F464975

General Info

Members Datasets Scaffolds Average Seq Length
571 230 1142 299

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0822353|Ga0436365_0822353_23112_24059
Length 315
Sequence MTEKQKAGVGRGAAKAGAPDIVIITGLSGSGMSSATNAFEDLGYFCVDNLPLTLMPTFGRLVQPEEHNRPHIERAALVVDIREGRFLSEFPARLRELRASGLRVYVLFFEASDEVLVRRFSETRRPHPADDGDGLLESIRRERRAMSEIRQLADQVIDTSGHTVHTLRRLLIERFGGEDGATMRVQVYSFGYKHGSPHDVDLLFDVRHLPNPHFVPELRALSGHDPRIVKYLMASDEVRETLRRFTELIDYLLPLYRREGKSYVTIGIGCTGGRHRSVMAANYIARHLRRGGYEAAAVHRDVSKTKRRKAVGSKQ

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
207 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
211 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
214 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
215 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
216 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
217 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
220 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
221 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
222 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.4
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 26.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0822353 3300039437 Bacteria 103701
2 MBSR1b_contig_9672989 2162886012 Bacteria 1425
3 JGI24748J21848_1000003 3300002074 Bacteria 323921
4 JGI24034J26672_10000005 3300002239 Bacteria 404185
5 JGI24751J29686_10000198 3300002459 Bacteria 26464
6 Ga0065714_10064448 3300005288 Bacteria 81247
7 Ga0065704_10080346 3300005289 Bacteria 3965
8 Ga0065704_10136416 3300005289 Unclassified 1566
9 Ga0065712_10000125 3300005290 Bacteria 81248
10 Ga0065712_10008629 3300005290 Bacteria 2381
11 Ga0065712_10107106 3300005290 Bacteria 1903
12 Ga0065715_10003227 3300005293 Bacteria 5387
13 Ga0065715_10091924 3300005293 Bacteria 5441
14 Ga0065715_10143240 3300005293 Bacteria 1823
15 Ga0065715_10194380 3300005293 Unclassified 1396
16 Ga0065707_10000983 3300005295 Bacteria 12505
17 Ga0065707_10005912 3300005295 Unclassified 3706
18 Ga0070690_100006341 3300005330 Bacteria 6706
19 Ga0070690_100025432 3300005330 Bacteria 3646
20 Ga0070690_100047456 3300005330 Bacteria 2732
21 Ga0070670_100000098 3300005331 Bacteria 80608
22 Ga0070670_100081742 3300005331 Bacteria 2776
23 Ga0070670_100392389 3300005331 Unclassified 1224
24 Ga0068869_100001546 3300005334 Bacteria 13672
25 Ga0068869_100041382 3300005334 Bacteria 3300
26 Ga0068869_100161001 3300005334 Unclassified 1747
27 Ga0068869_100177228 3300005334 Bacteria 1669
28 Ga0068869_100193363 3300005334 Unclassified 1601
29 Ga0070666_10065696 3300005335 Bacteria 2462
30 Ga0070680_100000085 3300005336 Bacteria 51915
31 Ga0070680_100309812 3300005336 Bacteria 1339
32 Ga0070682_100009737 3300005337 Bacteria 5441
33 Ga0070682_100016101 3300005337 Unclassified 4344
34 Ga0070682_100221751 3300005337 Unclassified 1346
35 Ga0068868_100014103 3300005338 Bacteria 5883
36 Ga0070660_100051002 3300005339 Unclassified 3185
37 Ga0070689_100000888 3300005340 Bacteria 18656
38 Ga0070689_100042317 3300005340 Bacteria 3497
39 Ga0070689_100473718 3300005340 Unclassified 1069
40 Ga0070687_100011951 3300005343 Bacteria 3816
41 Ga0070687_100039528 3300005343 Unclassified 2371
42 Ga0070687_100114208 3300005343 Unclassified 1534
43 Ga0070661_100117101 3300005344 Bacteria 1993
44 Ga0070692_10002979 3300005345 Bacteria 6738
45 Ga0070692_10004226 3300005345 Bacteria 5958
46 Ga0070668_100005005 3300005347 Bacteria 9818
47 Ga0070669_100024722 3300005353 Unclassified 4309
48 Ga0070669_100044047 3300005353 Bacteria 3252
49 Ga0070669_100104690 3300005353 Bacteria 2139
50 Ga0070671_100004102 3300005355 Bacteria 11501
51 Ga0070671_100074589 3300005355 Unclassified 2834
52 Ga0070671_100113725 3300005355 Unclassified 2275
53 Ga0070673_100120210 3300005364 Bacteria 2190
54 Ga0070673_100158426 3300005364 Bacteria 1923
55 Ga0070673_100283192 3300005364 Bacteria 1454
56 Ga0070659_100001315 3300005366 Bacteria 18003
57 Ga0070667_100011106 3300005367 Bacteria 7450
58 Ga0070667_100034698 3300005367 Unclassified 4223
59 Ga0070703_10000268 3300005406 Bacteria 24855
60 Ga0070703_10007708 3300005406 Unclassified 3026
61 Ga0070701_10031180 3300005438 Bacteria 2644
62 Ga0070701_10060154 3300005438 Bacteria 1999
63 Ga0070705_100027607 3300005440 Unclassified 3101
64 Ga0070705_100068114 3300005440 Bacteria 2141
65 Ga0070700_100000227 3300005441 Bacteria 31044
66 Ga0070700_100014560 3300005441 Unclassified 4442
67 Ga0070700_100017916 3300005441 Bacteria 4061
68 Ga0070700_100084453 3300005441 Bacteria 2058
69 Ga0070700_100309125 3300005441 Unclassified 1157
70 Ga0070694_100001061 3300005444 Bacteria 15693
71 Ga0070694_100004594 3300005444 Bacteria 8304
72 Ga0070694_100014087 3300005444 Bacteria 5004
73 Ga0070694_100022917 3300005444 Bacteria 4008
74 Ga0070694_100064963 3300005444 Bacteria 2499
75 Ga0070694_100233583 3300005444 Bacteria 1384
76 Ga0070694_100257811 3300005444 Bacteria 1321
77 Ga0070708_100000653 3300005445 Bacteria 26247
78 Ga0070708_100224226 3300005445 Bacteria 1763
79 Ga0070662_100032233 3300005457 Unclassified 3682
80 Ga0070662_100201387 3300005457 Unclassified 1580
81 Ga0070662_100221637 3300005457 Bacteria 1509
82 Ga0070681_10000189 3300005458 Bacteria 47802
83 Ga0070681_10012299 3300005458 Bacteria 8488
84 Ga0070681_10020660 3300005458 Bacteria 6597
85 Ga0070681_10183902 3300005458 Bacteria 2011
86 Ga0068867_100142066 3300005459 Bacteria 1877
87 Ga0068867_100181604 3300005459 Bacteria 1673
88 Ga0068867_100205436 3300005459 Bacteria 1579
89 Ga0070706_100000032 3300005467 Bacteria 152892
90 Ga0070706_100004498 3300005467 Bacteria 13439
91 Ga0070706_100008242 3300005467 Bacteria 9720
92 Ga0070706_100028437 3300005467 Bacteria 5146
93 Ga0070707_100016360 3300005468 Bacteria 6961
94 Ga0070707_100020360 3300005468 Bacteria 6257
95 Ga0070698_100006414 3300005471 Bacteria 12761
96 Ga0070698_100009821 3300005471 Bacteria 10228
97 Ga0070698_100017204 3300005471 Bacteria 7618
98 Ga0070698_100017445 3300005471 Bacteria 7567
99 Ga0070698_100064382 3300005471 Unclassified 3694
100 Ga0070699_100017621 3300005518 Bacteria 6131
101 Ga0070699_100063689 3300005518 Bacteria 3197
102 Ga0070699_100326669 3300005518 Unclassified 1379
103 Ga0070679_100001869 3300005530 Bacteria 18946
104 Ga0070679_100021064 3300005530 Bacteria 6361
105 Ga0070679_100193665 3300005530 Bacteria 2001
106 Ga0070697_100001100 3300005536 Bacteria 20417
107 Ga0070697_100001819 3300005536 Bacteria 16294
108 Ga0070697_100007762 3300005536 Bacteria 8353
109 Ga0070697_100047692 3300005536 Bacteria 3473
110 Ga0070697_100089584 3300005536 Bacteria 2542
111 Ga0070697_100372653 3300005536 Bacteria 1235
112 Ga0068853_100153733 3300005539 Unclassified 2072
113 Ga0068853_100210108 3300005539 Unclassified 1774
114 Ga0068853_100453997 3300005539 Bacteria 1206
115 Ga0068853_100574740 3300005539 Bacteria 1069
116 Ga0070672_100048965 3300005543 Bacteria 3286
117 Ga0070672_100438263 3300005543 Bacteria 1124
118 Ga0070686_100004978 3300005544 Bacteria 7330
119 Ga0070686_100005424 3300005544 Bacteria 7060
120 Ga0070695_100007984 3300005545 Bacteria 6270
121 Ga0070695_100010744 3300005545 Bacteria 5470
122 Ga0070695_100016721 3300005545 Bacteria 4442
123 Ga0070695_100167912 3300005545 Bacteria 1546
124 Ga0070695_100173470 3300005545 Unclassified 1523
125 Ga0070695_100392634 3300005545 Unclassified 1050
126 Ga0070696_100038580 3300005546 Bacteria 3297
127 Ga0070696_100044416 3300005546 Bacteria 3077
128 Ga0070696_100069230 3300005546 Bacteria 2479
129 Ga0070696_100099227 3300005546 Bacteria 2084
130 Ga0070696_100112443 3300005546 Unclassified 1962
131 Ga0070696_100129436 3300005546 Unclassified 1835
132 Ga0070696_100236371 3300005546 Bacteria 1376
133 Ga0070693_100004827 3300005547 Bacteria 6427
134 Ga0070693_100070606 3300005547 Unclassified 2055
135 Ga0070693_100070766 3300005547 Bacteria 2053
136 Ga0070693_100074039 3300005547 Bacteria 2013
137 Ga0070693_100163536 3300005547 Bacteria 1419
138 Ga0070665_100155226 3300005548 Unclassified 2291
139 Ga0070704_100014443 3300005549 Bacteria 4934
140 Ga0068855_100215802 3300005563 Bacteria 2154
141 Ga0070664_100011559 3300005564 Bacteria 7163
142 Ga0070664_100157332 3300005564 Bacteria 2008
143 Ga0070664_100378334 3300005564 Unclassified 1292
144 Ga0068857_100208047 3300005577 Bacteria 1785
145 Ga0068854_100062892 3300005578 Bacteria 2693
146 Ga0068854_100165872 3300005578 Bacteria 1715
147 Ga0068854_100181540 3300005578 Bacteria 1644
148 Ga0070702_100017299 3300005615 Unclassified 3716
149 Ga0070702_100033442 3300005615 Unclassified 2827
150 Ga0070702_100061046 3300005615 Unclassified 2194
151 Ga0070702_100239095 3300005615 Bacteria 1225
152 Ga0068852_100034356 3300005616 Bacteria 4218
153 Ga0068852_100171576 3300005616 Unclassified 2034
154 Ga0068852_100286647 3300005616 Bacteria 1589
155 Ga0068859_100015044 3300005617 Bacteria 7769
156 Ga0068859_100018662 3300005617 Bacteria 6972
157 Ga0068859_100069051 3300005617 Bacteria 3568
158 Ga0068859_100097295 3300005617 Unclassified 2996
159 Ga0068859_100300188 3300005617 Bacteria 1699
160 Ga0068859_100322471 3300005617 Unclassified 1639
161 Ga0068859_100460513 3300005617 Unclassified 1368
162 Ga0068859_100544893 3300005617 Bacteria 1255
163 Ga0068859_100673160 3300005617 Bacteria 1126
164 Ga0068864_100046156 3300005618 Bacteria 3737
165 Ga0068864_100090267 3300005618 Unclassified 2701
166 Ga0068864_100144303 3300005618 Bacteria 2150
167 Ga0068864_100177377 3300005618 Unclassified 1946
168 Ga0068864_100290681 3300005618 Bacteria 1528
169 Ga0068866_10037109 3300005718 Bacteria 2392
170 Ga0068861_100005263 3300005719 Bacteria 8723
171 Ga0068861_100012032 3300005719 Bacteria 6027
172 Ga0068861_100039309 3300005719 Bacteria 3529
173 Ga0068861_100298885 3300005719 Unclassified 1393
174 Ga0068851_10000786 3300005834 Bacteria 13677
175 Ga0068870_10032313 3300005840 Bacteria 2659
176 Ga0068870_10038990 3300005840 Unclassified 2456
177 Ga0068870_10044540 3300005840 Bacteria 2319
178 Ga0068870_10287016 3300005840 Unclassified 1034
179 Ga0068863_100014605 3300005841 Bacteria 7560
180 Ga0068863_100027481 3300005841 Bacteria 5427
181 Ga0068858_100000026 3300005842 Bacteria 153013
182 Ga0068858_100031528 3300005842 Bacteria 4924
183 Ga0068858_100067293 3300005842 Unclassified 3317
184 Ga0068858_100106165 3300005842 Bacteria 2621
185 Ga0068858_100124224 3300005842 Bacteria 2416
186 Ga0068858_100171397 3300005842 Bacteria 2046
187 Ga0068858_100356972 3300005842 Unclassified 1400
188 Ga0068858_100663296 3300005842 Bacteria 1014
189 Ga0068860_100008037 3300005843 Bacteria 10518
190 Ga0068860_100089974 3300005843 Bacteria 2923
191 Ga0068860_100157294 3300005843 Bacteria 2190
192 Ga0068860_100346038 3300005843 Bacteria 1462
193 Ga0068862_100003684 3300005844 Bacteria 13107
194 Ga0068862_100043301 3300005844 Unclassified 3837
195 Ga0068862_100080750 3300005844 Bacteria 2820
196 Ga0081539_10000119 3300005985 Bacteria 184136
197 Ga0081539_10000145 3300005985 Bacteria 165008
198 Ga0081539_10007215 3300005985 Bacteria 10224
199 Ga0081539_10116695 3300005985 Bacteria 1333
200 Ga0070716_100024237 3300006173 Bacteria 3228
201 Ga0097621_100080442 3300006237 Unclassified 2710
202 Ga0068871_100052761 3300006358 Bacteria 3294
203 Ga0075428_100070966 3300006844 Unclassified 3808
204 Ga0075428_100302924 3300006844 Bacteria 1718
205 Ga0075433_10016646 3300006852 Bacteria 6066
206 Ga0075433_10020848 3300006852 Bacteria 5486
207 Ga0075433_10043802 3300006852 Bacteria 3886
208 Ga0075433_10155877 3300006852 Bacteria 2032
209 Ga0075434_100131417 3300006871 Bacteria 2523
210 Ga0075434_100278280 3300006871 Bacteria 1693
211 Ga0075434_100430821 3300006871 Unclassified 1340
212 Ga0075429_100023714 3300006880 Bacteria 5324
213 Ga0075429_100139373 3300006880 Unclassified 2123
214 Ga0068865_100008436 3300006881 Bacteria 6371
215 Ga0068865_100145382 3300006881 Unclassified 1793
216 Ga0075436_100000011 3300006914 Bacteria 208094
217 Ga0075436_100014526 3300006914 Bacteria 5396
218 Ga0097620_100015044 3300006931 Bacteria 7769
219 Ga0097620_100018662 3300006931 Bacteria 6972
220 Ga0097620_100069055 3300006931 Bacteria 3568
221 Ga0097620_100097293 3300006931 Unclassified 2996
222 Ga0097620_100300195 3300006931 Bacteria 1699
223 Ga0097620_100322481 3300006931 Unclassified 1639
224 Ga0097620_100460536 3300006931 Unclassified 1368
225 Ga0097620_100544899 3300006931 Bacteria 1255
226 Ga0097620_100673164 3300006931 Bacteria 1126
227 Ga0075435_100000627 3300007076 Bacteria 21654
228 Ga0075435_100019089 3300007076 Bacteria 5226
229 Ga0075435_100150231 3300007076 Bacteria 1958
230 Ga0075435_100171216 3300007076 Bacteria 1832
231 Ga0099794_10001794 3300007265 Bacteria 7660
232 Ga0099794_10037503 3300007265 Unclassified 2295
233 Ga0105250_10059376 3300009092 Bacteria 1536
234 Ga0105240_10246773 3300009093 Unclassified 2067
235 Ga0105240_10343624 3300009093 Unclassified 1694
236 Ga0111539_10001485 3300009094 Bacteria 31320
237 Ga0111539_10040331 3300009094 Bacteria 5622
238 Ga0105245_10033485 3300009098 Bacteria 4555
239 Ga0105247_10000033 3300009101 Bacteria 184433
240 Ga0105247_10018053 3300009101 Bacteria 4231
241 Ga0114129_10009360 3300009147 Bacteria 13968
242 Ga0114129_10010245 3300009147 Bacteria 13373
243 Ga0114129_10011128 3300009147 Bacteria 12824
244 Ga0114129_10018423 3300009147 Bacteria 9944
245 Ga0114129_10208633 3300009147 Unclassified 2642
246 Ga0114129_10618927 3300009147 Bacteria 1401
247 Ga0114129_10821660 3300009147 Bacteria 1184
248 Ga0105243_10000107 3300009148 Bacteria 95426
249 Ga0105243_10014719 3300009148 Bacteria 5918
250 Ga0105243_10190612 3300009148 Bacteria 1790
251 Ga0105243_10221528 3300009148 Bacteria 1673
252 Ga0105243_10231920 3300009148 Unclassified 1638
253 Ga0105241_10071009 3300009174 Bacteria 2703
254 Ga0105241_10098397 3300009174 Bacteria 2321
255 Ga0105242_10000516 3300009176 Bacteria 30338
256 Ga0105242_10001164 3300009176 Bacteria 20704
257 Ga0105242_10005344 3300009176 Bacteria 9928
258 Ga0105242_10017913 3300009176 Bacteria 5530
259 Ga0105242_10097040 3300009176 Bacteria 2491
260 Ga0105242_10130195 3300009176 Unclassified 2171
261 Ga0105242_10192481 3300009176 Bacteria 1807
262 Ga0105248_10008264 3300009177 Bacteria 11435
263 Ga0105248_10047139 3300009177 Viruses 4832
264 Ga0105248_10079546 3300009177 Bacteria 3684
265 Ga0105248_10092246 3300009177 Bacteria 3411
266 Ga0105248_10104728 3300009177 Bacteria 3190
267 Ga0105248_10146994 3300009177 Unclassified 2660
268 Ga0105248_10244749 3300009177 Bacteria 2019
269 Ga0105248_10292492 3300009177 Unclassified 1834
270 Ga0105237_10000839 3300009545 Bacteria 42008
271 Ga0105237_10116054 3300009545 Bacteria 2671
272 Ga0105237_10216256 3300009545 Bacteria 1916
273 Ga0105238_10017033 3300009551 Bacteria 7377
274 Ga0105238_10035475 3300009551 Bacteria 5070
275 Ga0105249_10024715 3300009553 Bacteria 5401
276 Ga0105249_10029218 3300009553 Bacteria 4978
277 Ga0105249_10112111 3300009553 Bacteria 2579
278 Ga0105249_10219288 3300009553 Unclassified 1871
279 Ga0105249_10282165 3300009553 Bacteria 1659
280 Ga0105239_10008406 3300010375 Bacteria 11751
281 Ga0105239_10059519 3300010375 Unclassified 4192
282 Ga0105239_10099970 3300010375 Bacteria 3207
283 Ga0105246_10038593 3300011119 Unclassified 3213
284 Ga0105246_10042617 3300011119 Bacteria 3074
285 Ga0105246_10265749 3300011119 Unclassified 1369
286 Ga0157373_10018787 3300013100 Bacteria 5030
287 Ga0157373_10043543 3300013100 Bacteria 3207
288 Ga0157374_10059176 3300013296 Bacteria 3581
289 Ga0157378_10000011 3300013297 Bacteria 158889
290 Ga0157378_10003909 3300013297 Bacteria 13200
291 Ga0157378_10019498 3300013297 Bacteria 5962
292 Ga0157378_10022997 3300013297 Bacteria 5487
293 Ga0157378_10090809 3300013297 Unclassified 2776
294 Ga0157378_10192383 3300013297 Bacteria 1925
295 Ga0163162_10000039 3300013306 Bacteria 137338
296 Ga0163162_10005864 3300013306 Bacteria 11888
297 Ga0163162_10015731 3300013306 Bacteria 7394
298 Ga0163162_10036438 3300013306 Bacteria 4903
299 Ga0163162_10087672 3300013306 Bacteria 3191
300 Ga0163162_10198816 3300013306 Bacteria 2133
301 Ga0157375_10013982 3300013308 Bacteria 7156
302 Ga0157375_10041573 3300013308 Bacteria 4440
303 Ga0157375_10656494 3300013308 Bacteria 1205
304 Ga0163163_10000669 3300014325 Bacteria 29324
305 Ga0163163_10005113 3300014325 Bacteria 11311
306 Ga0163163_10006079 3300014325 Bacteria 10505
307 Ga0163163_10015633 3300014325 Bacteria 7023
308 Ga0163163_10064508 3300014325 Bacteria 3634
309 Ga0163163_10165948 3300014325 Bacteria 2254
310 Ga0163163_10253233 3300014325 Unclassified 1811
311 Ga0163163_10295602 3300014325 Unclassified 1672
312 Ga0157380_10001254 3300014326 Bacteria 16484
313 Ga0157380_10001303 3300014326 Bacteria 16215
314 Ga0157380_10015533 3300014326 Bacteria 5597
315 Ga0157380_10072366 3300014326 Bacteria 2792
316 Ga0157380_10079528 3300014326 Bacteria 2678
317 Ga0157377_10022864 3300014745 Bacteria 3307
318 Ga0157379_10036929 3300014968 Unclassified 4356
319 Ga0157379_10218793 3300014968 Unclassified 1725
320 Ga0157376_10033070 3300014969 Bacteria 4159
321 Ga0157376_10140317 3300014969 Archaea 2167
322 Ga0163161_10106682 3300017792 Unclassified 2090
323 Ga0213876_10000022 3300021384 Bacteria 259520
324 Ga0213876_10002606 3300021384 Bacteria 10543
325 Ga0207672_1000910 3300025223 Unclassified 2962
326 Ga0207656_10003196 3300025321 Bacteria 5600
327 Ga0207653_10000019 3300025885 Bacteria 138019
328 Ga0207653_10003835 3300025885 Bacteria 4733
329 Ga0207642_10006966 3300025899 Bacteria 3789
330 Ga0207710_10000001 3300025900 Bacteria 1797433
331 Ga0207710_10016905 3300025900 Unclassified 3089
332 Ga0207688_10243126 3300025901 Unclassified 1089
333 Ga0207647_10007114 3300025904 Bacteria 8113
334 Ga0207647_10082106 3300025904 Bacteria 1931
335 Ga0207645_10026240 3300025907 Bacteria 3765
336 Ga0207643_10004099 3300025908 Bacteria 7842
337 Ga0207643_10022061 3300025908 Bacteria 3504
338 Ga0207643_10027865 3300025908 Bacteria 3135
339 Ga0207643_10035324 3300025908 Unclassified 2802
340 Ga0207643_10059821 3300025908 Unclassified 2174
341 Ga0207643_10278296 3300025908 Unclassified 1037
342 Ga0207684_10001147 3300025910 Bacteria 29558
343 Ga0207684_10003682 3300025910 Bacteria 14861
344 Ga0207684_10023644 3300025910 Bacteria 5246
345 Ga0207684_10027155 3300025910 Unclassified 4881
346 Ga0207684_10039171 3300025910 Bacteria 4021
347 Ga0207654_10037822 3300025911 Bacteria 2703
348 Ga0207654_10065701 3300025911 Bacteria 2137
349 Ga0207654_10284697 3300025911 Bacteria 1119
350 Ga0207707_10000218 3300025912 Bacteria 61709
351 Ga0207707_10006026 3300025912 Bacteria 10608
352 Ga0207707_10151348 3300025912 Unclassified 2028
353 Ga0207695_10141980 3300025913 Bacteria 2349
354 Ga0207671_10008859 3300025914 Bacteria 8473
355 Ga0207671_10209832 3300025914 Bacteria 1523
356 Ga0207660_10000580 3300025917 Bacteria 24630
357 Ga0207660_10260408 3300025917 Bacteria 1371
358 Ga0207662_10001566 3300025918 Bacteria 11188
359 Ga0207662_10035967 3300025918 Bacteria 2894
360 Ga0207662_10062394 3300025918 Bacteria 2239
361 Ga0207657_10029024 3300025919 Bacteria 5041
362 Ga0207649_10006263 3300025920 Bacteria 6464
363 Ga0207649_10265946 3300025920 Bacteria 1241
364 Ga0207652_10000066 3300025921 Bacteria 110924
365 Ga0207652_10053454 3300025921 Bacteria 3469
366 Ga0207652_10353787 3300025921 Unclassified 1326
367 Ga0207646_10033554 3300025922 Bacteria 4643
368 Ga0207646_10108810 3300025922 Unclassified 2487
369 Ga0207681_10022423 3300025923 Bacteria 4027
370 Ga0207681_10025911 3300025923 Unclassified 3777
371 Ga0207681_10226383 3300025923 Bacteria 1449
372 Ga0207694_10032063 3300025924 Bacteria 4020
373 Ga0207650_10000156 3300025925 Bacteria 81983
374 Ga0207650_10035526 3300025925 Bacteria 3620
375 Ga0207650_10187539 3300025925 Unclassified 1651
376 Ga0207659_10115092 3300025926 Bacteria 2051
377 Ga0207659_10427826 3300025926 Unclassified 1111
378 Ga0207644_10001394 3300025931 Bacteria 15583
379 Ga0207644_10011617 3300025931 Bacteria 5831
380 Ga0207644_10107904 3300025931 Bacteria 2101
381 Ga0207690_10022239 3300025932 Unclassified 3942
382 Ga0207706_10168330 3300025933 Unclassified 1926
383 Ga0207686_10000015 3300025934 Bacteria 202118
384 Ga0207686_10000117 3300025934 Bacteria 64560
385 Ga0207686_10000710 3300025934 Bacteria 20673
386 Ga0207686_10044652 3300025934 Bacteria 2722
387 Ga0207686_10096274 3300025934 Bacteria 1966
388 Ga0207686_10183828 3300025934 Bacteria 1484
389 Ga0207709_10000043 3300025935 Bacteria 248179
390 Ga0207709_10010103 3300025935 Bacteria 5198
391 Ga0207709_10101653 3300025935 Bacteria 1902
392 Ga0207709_10279848 3300025935 Bacteria 1232
393 Ga0207670_10001499 3300025936 Bacteria 12273
394 Ga0207704_10012005 3300025938 Bacteria 4285
395 Ga0207665_10015355 3300025939 Bacteria 5028
396 Ga0207665_10016474 3300025939 Unclassified 4853
397 Ga0207665_10197798 3300025939 Unclassified 1463
398 Ga0207691_10005174 3300025940 Bacteria 12591
399 Ga0207711_10008895 3300025941 Bacteria 8396
400 Ga0207711_10020100 3300025941 Bacteria 5564
401 Ga0207711_10031632 3300025941 Unclassified 4468
402 Ga0207689_10011505 3300025942 Bacteria 7583
403 Ga0207689_10052684 3300025942 Unclassified 3352
404 Ga0207689_10088536 3300025942 Bacteria 2543
405 Ga0207689_10232525 3300025942 Bacteria 1523
406 Ga0207689_10342226 3300025942 Bacteria 1242
407 Ga0207679_10028254 3300025945 Unclassified 3889
408 Ga0207679_10121255 3300025945 Bacteria 2082
409 Ga0207667_10178851 3300025949 Bacteria 2179
410 Ga0207667_10292664 3300025949 Bacteria 1664
411 Ga0207651_10051507 3300025960 Bacteria 2802
412 Ga0207651_10065143 3300025960 Bacteria 2554
413 Ga0207651_10078994 3300025960 Bacteria 2362
414 Ga0207651_10093005 3300025960 Unclassified 2213
415 Ga0207651_10362376 3300025960 Unclassified 1224
416 Ga0207651_10619429 3300025960 Bacteria 948
417 Ga0207712_10000184 3300025961 Bacteria 64460
418 Ga0207712_10013750 3300025961 Bacteria 5192
419 Ga0207712_10063102 3300025961 Bacteria 2636
420 Ga0207712_10086204 3300025961 Bacteria 2300
421 Ga0207712_10132514 3300025961 Unclassified 1901
422 Ga0207668_10065007 3300025972 Unclassified 2580
423 Ga0207640_10052734 3300025981 Unclassified 2651
424 Ga0207640_10426051 3300025981 Unclassified 1087
425 Ga0207677_10102272 3300026023 Bacteria 2112
426 Ga0207677_10273806 3300026023 Unclassified 1382
427 Ga0207703_10000110 3300026035 Bacteria 96947
428 Ga0207703_10094899 3300026035 Bacteria 2515
429 Ga0207703_10297779 3300026035 Unclassified 1470
430 Ga0207703_10363718 3300026035 Unclassified 1335
431 Ga0207639_10126215 3300026041 Unclassified 2111
432 Ga0207639_10289034 3300026041 Bacteria 1445
433 Ga0207708_10000031 3300026075 Bacteria 155478
434 Ga0207708_10008358 3300026075 Bacteria 7665
435 Ga0207708_10015210 3300026075 Bacteria 5769
436 Ga0207708_10040910 3300026075 Bacteria 3535
437 Ga0207708_10042431 3300026075 Bacteria 3468
438 Ga0207708_10049255 3300026075 Unclassified 3207
439 Ga0207708_10132407 3300026075 Bacteria 1950
440 Ga0207702_10286451 3300026078 Bacteria 1559
441 Ga0207641_10012657 3300026088 Bacteria 6917
442 Ga0207641_10065316 3300026088 Bacteria 3113
443 Ga0207641_10468513 3300026088 Bacteria 1220
444 Ga0207676_10002306 3300026095 Bacteria 13696
445 Ga0207676_10012705 3300026095 Bacteria 6039
446 Ga0207676_10027801 3300026095 Unclassified 4217
447 Ga0207676_10074979 3300026095 Bacteria 2727
448 Ga0207676_10107253 3300026095 Unclassified 2329
449 Ga0207676_10244143 3300026095 Bacteria 1613
450 Ga0207676_10295727 3300026095 Bacteria 1476
451 Ga0207676_10364992 3300026095 Unclassified 1339
452 Ga0207674_10000006 3300026116 Bacteria 233530
453 Ga0207674_10199088 3300026116 Unclassified 1953
454 Ga0207674_10288958 3300026116 Bacteria 1588
455 Ga0207674_10468366 3300026116 Bacteria 1218
456 Ga0207675_100000348 3300026118 Bacteria 44204
457 Ga0207675_100004337 3300026118 Bacteria 13705
458 Ga0207675_100010500 3300026118 Bacteria 8676
459 Ga0207675_100025927 3300026118 Bacteria 5455
460 Ga0207675_100048726 3300026118 Bacteria 3954
461 Ga0207675_100102483 3300026118 Bacteria 2697
462 Ga0207675_100155136 3300026118 Bacteria 2182
463 Ga0207683_10043181 3300026121 Bacteria 3939
464 Ga0207698_10065068 3300026142 Bacteria 2861
465 Ga0209588_1005810 3300027671 Unclassified 3553
466 Ga0207428_10013603 3300027907 Bacteria 7101
467 Ga0207428_10034327 3300027907 Bacteria 4158
468 Ga0207428_10130612 3300027907 Bacteria 1922
469 Ga0268265_10035365 3300028380 Unclassified 3649
470 Ga0268264_10033138 3300028381 Bacteria 4242
471 Ga0268264_10056815 3300028381 Bacteria 3272
472 Ga0268264_10121831 3300028381 Bacteria 2299
473 Ga0268264_10202521 3300028381 Bacteria 1817
474 Ga0268264_10289610 3300028381 Bacteria 1537
475 Ga0307513_10107616 3300031456 Bacteria 2791
476 Ga0307408_100008431 3300031548 Bacteria 6803
477 Ga0307405_10096517 3300031731 Bacteria 1971
478 Ga0307405_10256216 3300031731 Unclassified 1304
479 Ga0307413_10041013 3300031824 Unclassified 2707
480 Ga0307406_10279421 3300031901 Unclassified 1273
481 Ga0307406_10457787 3300031901 Bacteria 1025
482 Ga0307407_10002199 3300031903 Bacteria 7521
483 Ga0307412_10107378 3300031911 Unclassified 1987
484 Ga0307412_10137145 3300031911 Bacteria 1786
485 Ga0307412_10335497 3300031911 Unclassified 1208
486 Ga0307409_100103004 3300031995 Unclassified 2373
487 Ga0307416_100208114 3300032002 Unclassified 1863
488 Ga0307414_10017655 3300032004 Unclassified 4372
489 Ga0307411_10050085 3300032005 Bacteria 2718
490 Ga0307411_10066019 3300032005 Unclassified 2429
491 Ga0307411_10347188 3300032005 Unclassified 1208
492 Ga0373939_0065173 3300035114 Unclassified 1171
493 Ga0373942_0001894 3300035207 Bacteria 5252
494 Ga0395900_0136191 3300037418 Bacteria 2516
495 Ga0395898_0123006 3300037466 Unclassified 2486
496 Ga0395898_0140085 3300037466 Bacteria 2316
497 Ga0395905_0007704 3300037471 Bacteria 10686
498 Ga0395901_0544637 3300038443 Bacteria 1177
499 Ga0242420_023318 3300038996 Unclassified 1117
500 Ga0436365_0128795 3300039437 Unclassified 2549
501 Ga0436365_0359048 3300039437 Bacteria 106834
502 Ga0439448_0019374 3300042005 Bacteria 2094
503 Ga0439457_051135 3300042014 Unclassified 928
504 Ga0453683_0008843 3300044673 Bacteria 6742
505 Ga0451576_0239943 3300045051 Unclassified 1893
506 Ga0495663_0000159 3300046525 Bacteria 27471
507 Ga0495640_0156477 3300046533 Unclassified 1463
508 Ga0495598_0001674 3300046537 Unclassified 4447
509 Ga0495621_0000470 3300046539 Bacteria 9906
510 Ga0495635_0107384 3300046663 Unclassified 1907
511 Ga0495600_0044572 3300046809 Bacteria 2894
512 Ga0495636_0010611 3300047318 Bacteria 3641
513 Ga0495674_0154102 3300047319 Bacteria 1926
514 Ga0495672_0085264 3300047320 Unclassified 1751
515 Ga0496102_0023452 3300048905 Bacteria 5482
516 Ga0496103_0094391 3300048906 Bacteria 1890
517 Ga0496106_0000914 3300048909 Bacteria 21459
518 Ga0496106_0055924 3300048909 Unclassified 2983
519 Ga0496106_0106356 3300048909 Bacteria 2181
520 Ga0496108_0174900 3300048911 Unclassified 1858
521 Ga0496110_0244899 3300048913 Unclassified 1632
522 Ga0496113_0254170 3300048916 Bacteria 1403
523 Ga0501292_015230 3300049515 Unclassified 1200
524 Ga0501298_001765 3300049521 Bacteria 3201
525 Ga0501298_002804 3300049521 Unclassified 2668
526 Ga0501038_0018489 3300049574 Bacteria 6292
527 Ga0501077_0238720 3300049593 Bacteria 1155
528 Ga0501202_015397 3300049652 Unclassified 1473
529 Ga0501207_002750 3300049654 Bacteria 2298
530 Ga0501208_015023 3300049655 Bacteria 1182
531 Ga0501217_012305 3300049661 Unclassified 1904
532 Ga0501223_000915 3300049663 Bacteria 6972
533 Ga0501223_005452 3300049663 Unclassified 2672
534 Ga0501227_005636 3300049665 Unclassified 2681
535 Ga0501233_000251 3300049668 Bacteria 8149
536 Ga0501235_012006 3300049669 Bacteria 1904
537 Ga0501235_043888 3300049669 Unclassified 1026
538 Ga0501235_047008 3300049669 Bacteria 994
539 Ga0501239_015369 3300049672 Unclassified 894
540 Ga0501249_022736 3300049679 Bacteria 1374
541 Ga0501253_007016 3300049683 Unclassified 1555
542 Ga0501257_009788 3300049686 Bacteria 2167
543 Ga0501261_016027 3300049690 Bacteria 1038
544 Ga0501225_0003981 3300049705 Unclassified 4421
545 Ga0501225_0018760 3300049705 Unclassified 1916
546 Ga0501229_004715 3300049706 Bacteria 1659
547 Ga0501263_008907 3300049760 Bacteria 1207
548 Ga0501268_001629 3300049765 Unclassified 2835
549 Ga0501226_002136 3300049853 Bacteria 2449
550 nmdc:mga05p37_14065_c1 3300050507 Bacteria 9602
551 nmdc:mga05p37_179394_c1 3300050507 Unclassified 2578
552 nmdc:mga05p37_283233_c1 3300050507 Unclassified 1976
553 nmdc:mga05p37_416464_c1 3300050507 Unclassified 1565
554 nmdc:mga05p37_517620_c1 3300050507 Bacteria 1365
555 nmdc:mga05p37_84188_c1 3300050507 Unclassified 3918
556 nmdc:mga09592_399482_c1 3300050508 Bacteria 1188
557 nmdc:mga09592_83090_c1 3300050508 Bacteria 2729
558 nmdc:mga08y16_245582_c1 3300050511 Bacteria 1850
559 nmdc:mga08y16_25422_c1 3300050511 Bacteria 6245
560 nmdc:mga08y16_2895_c1 3300050511 Bacteria 17644
561 nmdc:mga08y16_336265_c1 3300050511 Bacteria 1553
562 nmdc:mga0n895_184661_c2 3300050512 Unclassified 1517
563 nmdc:mga0n895_35761_c1 3300050512 Bacteria 4791
564 nmdc:mga0rr50_132333_c1 3300050513 Bacteria 1998
565 nmdc:mga0rr50_3312_c1 3300050513 Bacteria 9252
566 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
567 nmdc:mga0a205_184961_c1 3300050515 Bacteria 1977
568 nmdc:mga0a205_207799_c1 3300050515 Unclassified 1847
569 nmdc:mga0a205_52027_c1 3300050515 Bacteria 3953
570 nmdc:mga0a205_62012_c1 3300050515 Bacteria 3613
571 Ga0500616_0000451 3300053153 Bacteria 53891
572 Ga0436365_0822353
573 MBSR1b_contig_9672989
574 JGI24748J21848_1000003
575 JGI24034J26672_10000005
576 JGI24751J29686_10000198
577 Ga0065714_10064448
578 Ga0065704_10080346
579 Ga0065704_10136416
580 Ga0065712_10000125
581 Ga0065712_10008629
582 Ga0065712_10107106
583 Ga0065715_10003227
584 Ga0065715_10091924
585 Ga0065715_10143240
586 Ga0065715_10194380
587 Ga0065707_10000983
588 Ga0065707_10005912
589 Ga0070690_100006341
590 Ga0070690_100025432
591 Ga0070690_100047456
592 Ga0070670_100000098
593 Ga0070670_100081742
594 Ga0070670_100392389
595 Ga0068869_100001546
596 Ga0068869_100041382
597 Ga0068869_100161001
598 Ga0068869_100177228
599 Ga0068869_100193363
600 Ga0070666_10065696
601 Ga0070680_100000085
602 Ga0070680_100309812
603 Ga0070682_100009737
604 Ga0070682_100016101
605 Ga0070682_100221751
606 Ga0068868_100014103
607 Ga0070660_100051002
608 Ga0070689_100000888
609 Ga0070689_100042317
610 Ga0070689_100473718
611 Ga0070687_100011951
612 Ga0070687_100039528
613 Ga0070687_100114208
614 Ga0070661_100117101
615 Ga0070692_10002979
616 Ga0070692_10004226
617 Ga0070668_100005005
618 Ga0070669_100024722
619 Ga0070669_100044047
620 Ga0070669_100104690
621 Ga0070671_100004102
622 Ga0070671_100074589
623 Ga0070671_100113725
624 Ga0070673_100120210
625 Ga0070673_100158426
626 Ga0070673_100283192
627 Ga0070659_100001315
628 Ga0070667_100011106
629 Ga0070667_100034698
630 Ga0070703_10000268
631 Ga0070703_10007708
632 Ga0070701_10031180
633 Ga0070701_10060154
634 Ga0070705_100027607
635 Ga0070705_100068114
636 Ga0070700_100000227
637 Ga0070700_100014560
638 Ga0070700_100017916
639 Ga0070700_100084453
640 Ga0070700_100309125
641 Ga0070694_100001061
642 Ga0070694_100004594
643 Ga0070694_100014087
644 Ga0070694_100022917
645 Ga0070694_100064963
646 Ga0070694_100233583
647 Ga0070694_100257811
648 Ga0070708_100000653
649 Ga0070708_100224226
650 Ga0070662_100032233
651 Ga0070662_100201387
652 Ga0070662_100221637
653 Ga0070681_10000189
654 Ga0070681_10012299
655 Ga0070681_10020660
656 Ga0070681_10183902
657 Ga0068867_100142066
658 Ga0068867_100181604
659 Ga0068867_100205436
660 Ga0070706_100000032
661 Ga0070706_100004498
662 Ga0070706_100008242
663 Ga0070706_100028437
664 Ga0070707_100016360
665 Ga0070707_100020360
666 Ga0070698_100006414
667 Ga0070698_100009821
668 Ga0070698_100017204
669 Ga0070698_100017445
670 Ga0070698_100064382
671 Ga0070699_100017621
672 Ga0070699_100063689
673 Ga0070699_100326669
674 Ga0070679_100001869
675 Ga0070679_100021064
676 Ga0070679_100193665
677 Ga0070697_100001100
678 Ga0070697_100001819
679 Ga0070697_100007762
680 Ga0070697_100047692
681 Ga0070697_100089584
682 Ga0070697_100372653
683 Ga0068853_100153733
684 Ga0068853_100210108
685 Ga0068853_100453997
686 Ga0068853_100574740
687 Ga0070672_100048965
688 Ga0070672_100438263
689 Ga0070686_100004978
690 Ga0070686_100005424
691 Ga0070695_100007984
692 Ga0070695_100010744
693 Ga0070695_100016721
694 Ga0070695_100167912
695 Ga0070695_100173470
696 Ga0070695_100392634
697 Ga0070696_100038580
698 Ga0070696_100044416
699 Ga0070696_100069230
700 Ga0070696_100099227
701 Ga0070696_100112443
702 Ga0070696_100129436
703 Ga0070696_100236371
704 Ga0070693_100004827
705 Ga0070693_100070606
706 Ga0070693_100070766
707 Ga0070693_100074039
708 Ga0070693_100163536
709 Ga0070665_100155226
710 Ga0070704_100014443
711 Ga0068855_100215802
712 Ga0070664_100011559
713 Ga0070664_100157332
714 Ga0070664_100378334
715 Ga0068857_100208047
716 Ga0068854_100062892
717 Ga0068854_100165872
718 Ga0068854_100181540
719 Ga0070702_100017299
720 Ga0070702_100033442
721 Ga0070702_100061046
722 Ga0070702_100239095
723 Ga0068852_100034356
724 Ga0068852_100171576
725 Ga0068852_100286647
726 Ga0068859_100015044
727 Ga0068859_100018662
728 Ga0068859_100069051
729 Ga0068859_100097295
730 Ga0068859_100300188
731 Ga0068859_100322471
732 Ga0068859_100460513
733 Ga0068859_100544893
734 Ga0068859_100673160
735 Ga0068864_100046156
736 Ga0068864_100090267
737 Ga0068864_100144303
738 Ga0068864_100177377
739 Ga0068864_100290681
740 Ga0068866_10037109
741 Ga0068861_100005263
742 Ga0068861_100012032
743 Ga0068861_100039309
744 Ga0068861_100298885
745 Ga0068851_10000786
746 Ga0068870_10032313
747 Ga0068870_10038990
748 Ga0068870_10044540
749 Ga0068870_10287016
750 Ga0068863_100014605
751 Ga0068863_100027481
752 Ga0068858_100000026
753 Ga0068858_100031528
754 Ga0068858_100067293
755 Ga0068858_100106165
756 Ga0068858_100124224
757 Ga0068858_100171397
758 Ga0068858_100356972
759 Ga0068858_100663296
760 Ga0068860_100008037
761 Ga0068860_100089974
762 Ga0068860_100157294
763 Ga0068860_100346038
764 Ga0068862_100003684
765 Ga0068862_100043301
766 Ga0068862_100080750
767 Ga0081539_10000119
768 Ga0081539_10000145
769 Ga0081539_10007215
770 Ga0081539_10116695
771 Ga0070716_100024237
772 Ga0097621_100080442
773 Ga0068871_100052761
774 Ga0075428_100070966
775 Ga0075428_100302924
776 Ga0075433_10016646
777 Ga0075433_10020848
778 Ga0075433_10043802
779 Ga0075433_10155877
780 Ga0075434_100131417
781 Ga0075434_100278280
782 Ga0075434_100430821
783 Ga0075429_100023714
784 Ga0075429_100139373
785 Ga0068865_100008436
786 Ga0068865_100145382
787 Ga0075436_100000011
788 Ga0075436_100014526
789 Ga0097620_100015044
790 Ga0097620_100018662
791 Ga0097620_100069055
792 Ga0097620_100097293
793 Ga0097620_100300195
794 Ga0097620_100322481
795 Ga0097620_100460536
796 Ga0097620_100544899
797 Ga0097620_100673164
798 Ga0075435_100000627
799 Ga0075435_100019089
800 Ga0075435_100150231
801 Ga0075435_100171216
802 Ga0099794_10001794
803 Ga0099794_10037503
804 Ga0105250_10059376
805 Ga0105240_10246773
806 Ga0105240_10343624
807 Ga0111539_10001485
808 Ga0111539_10040331
809 Ga0105245_10033485
810 Ga0105247_10000033
811 Ga0105247_10018053
812 Ga0114129_10009360
813 Ga0114129_10010245
814 Ga0114129_10011128
815 Ga0114129_10018423
816 Ga0114129_10208633
817 Ga0114129_10618927
818 Ga0114129_10821660
819 Ga0105243_10000107
820 Ga0105243_10014719
821 Ga0105243_10190612
822 Ga0105243_10221528
823 Ga0105243_10231920
824 Ga0105241_10071009
825 Ga0105241_10098397
826 Ga0105242_10000516
827 Ga0105242_10001164
828 Ga0105242_10005344
829 Ga0105242_10017913
830 Ga0105242_10097040
831 Ga0105242_10130195
832 Ga0105242_10192481
833 Ga0105248_10008264
834 Ga0105248_10047139
835 Ga0105248_10079546
836 Ga0105248_10092246
837 Ga0105248_10104728
838 Ga0105248_10146994
839 Ga0105248_10244749
840 Ga0105248_10292492
841 Ga0105237_10000839
842 Ga0105237_10116054
843 Ga0105237_10216256
844 Ga0105238_10017033
845 Ga0105238_10035475
846 Ga0105249_10024715
847 Ga0105249_10029218
848 Ga0105249_10112111
849 Ga0105249_10219288
850 Ga0105249_10282165
851 Ga0105239_10008406
852 Ga0105239_10059519
853 Ga0105239_10099970
854 Ga0105246_10038593
855 Ga0105246_10042617
856 Ga0105246_10265749
857 Ga0157373_10018787
858 Ga0157373_10043543
859 Ga0157374_10059176
860 Ga0157378_10000011
861 Ga0157378_10003909
862 Ga0157378_10019498
863 Ga0157378_10022997
864 Ga0157378_10090809
865 Ga0157378_10192383
866 Ga0163162_10000039
867 Ga0163162_10005864
868 Ga0163162_10015731
869 Ga0163162_10036438
870 Ga0163162_10087672
871 Ga0163162_10198816
872 Ga0157375_10013982
873 Ga0157375_10041573
874 Ga0157375_10656494
875 Ga0163163_10000669
876 Ga0163163_10005113
877 Ga0163163_10006079
878 Ga0163163_10015633
879 Ga0163163_10064508
880 Ga0163163_10165948
881 Ga0163163_10253233
882 Ga0163163_10295602
883 Ga0157380_10001254
884 Ga0157380_10001303
885 Ga0157380_10015533
886 Ga0157380_10072366
887 Ga0157380_10079528
888 Ga0157377_10022864
889 Ga0157379_10036929
890 Ga0157379_10218793
891 Ga0157376_10033070
892 Ga0157376_10140317
893 Ga0163161_10106682
894 Ga0213876_10000022
895 Ga0213876_10002606
896 Ga0207672_1000910
897 Ga0207656_10003196
898 Ga0207653_10000019
899 Ga0207653_10003835
900 Ga0207642_10006966
901 Ga0207710_10000001
902 Ga0207710_10016905
903 Ga0207688_10243126
904 Ga0207647_10007114
905 Ga0207647_10082106
906 Ga0207645_10026240
907 Ga0207643_10004099
908 Ga0207643_10022061
909 Ga0207643_10027865
910 Ga0207643_10035324
911 Ga0207643_10059821
912 Ga0207643_10278296
913 Ga0207684_10001147
914 Ga0207684_10003682
915 Ga0207684_10023644
916 Ga0207684_10027155
917 Ga0207684_10039171
918 Ga0207654_10037822
919 Ga0207654_10065701
920 Ga0207654_10284697
921 Ga0207707_10000218
922 Ga0207707_10006026
923 Ga0207707_10151348
924 Ga0207695_10141980
925 Ga0207671_10008859
926 Ga0207671_10209832
927 Ga0207660_10000580
928 Ga0207660_10260408
929 Ga0207662_10001566
930 Ga0207662_10035967
931 Ga0207662_10062394
932 Ga0207657_10029024
933 Ga0207649_10006263
934 Ga0207649_10265946
935 Ga0207652_10000066
936 Ga0207652_10053454
937 Ga0207652_10353787
938 Ga0207646_10033554
939 Ga0207646_10108810
940 Ga0207681_10022423
941 Ga0207681_10025911
942 Ga0207681_10226383
943 Ga0207694_10032063
944 Ga0207650_10000156
945 Ga0207650_10035526
946 Ga0207650_10187539
947 Ga0207659_10115092
948 Ga0207659_10427826
949 Ga0207644_10001394
950 Ga0207644_10011617
951 Ga0207644_10107904
952 Ga0207690_10022239
953 Ga0207706_10168330
954 Ga0207686_10000015
955 Ga0207686_10000117
956 Ga0207686_10000710
957 Ga0207686_10044652
958 Ga0207686_10096274
959 Ga0207686_10183828
960 Ga0207709_10000043
961 Ga0207709_10010103
962 Ga0207709_10101653
963 Ga0207709_10279848
964 Ga0207670_10001499
965 Ga0207704_10012005
966 Ga0207665_10015355
967 Ga0207665_10016474
968 Ga0207665_10197798
969 Ga0207691_10005174
970 Ga0207711_10008895
971 Ga0207711_10020100
972 Ga0207711_10031632
973 Ga0207689_10011505
974 Ga0207689_10052684
975 Ga0207689_10088536
976 Ga0207689_10232525
977 Ga0207689_10342226
978 Ga0207679_10028254
979 Ga0207679_10121255
980 Ga0207667_10178851
981 Ga0207667_10292664
982 Ga0207651_10051507
983 Ga0207651_10065143
984 Ga0207651_10078994
985 Ga0207651_10093005
986 Ga0207651_10362376
987 Ga0207651_10619429
988 Ga0207712_10000184
989 Ga0207712_10013750
990 Ga0207712_10063102
991 Ga0207712_10086204
992 Ga0207712_10132514
993 Ga0207668_10065007
994 Ga0207640_10052734
995 Ga0207640_10426051
996 Ga0207677_10102272
997 Ga0207677_10273806
998 Ga0207703_10000110
999 Ga0207703_10094899
1000 Ga0207703_10297779
1001 Ga0207703_10363718
1002 Ga0207639_10126215
1003 Ga0207639_10289034
1004 Ga0207708_10000031
1005 Ga0207708_10008358
1006 Ga0207708_10015210
1007 Ga0207708_10040910
1008 Ga0207708_10042431
1009 Ga0207708_10049255
1010 Ga0207708_10132407
1011 Ga0207702_10286451
1012 Ga0207641_10012657
1013 Ga0207641_10065316
1014 Ga0207641_10468513
1015 Ga0207676_10002306
1016 Ga0207676_10012705
1017 Ga0207676_10027801
1018 Ga0207676_10074979
1019 Ga0207676_10107253
1020 Ga0207676_10244143
1021 Ga0207676_10295727
1022 Ga0207676_10364992
1023 Ga0207674_10000006
1024 Ga0207674_10199088
1025 Ga0207674_10288958
1026 Ga0207674_10468366
1027 Ga0207675_100000348
1028 Ga0207675_100004337
1029 Ga0207675_100010500
1030 Ga0207675_100025927
1031 Ga0207675_100048726
1032 Ga0207675_100102483
1033 Ga0207675_100155136
1034 Ga0207683_10043181
1035 Ga0207698_10065068
1036 Ga0209588_1005810
1037 Ga0207428_10013603
1038 Ga0207428_10034327
1039 Ga0207428_10130612
1040 Ga0268265_10035365
1041 Ga0268264_10033138
1042 Ga0268264_10056815
1043 Ga0268264_10121831
1044 Ga0268264_10202521
1045 Ga0268264_10289610
1046 Ga0307513_10107616
1047 Ga0307408_100008431
1048 Ga0307405_10096517
1049 Ga0307405_10256216
1050 Ga0307413_10041013
1051 Ga0307406_10279421
1052 Ga0307406_10457787
1053 Ga0307407_10002199
1054 Ga0307412_10107378
1055 Ga0307412_10137145
1056 Ga0307412_10335497
1057 Ga0307409_100103004
1058 Ga0307416_100208114
1059 Ga0307414_10017655
1060 Ga0307411_10050085
1061 Ga0307411_10066019
1062 Ga0307411_10347188
1063 Ga0373939_0065173
1064 Ga0373942_0001894
1065 Ga0395900_0136191
1066 Ga0395898_0123006
1067 Ga0395898_0140085
1068 Ga0395905_0007704
1069 Ga0395901_0544637
1070 Ga0242420_023318
1071 Ga0436365_0128795
1072 Ga0436365_0359048
1073 Ga0439448_0019374
1074 Ga0439457_051135
1075 Ga0453683_0008843
1076 Ga0451576_0239943
1077 Ga0495663_0000159
1078 Ga0495640_0156477
1079 Ga0495598_0001674
1080 Ga0495621_0000470
1081 Ga0495635_0107384
1082 Ga0495600_0044572
1083 Ga0495636_0010611
1084 Ga0495674_0154102
1085 Ga0495672_0085264
1086 Ga0496102_0023452
1087 Ga0496103_0094391
1088 Ga0496106_0000914
1089 Ga0496106_0055924
1090 Ga0496106_0106356
1091 Ga0496108_0174900
1092 Ga0496110_0244899
1093 Ga0496113_0254170
1094 Ga0501292_015230
1095 Ga0501298_001765
1096 Ga0501298_002804
1097 Ga0501038_0018489
1098 Ga0501077_0238720
1099 Ga0501202_015397
1100 Ga0501207_002750
1101 Ga0501208_015023
1102 Ga0501217_012305
1103 Ga0501223_000915
1104 Ga0501223_005452
1105 Ga0501227_005636
1106 Ga0501233_000251
1107 Ga0501235_012006
1108 Ga0501235_043888
1109 Ga0501235_047008
1110 Ga0501239_015369
1111 Ga0501249_022736
1112 Ga0501253_007016
1113 Ga0501257_009788
1114 Ga0501261_016027
1115 Ga0501225_0003981
1116 Ga0501225_0018760
1117 Ga0501229_004715
1118 Ga0501263_008907
1119 Ga0501268_001629
1120 Ga0501226_002136
1121 nmdc:mga05p37_14065_c1
1122 nmdc:mga05p37_179394_c1
1123 nmdc:mga05p37_283233_c1
1124 nmdc:mga05p37_416464_c1
1125 nmdc:mga05p37_517620_c1
1126 nmdc:mga05p37_84188_c1
1127 nmdc:mga09592_399482_c1
1128 nmdc:mga09592_83090_c1
1129 nmdc:mga08y16_245582_c1
1130 nmdc:mga08y16_25422_c1
1131 nmdc:mga08y16_2895_c1
1132 nmdc:mga08y16_336265_c1
1133 nmdc:mga0n895_184661_c2
1134 nmdc:mga0n895_35761_c1
1135 nmdc:mga0rr50_132333_c1
1136 nmdc:mga0rr50_3312_c1
1137 nmdc:mga08x19_13_c1
1138 nmdc:mga0a205_184961_c1
1139 nmdc:mga0a205_207799_c1
1140 nmdc:mga0a205_52027_c1
1141 nmdc:mga0a205_62012_c1
1142 Ga0500616_0000451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22740

PapZ_C

RapZ C-terminal domain

183

303

0.99

PF03668

RapZ-like_N

RapZ-like N-terminal domain

19

179

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9215 180 300
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9004 180 300
4y0a-assembly1.cif.gz_A shikimate kinase from acinetobacter baumannii in complex with shikimate 0.643 13 176
3n2e-assembly2.cif.gz_B crystal structure of helicobactor pylori shikimate kinase in complex with nsc162535 0.6372 17 170
2cdn-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg 0.6358 19 169
ID Description Score Start End Superfamily
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8778 187 307 3.40.50.720
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8642 187 307 3.40.50.720
af_P0A894_1_282_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7059 18 301 3.40.50.300
af_P0A894_1_282_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6978 18 301 3.40.50.300
af_Q58794_3_181_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6488 19 167 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2W6C866-F1-model_v4 RapZ C-terminal domain-containing protein 0.9472 179 298 GO:0005524
AF-A0A383CC62-F1-model_v4 RapZ-like N-terminal domain-containing protein 0.9413 15 172 GO:0005524
GO:0005525
AF-A0A358SIP8-F1-model_v4 RNase adaptor protein RapZ 0.9413 184 298 GO:0005524
AF-A0A662DSW2-F1-model_v4 RNase adaptor protein RapZ 0.9378 180 300 GO:0005524
AF-A0A2N3F0Z0-F1-model_v4 RNase adaptor protein RapZ 0.9364 197 302 GO:0005524

Map