
168 3300005564 Ga0070664_100047093 Ga0070664_1000470934 313
169 3300006177 Ga0075362_10004440 Ga0075362_100044405 313
170 3300006195 Ga0075366_10021112 Ga0075366_100211123 313
171 3300006195 Ga0075366_10172716 Ga0075366_101727162 313
172 3300006353 Ga0075370_10005227 Ga0075370_100052275 313
173 3300006353 Ga0075370_10007084 Ga0075370_100070843 313
174 3300006881 Ga0068865_100215065 Ga0068865_1002150651 313
175 3300006948 Ga0099826_10000369 Ga0099826_1000036912 313
176 3300009148 Ga0105243_10020508 Ga0105243_100205082 313
177 3300010375 Ga0105239_10705162 Ga0105239_107051622 313
178 3300013104 Ga0157370_10008744 Ga0157370_100087449 313
179 3300013104 Ga0157370_10244360 Ga0157370_102443602 313
180 3300014326 Ga0157380_10056306 Ga0157380_100563063 313
181 3300014497 Ga0182008_10009972 Ga0182008_100099722 313
182 3300015261 Ga0182006_1016573 Ga0182006_10165732 313
183 3300015262 Ga0182007_10000727 Ga0182007_1000072715 313
184 3300015262 Ga0182007_10025419 Ga0182007_100254192 313
185 3300017792 Ga0163161_10058890 Ga0163161_100588902 313
186 3300017792 Ga0163161_10135423 Ga0163161_101354232 313
187 3300025245 Ga0207425_1007769 Ga0207425_10077692 313
188 3300025258 Ga0209129_1004712 Ga0209129_10047122 313
189 3300025263 Ga0209565_1000075 Ga0209565_1000075133 313
190 3300025263 Ga0209565_1004633 Ga0209565_10046332 313
191 3300025273 Ga0209673_1000066 Ga0209673_100006668 313
192 3300025273 Ga0209673_1001092 Ga0209673_100109221 313
193 3300025273 Ga0209673_1002586 Ga0209673_10025864 313
194 3300025284 Ga0209130_1000131 Ga0209130_100013176 313
195 3300025284 Ga0209130_1001901 Ga0209130_10019018 313
196 3300025291 Ga0209675_1000074 Ga0209675_1000074133 313
197 3300025291 Ga0209675_1013064 Ga0209675_10130642 313
198 3300025292 Ga0209676_1000005 Ga0209676_1000005901 313
199 3300025292 Ga0209676_1000139 Ga0209676_100013937 313
200 3300025292 Ga0209676_1000186 Ga0209676_100018687 313
201 3300025294 Ga0209025_1000088 Ga0209025_1000088160 313
202 3300025294 Ga0209025_1000104 Ga0209025_10001046 313
203 3300025294 Ga0209025_1021862 Ga0209025_10218623 313
204 3300025294 Ga0209025_1027639 Ga0209025_10276392 313
205 3300025295 Ga0209564_1000090 Ga0209564_100009051 313
206 3300025297 Ga0209758_1007714 Ga0209758_10077144 313
207 3300025298 Ga0209050_1000007 Ga0209050_1000007196 313
208 3300025298 Ga0209050_1000250 Ga0209050_100025078 313
209 3300025299 Ga0209256_1000022 Ga0209256_1000022241 313
210 3300025302 Ga0207426_1000031 Ga0207426_1000031398 313
211 3300025303 Ga0209051_1000036 Ga0209051_1000036252 313
212 3300025303 Ga0209051_1000160 Ga0209051_100016086 313
213 3300025303 Ga0209051_1000213 Ga0209051_100021323 313
214 3300025304 Ga0209257_1000011 Ga0209257_1000011875 313
215 3300025304 Ga0209257_1000116 Ga0209257_100011637 313
216 3300025728 Ga0207655_1027258 Ga0207655_10272582 313
217 3300025924 Ga0207694_10219030 Ga0207694_102190302 313
218 3300025932 Ga0207690_10206527 Ga0207690_102065271 313
219 3300025935 Ga0207709_10009721 Ga0207709_100097211 313
220 3300025935 Ga0207709_10011042 Ga0207709_100110425 313
221 3300025945 Ga0207679_10018064 Ga0207679_100180645 313
222 3300027111 Ga0209281_1022292 Ga0209281_10222921 313
223 3300027666 Ga0209282_1000221 Ga0209282_100022110 313
224 3300027876 Ga0209974_10031352 Ga0209974_100313522 313
225 3300028380 Ga0268265_10515486 Ga0268265_105154862 313
226 3300028794 Ga0307515_10000014 Ga0307515_10000014171 313
227 3300030731 Ga0316177_1005798 Ga0316177_10057983 313
228 3300030745 Ga0316182_1422663 Ga0316182_14226632 313
229 3300031548 Ga0307408_100005066 Ga0307408_1000050667 313
230 3300031548 Ga0307408_100264739 Ga0307408_1002647392 313
231 3300031901 Ga0307406_10003384 Ga0307406_100033847 313
232 3300032002 Ga0307416_100288398 Ga0307416_1002883982 313
233 3300032002 Ga0307416_100417801 Ga0307416_1004178012 313
234 3300037471 Ga0395905_0129895 Ga0395905_0129895_590_1558 313
235 3300037471 Ga0395905_0178069 Ga0395905_0178069_991_1959 313
236 3300041404 Ga0439436_0020790 Ga0439436_0020790_77_1060 313
237 3300041997 Ga0439431_0011897 Ga0439431_0011897_692_1675 313
238 3300042435 Ga0439434_0010366 Ga0439434_0010366_1327_2310 313
239 3300042531 Ga0450918_007437 Ga0450918_007437_934_1917 313
240 3300046520 Ga0495637_0002107 Ga0495637_0002107_6003_6983 313
241 3300046616 Ga0495668_0045141 Ga0495668_0045141_379_1356 313
242 3300046665 Ga0495661_0118827 Ga0495661_0118827_222_1202 313
243 3300046674 Ga0495588_0066832 Ga0495588_0066832_280_1260 313
244 3300046692 Ga0495671_0003603 Ga0495671_0003603_4062_5042 313
245 3300046810 Ga0495660_0076519 Ga0495660_0076519_385_1365 313
246 3300048904 Ga0496101_0023870 Ga0496101_0023870_706_1686 313
247 3300048919 Ga0496116_0013989 Ga0496116_0013989_3281_4261 313
248 3300048921 Ga0496118_0027282 Ga0496118_0027282_828_1808 313
249 3300049759 Ga0501262_000144 Ga0501262_000144_964_1947 313
250 3300049763 Ga0501266_000871 Ga0501266_000871_1154_2143 313
251 3300050493 nmdc:mga0k408_19722_c1 nmdc:mga0k408_19722_c1_1991_2983 313
252 3300050494 nmdc:mga06z11_101327_c1 nmdc:mga06z11_101327_c1_468_1448 313
253 3300050496 nmdc:mga07m45_1861_c2 nmdc:mga07m45_1861_c2_2892_3875 313
254 3300050496 nmdc:mga07m45_6560_c1 nmdc:mga07m45_6560_c1_326_1318 313
255 3300050516 nmdc:mga0sz30_11499_c2 nmdc:mga0sz30_11499_c2_460_1443 313
256 3300053079 Ga0500610_0000173 Ga0500610_0000173_10619_11599 313
257 3300053103 Ga0500555_053897 Ga0500555_053897_56_1036 313
258 3300053109 Ga0500569_002258 Ga0500569_002258_333_1313 313
259 3300053117 Ga0500593_000629 Ga0500593_000629_10296_11276 313
260 3300053121 Ga0500607_000328 Ga0500607_000328_32890_33870 313
261 3300053128 Ga0500626_063827 Ga0500626_063827_546_1526 313
262 3300053133 Ga0500655_000214 Ga0500655_000214_4440_5420 313
263 3300053136 Ga0500559_0054559 Ga0500559_0054559_320_1300 313
264 3300053161 Ga0500634_0003816 Ga0500634_0003816_574_1554 313
265 iso_pu_bacteria 2513020051 2513226407 313
266 iso_pu_bacteria 2599185214 2599626516 313
267 iso_pu_bacteria 2599185226 2599675580 313
268 iso_pu_bacteria 2599185227 2599684053 313
269 iso_pu_bacteria 2599185229 2599696067 313
270 iso_pu_bacteria 2643221570 2643865273 313
271 iso_pu_bacteria 2643221596 2643991501 313
272 iso_pu_bacteria 2643221609 2644062341 313
273 iso_pu_bacteria 2643221628 2644163312 313
274 iso_pu_bacteria 2643221652 2644292548 313
275 iso_pu_bacteria 2643221654 2644301149 313
276 iso_pu_bacteria 2643221654 2644303122 313
277 iso_pu_bacteria 2643221658 2644327827 313
278 iso_pu_bacteria 2643221672 2644400524 313
279 iso_pu_bacteria 2721755523 2722885737 313
280 iso_pu_bacteria 2738541277 2738717936 313
281 iso_pu_bacteria 2738543012 2739243082 313
282 iso_pu_bacteria 2738543019 2739278622 313
283 iso_pu_bacteria 2816332133 2816473226 313
284 iso_pu_bacteria 2818991467 2819721139 313
285 iso_pu_bacteria 2831265667 2831266646 313
286 iso_pu_bacteria 2838054893 2838057275 313
287 iso_pu_bacteria 2842333319 2842336759 313
288 iso_pu_bacteria 2842677519 2842679583 313
289 iso_pu_bacteria 2842718218 2842721703 313
290 iso_pu_bacteria 2885198086 2885201330 313
291 iso_pu_bacteria 2885211737 2885214988 313
292 iso_pu_bacteria 2904449895 2904455682 313
293 iso_pu_bacteria 2904456579 2904462808 313
294 iso_pu_bacteria 2904541872 2904544895 313
295 iso_pu_bacteria 2919462493 2919467321 313
296 iso_pu_bacteria 2928070936 2928071396 313
297 iso_pu_bacteria 2928084124 2928084662 313
298 iso_pu_bacteria 2929160207 2929163435 313
299 iso_pu_bacteria 2929520902 2929522670 313
300 iso_pu_bacteria 2945909444 2945912129 313
301 iso_pu_bacteria 2945945610 2945947805 313
302 iso_pu_bacteria 2945984333 2945985586 313
303 iso_pu_bacteria 2974320154 2974322087 313
304 iso_pu_bacteria 2990710928 2990714054 313
305 3300003781 Ga0055536_1002368 Ga0055536_10023683 314
306 3300003781 Ga0055536_1023771 Ga0055536_10237712 314
307 3300003784 Ga0055534_1001805 Ga0055534_10018056 314
308 3300003784 Ga0055534_1001837 Ga0055534_10018372 314
309 3300003792 Ga0055540_1003761 Ga0055540_10037615 314
310 3300005262 Ga0065165_1010337 Ga0065165_10103373 314
311 3300005327 Ga0070658_10090874 Ga0070658_100908742 314
312 3300005356 Ga0070674_100254776 Ga0070674_1002547762 314
313 3300005367 Ga0070667_100028805 Ga0070667_1000288058 314
314 3300005548 Ga0070665_100315422 Ga0070665_1003154221 314
315 3300005578 Ga0068854_100062233 Ga0068854_1000622332 314
316 3300005616 Ga0068852_100130372 Ga0068852_1001303722 314
317 3300006048 Ga0075363_100188494 Ga0075363_1001884941 314
318 3300006195 Ga0075366_10012090 Ga0075366_100120907 314
319 3300006881 Ga0068865_100298878 Ga0068865_1002988781 314
320 3300009093 Ga0105240_10153597 Ga0105240_101535972 314
321 3300009545 Ga0105237_10236605 Ga0105237_102366052 314
322 3300013105 Ga0157369_10108768 Ga0157369_101087684 314
323 3300013306 Ga0163162_10400960 Ga0163162_104009601 314
324 3300017792 Ga0163161_10016574 Ga0163161_100165742 314
325 3300017792 Ga0163161_10066035 Ga0163161_100660352 314
326 3300025284 Ga0209130_1015649 Ga0209130_10156492 314
327 3300025291 Ga0209675_1017546 Ga0209675_10175461 314
328 3300025292 Ga0209676_1000142 Ga0209676_10001427 314
329 3300025292 Ga0209676_1004996 Ga0209676_10049962 314
330 3300025295 Ga0209564_1026118 Ga0209564_10261182 314
331 3300025303 Ga0209051_1000243 Ga0209051_10002437 314
332 3300025303 Ga0209051_1010050 Ga0209051_10100501 314
333 3300025304 Ga0209257_1005026 Ga0209257_10050265 314
334 3300025913 Ga0207695_10226568 Ga0207695_102265682 314
335 3300025914 Ga0207671_10160000 Ga0207671_101600002 314
336 3300025923 Ga0207681_10075350 Ga0207681_100753502 314
337 3300025935 Ga0207709_10000147 Ga0207709_1000014773 314
338 3300025938 Ga0207704_10041592 Ga0207704_100415922 314
339 3300026121 Ga0207683_10024860 Ga0207683_100248603 314
340 3300026121 Ga0207683_10040295 Ga0207683_100402952 314
341 3300030745 Ga0316182_1376612 Ga0316182_13766121 314
342 3300031251 Ga0265327_10005212 Ga0265327_100052122 314
343 3300041404 Ga0439436_0002888 Ga0439436_0002888_913_1899 314
344 3300041407 Ga0439447_027716 Ga0439447_027716_46_1032 314
345 3300041411 Ga0439466_0011174 Ga0439466_0011174_2130_3116 314
346 3300041997 Ga0439431_0000244 Ga0439431_0000244_1695_2681 314
347 3300042002 Ga0439442_002325 Ga0439442_002325_1093_2079 314
348 3300042004 Ga0439445_0001130 Ga0439445_0001130_2574_3560 314
349 3300042006 Ga0439432_000895 Ga0439432_000895_4687_5673 314
350 3300042007 Ga0439449_0000162 Ga0439449_0000162_18945_19931 314
351 3300042007 Ga0439449_0008704 Ga0439449_0008704_217_1203 314
352 3300042010 Ga0439452_001519 Ga0439452_001519_4280_5266 314
353 3300042010 Ga0439452_003280 Ga0439452_003280_1799_2785 314
354 3300042014 Ga0439457_002467 Ga0439457_002467_4243_5229 314
355 3300042015 Ga0439462_0028054 Ga0439462_0028054_380_1366 314
356 3300042156 Ga0439446_0001692 Ga0439446_0001692_3432_4418 314
357 3300042156 Ga0439446_0041847 Ga0439446_0041847_110_1096 314
358 3300042435 Ga0439434_0001507 Ga0439434_0001507_209_1195 314
359 3300046475 Ga0495639_0004274 Ga0495639_0004274_4190_5176 314
360 3300046615 Ga0495656_0000051 Ga0495656_0000051_47235_48221 314
361 3300046674 Ga0495588_0175731 Ga0495588_0175731_39_1025 314
362 3300048089 Ga0495614_0058594 Ga0495614_0058594_448_1434 314
363 3300048903 Ga0496100_0004454 Ga0496100_0004454_3803_4789 314
364 3300048905 Ga0496102_0027988 Ga0496102_0027988_1448_2434 314
365 3300048906 Ga0496103_0051467 Ga0496103_0051467_491_1477 314
366 3300048907 Ga0496104_0019488 Ga0496104_0019488_1717_2703 314
367 3300048908 Ga0496105_0005332 Ga0496105_0005332_8334_9320 314
368 3300048912 Ga0496109_0141325 Ga0496109_0141325_195_1181 314
369 3300048914 Ga0496111_0036072 Ga0496111_0036072_2405_3391 314
370 3300048914 Ga0496111_0124943 Ga0496111_0124943_718_1704 314
371 3300048917 Ga0496114_0079702 Ga0496114_0079702_689_1675 314
372 3300048924 Ga0496121_0176785 Ga0496121_0176785_492_1478 314
373 3300048927 Ga0496124_0137326 Ga0496124_0137326_319_1302 314
374 iso_pu_bacteria 2643221683 2644468377 314
375 iso_pu_bacteria 2841760612 2841764056 314
376 iso_pu_bacteria 2842747753 2842751519 314
377 iso_pu_bacteria 2844104063 2844108489 314
378 iso_pu_bacteria 2851182111 2851185295 314
379 iso_pu_bacteria 2851246043 2851250491 314
380 iso_pu_bacteria 2885192300 2885192557 314
381 iso_pu_bacteria 2917699015 2917704962 314
382 iso_pu_bacteria 2954767861 2954772125 314
383 iso_pu_bacteria 8057529695 8057534025 314
384 3300006038 Ga0075365_10015817 Ga0075365_100158172 315
385 3300006042 Ga0075368_10009942 Ga0075368_100099422 315
386 3300006051 Ga0075364_10029776 Ga0075364_100297762 315
387 3300006353 Ga0075370_10113002 Ga0075370_101130022 315
388 3300009148 Ga0105243_10181790 Ga0105243_101817902 315
389 3300017792 Ga0163161_10000578 Ga0163161_1000057810 315
390 3300025923 Ga0207681_10236268 Ga0207681_102362682 315
391 3300025940 Ga0207691_10105128 Ga0207691_101051282 315
392 3300027866 Ga0209813_10003569 Ga0209813_100035692 315
393 3300031456 Ga0307513_10000006 Ga0307513_1000000632 315
394 3300031548 Ga0307408_100061238 Ga0307408_1000612382 315
395 3300031730 Ga0307516_10003345 Ga0307516_100033455 315
396 3300042006 Ga0439432_009575 Ga0439432_009575_1259_2236 315
397 3300042007 Ga0439449_0003095 Ga0439449_0003095_5088_6065 315
398 3300044712 Ga0453684_0295326 Ga0453684_0295326_209_1186 315
399 3300046471 Ga0495650_0004904 Ga0495650_0004904_1226_2212 315
400 3300050490 nmdc:mga03n38_10461_c1 nmdc:mga03n38_10461_c1_151_1266 315
401 3300050495 nmdc:mga04h51_4498_c1 nmdc:mga04h51_4498_c1_1287_2261 315
402 3300050496 nmdc:mga07m45_32979_c1 nmdc:mga07m45_32979_c1_381_1355 315
403 3300003771 Ga0055526_1000184 Ga0055526_100018432 316
404 3300003773 Ga0055537_1000006 Ga0055537_100000698 316
405 3300003775 Ga0055524_1000032 Ga0055524_100003246 316
406 3300003784 Ga0055534_1000048 Ga0055534_100004810 316
407 3300005347 Ga0070668_100205342 Ga0070668_1002053421 316
408 3300005353 Ga0070669_100244868 Ga0070669_1002448682 316
409 3300005841 Ga0068863_100284909 Ga0068863_1002849092 316
410 3300005844 Ga0068862_100032571 Ga0068862_1000325713 316
411 3300006195 Ga0075366_10009077 Ga0075366_100090778 316
412 3300006237 Ga0097621_100377961 Ga0097621_1003779612 316
413 3300009148 Ga0105243_10000481 Ga0105243_100004813 316
414 3300009148 Ga0105243_10330639 Ga0105243_103306391 316
415 3300014497 Ga0182008_10081805 Ga0182008_100818052 316
416 3300025245 Ga0207425_1004522 Ga0207425_10045222 316
417 3300025263 Ga0209565_1000016 Ga0209565_1000016232 316
418 3300025273 Ga0209673_1000073 Ga0209673_100007346 316
419 3300025291 Ga0209675_1000080 Ga0209675_1000080143 316
420 3300025292 Ga0209676_1001725 Ga0209676_10017255 316
421 3300025295 Ga0209564_1000165 Ga0209564_1000165121 316
422 3300025299 Ga0209256_1000110 Ga0209256_100011046 316
423 3300025925 Ga0207650_10019359 Ga0207650_100193593 316
424 3300025934 Ga0207686_10154566 Ga0207686_101545661 316
425 3300025940 Ga0207691_10360910 Ga0207691_103609101 316
426 3300025972 Ga0207668_10002415 Ga0207668_100024158 316
427 3300025986 Ga0207658_10129522 Ga0207658_101295222 316
428 3300026089 Ga0207648_10317815 Ga0207648_103178152 316
429 3300026118 Ga0207675_100149486 Ga0207675_1001494862 316
430 3300028379 Ga0268266_10185496 Ga0268266_101854962 316
431 3300041407 Ga0439447_037174 Ga0439447_037174_36_1046 316
432 3300041999 Ga0439433_0010174 Ga0439433_0010174_894_1904 316
433 3300042876 Ga0451577_0213361 Ga0451577_0213361_396_1406 316
434 3300046460 Ga0495638_0008625 Ga0495638_0008625_2944_3978 316
435 3300046501 Ga0495607_0160687 Ga0495607_0160687_96_1082 316
436 3300046513 Ga0495616_0006349 Ga0495616_0006349_4086_5120 316
437 3300046518 Ga0495631_0000314 Ga0495631_0000314_12899_13933 316
438 3300046539 Ga0495621_0007586 Ga0495621_0007586_373_1407 316
439 3300046674 Ga0495588_0010542 Ga0495588_0010542_653_1687 316
440 3300048922 Ga0496119_0044835 Ga0496119_0044835_1505_2539 316
441 3300048924 Ga0496121_0054314 Ga0496121_0054314_950_1984 316
442 3300048925 Ga0496122_0010051 Ga0496122_0010051_971_1990 316
443 3300048925 Ga0496122_0031555 Ga0496122_0031555_1384_2418 316
444 3300048925 Ga0496122_0144404 Ga0496122_0144404_155_1198 316
445 3300048926 Ga0496123_0000108 Ga0496123_0000108_23823_24842 316
446 3300048926 Ga0496123_0021779 Ga0496123_0021779_3591_4625 316
447 3300048927 Ga0496124_0035694 Ga0496124_0035694_891_1910 316
448 3300048928 Ga0496125_0012019 Ga0496125_0012019_7390_8433 316
449 3300048929 Ga0496126_0188946 Ga0496126_0188946_124_1158 316
450 3300053087 Ga0500643_002772 Ga0500643_002772_4091_5125 316
451 3300053090 Ga0500646_0020310 Ga0500646_0020310_737_1741 316
452 3300053093 Ga0500651_0000090 Ga0500651_0000090_25430_26464 316
453 3300053096 Ga0500641_0068533 Ga0500641_0068533_11_994 316
454 3300053134 Ga0500658_0000018 Ga0500658_0000018_47306_48343 316
455 3300053134 Ga0500658_0000068 Ga0500658_0000068_46917_47951 316
456 3300053139 Ga0500568_0004019 Ga0500568_0004019_2421_3458 316
457 3300053141 Ga0500574_026398 Ga0500574_026398_127_1161 316
458 iso_pu_bacteria 2775506901 2776266774 316
459 iso_pu_bacteria 2885192300 2885193460 316
460 3300003578 Ga0006562J51391_1125836 Ga0006562J51391_11258364 317
461 3300003578 Ga0006562J51391_1125839 Ga0006562J51391_11258394 317
462 3300003792 Ga0055540_1001765 Ga0055540_10017657 317
463 3300005289 Ga0065704_10088799 Ga0065704_100887992 317
464 3300006038 Ga0075365_10072562 Ga0075365_100725622 317
465 3300006177 Ga0075362_10001734 Ga0075362_100017346 317
466 3300006353 Ga0075370_10035937 Ga0075370_100359372 317
467 3300013100 Ga0157373_10018829 Ga0157373_100188293 317
468 3300015265 Ga0182005_1017935 Ga0182005_10179352 317
469 3300025303 Ga0209051_1001689 Ga0209051_100168913 317
470 3300028794 Ga0307515_10000215 Ga0307515_1000021542 317
471 3300031649 Ga0307514_10008357 Ga0307514_100083577 317
472 3300031731 Ga0307405_10082415 Ga0307405_100824152 317
473 3300032004 Ga0307414_10223961 Ga0307414_102239611 317
474 3300044901 Ga0466960_0089034 Ga0466960_0089034_405_1394 317
475 3300050489 nmdc:mga03683_1156_c2 nmdc:mga03683_1156_c2_2123_3136 317
476 3300050491 nmdc:mga00v17_165139_c1 nmdc:mga00v17_165139_c1_314_1327 317
477 3300050492 nmdc:mga0yw44_18373_c1 nmdc:mga0yw44_18373_c1_2355_3368 317
478 3300050496 nmdc:mga07m45_29426_c1 nmdc:mga07m45_29426_c1_200_1192 317
479 iso_pu_bacteria 2904449895 2904453500 317
480 iso_pu_bacteria 2904456579 2904463076 317
481 iso_pu_bacteria 2929520902 2929525088 317
482 iso_pu_bacteria 2945972063 2945972226 317
483 3300002987 JGI25159J45721_1005379 JGI25159J45721_10053795 318
484 3300003323 rootH1_10174792 rootH1_101747921 318
485 3300005262 Ga0065165_1007800 Ga0065165_10078005 318
486 3300005456 Ga0070678_100043273 Ga0070678_1000432734 318
487 3300005459 Ga0068867_100033126 Ga0068867_1000331261 318
488 3300006846 Ga0075430_100000003 Ga0075430_10000000393 318
489 3300012502 Ga0157347_1001465 Ga0157347_10014652 318
490 3300014325 Ga0163163_10255097 Ga0163163_102550971 318
491 3300014497 Ga0182008_10125522 Ga0182008_101255221 318
492 3300015261 Ga0182006_1054407 Ga0182006_10544071 318
493 3300017792 Ga0163161_10000162 Ga0163161_1000016239 318
494 3300025284 Ga0209130_1004592 Ga0209130_10045925 318
495 3300025291 Ga0209675_1001656 Ga0209675_10016563 318
496 3300025298 Ga0209050_1011058 Ga0209050_10110583 318
497 3300025302 Ga0207426_1008494 Ga0207426_10084945 318
498 3300025923 Ga0207681_10012605 Ga0207681_100126053 318
499 3300026121 Ga0207683_10020918 Ga0207683_100209186 318
500 3300031911 Ga0307412_10080912 Ga0307412_100809122 318
501 3300046515 Ga0495620_0005458 Ga0495620_0005458_206_1198 318
502 3300046692 Ga0495671_0009248 Ga0495671_0009248_2349_3341 318
503 3300047321 Ga0495676_0024069 Ga0495676_0024069_2427_3416 318
504 3300047673 Ga0495593_0003390 Ga0495593_0003390_184_1173 318
505 3300048089 Ga0495614_0013538 Ga0495614_0013538_1351_2340 318
506 3300048909 Ga0496106_0009138 Ga0496106_0009138_1906_2898 318
507 3300048919 Ga0496116_0123855 Ga0496116_0123855_381_1370 318
508 3300048920 Ga0496117_0010676 Ga0496117_0010676_6200_7189 318
509 3300048924 Ga0496121_0088621 Ga0496121_0088621_224_1213 318
510 3300048925 Ga0496122_0000039 Ga0496122_0000039_14710_15714 318
511 3300048925 Ga0496122_0082864 Ga0496122_0082864_797_1786 318
512 3300048926 Ga0496123_0000026 Ga0496123_0000026_14806_15810 318
513 3300049537 Ga0501321_002860 Ga0501321_002860_369_1352 318
514 3300050509 nmdc:mga0qj67_5_c1 nmdc:mga0qj67_5_c1_33085_34092 318
515 3300053079 Ga0500610_0000175 Ga0500610_0000175_17578_18567 318
516 3300053079 Ga0500610_0054529 Ga0500610_0054529_396_1385 318
517 3300053086 Ga0500578_0016250 Ga0500578_0016250_480_1472 318
518 3300053087 Ga0500643_019032 Ga0500643_019032_796_1785 318
519 3300053093 Ga0500651_0058311 Ga0500651_0058311_694_1683 318
520 3300053094 Ga0500566_0037643 Ga0500566_0037643_1082_2071 318
521 3300053096 Ga0500641_0110044 Ga0500641_0110044_128_1117 318
522 3300053110 Ga0500571_000041 Ga0500571_000041_1031_2020 318
523 3300053117 Ga0500593_000045 Ga0500593_000045_20166_21158 318
524 3300053121 Ga0500607_000934 Ga0500607_000934_26699_27691 318
525 3300053125 Ga0500618_010160 Ga0500618_010160_1029_2018 318
526 3300053133 Ga0500655_000865 Ga0500655_000865_2985_3974 318
527 3300053134 Ga0500658_0000614 Ga0500658_0000614_9552_10541 318
528 3300053137 Ga0500561_0012300 Ga0500561_0012300_798_1787 318
529 3300053138 Ga0500564_048514 Ga0500564_048514_533_1522 318
530 3300053141 Ga0500574_006956 Ga0500574_006956_356_1345 318
531 3300053157 Ga0500624_006562 Ga0500624_006562_304_1293 318
532 3300053158 Ga0500627_0001973 Ga0500627_0001973_1244_2236 318
533 3300053161 Ga0500634_0023017 Ga0500634_0023017_2197_3186 318
534 3300053161 Ga0500634_0053394 Ga0500634_0053394_101_1090 318
535 3300053162 Ga0500638_014236 Ga0500638_014236_1072_2061 318
536 iso_pu_bacteria 2738541307 2738881095 318
537 iso_pu_bacteria 2842733646 2842736693 318
538 iso_pu_bacteria 2842747753 2842750320 318
539 iso_pu_bacteria 2945909444 2945911093 318
540 iso_pu_bacteria 2945984333 2945986607 318
541 3300006042 Ga0075368_10081726 Ga0075368_100817262 319
542 3300006177 Ga0075362_10110720 Ga0075362_101107202 319
543 3300025901 Ga0207688_10027637 Ga0207688_100276372 319
544 3300047472 Ga0495686_0005034 Ga0495686_0005034_4186_5187 319
545 3300015683 Ga0183362_10010 Ga0183362_1001026 320
546 3300028794 Ga0307515_10098521 Ga0307515_100985213 320
547 3300050489 nmdc:mga03683_4623_c2 nmdc:mga03683_4623_c2_1927_2970 320
548 3300050491 nmdc:mga00v17_4493_c1 nmdc:mga00v17_4493_c1_2171_3217 320
549 3300050492 nmdc:mga0yw44_90600_c1 nmdc:mga0yw44_90600_c1_334_1380 320
550 3300053080 Ga0500635_0003069 Ga0500635_0003069_1002_2003 320
551 3300053108 Ga0500562_012500 Ga0500562_012500_678_1679 320
552 3300013104 Ga0157370_10244187 Ga0157370_102441872 321
553 3300032002 Ga0307416_100013165 Ga0307416_1000131654 321
554 3300025901 Ga0207688_10067248 Ga0207688_100672482 322
555 iso_pu_bacteria 2904479285 2904482189 322
556 3300002704 JGI25155J39150_1000062 JGI25155J39150_10000627 324
557 3300002705 JGI25156J39149_1000012 JGI25156J39149_1000012111 324
558 3300002738 JGI25154J39366_1000029 JGI25154J39366_100002960 324
559 3300002741 JGI25157J39369_1000014 JGI25157J39369_1000014111 324
560 3300003187 JGI25151J46595_10004683 JGI25151J46595_100046837 324
561 3300005262 Ga0065165_1031593 Ga0065165_10315932 324
562 3300025206 Ga0209435_100002 Ga0209435_100002514 324
563 3300025246 Ga0209646_1000001 Ga0209646_10000012657 324
564 3300025250 Ga0209026_1000040 Ga0209026_1000040118 324
565 3300025256 Ga0209759_1000001 Ga0209759_10000012288 324
566 3300025258 Ga0209129_1009567 Ga0209129_10095671 324
567 3300025292 Ga0209676_1004754 Ga0209676_10047544 324
568 3300025294 Ga0209025_1001126 Ga0209025_100112620 324
569 3300025295 Ga0209564_1013125 Ga0209564_10131253 324
570 3300025298 Ga0209050_1007601 Ga0209050_10076014 324
571 3300025304 Ga0209257_1011698 Ga0209257_10116983 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

95

368

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9489 32 324
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9461 29 322
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9451 28 324
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9331 28 324
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9324 29 322
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9638 126 248 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9487 126 248 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9375 126 241 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9305 29 324 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9252 29 324 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A6P2E0C5-F1-model_v4 Argininosuccinate lyase 0.9702 19 324 GO:0016829
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9636 54 321
AF-A0A4P7LJW2-F1-model_v4 TTT family tricarboxylate transporter receptor protein 0.9633 54 322
AF-V8QW12-F1-model_v4 ABC transporter substrate-binding protein 0.9621 37 324
AF-A0A1B2R9E2-F1-model_v4 LacI family transcriptional regulator 0.962 20 322

Feature Viewer

pLDDT pTM Quality
90.86 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map