F464965

General Info

Members Datasets Scaffolds Average Seq Length
571 276 570 126

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10558397|Ga0307412_105583972
Length 115
Sequence MTESNPHARNVGVAVGTLLASSSTLICCVLPAVMVSLGAGAALAGLVTAVPQLVWLSEHKSGAMLWRARSLPCPVDARAARSCARLRRISAILYGVSLVAYVAGATFAFLLPALA

Samples

Sample ID Description Type Environment
1 2643221695 Lysobacter sp. Root494 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
196 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
197 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
205 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
206 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
212 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
256 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
257 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
258 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
259 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
264 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 3.68
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10066473 3300003320 Bacteria 2169
2 rootL2_10321089 3300003322 Bacteria 2443
3 rootH1_10201361 3300003323 Bacteria 1410
4 rootH1_10321975 3300003323 Unclassified 1564
5 Ga0065712_10305834 3300005290 Bacteria 846
6 Ga0065715_10009804 3300005293 Bacteria 2292
7 Ga0065715_10040101 3300005293 Bacteria 1319
8 Ga0065715_10056605 3300005293 Bacteria 1019
9 Ga0065707_10082412 3300005295 Bacteria 15474
10 Ga0070658_10493648 3300005327 Bacteria 1057
11 Ga0070658_11282799 3300005327 Unclassified 636
12 Ga0070676_10477852 3300005328 Bacteria 881
13 Ga0070676_10646191 3300005328 Bacteria 767
14 Ga0070676_11120941 3300005328 Unclassified 595
15 Ga0070683_100364897 3300005329 Bacteria 1375
16 Ga0070690_100632418 3300005330 Bacteria 815
17 Ga0070670_100259762 3300005331 Unclassified 1514
18 Ga0070670_102190301 3300005331 Unclassified 509
19 Ga0070677_10007898 3300005333 Bacteria 3562
20 Ga0070677_10017588 3300005333 Unclassified 2561
21 Ga0068869_100021885 3300005334 Bacteria 4400
22 Ga0068869_100294738 3300005334 Bacteria 1308
23 Ga0068869_100555031 3300005334 Bacteria 965
24 Ga0068869_100701310 3300005334 Bacteria 863
25 Ga0070666_10091530 3300005335 Bacteria 2089
26 Ga0070666_10132730 3300005335 Bacteria 1731
27 Ga0070666_10231794 3300005335 Unclassified 1304
28 Ga0070682_100059937 3300005337 Bacteria 2405
29 Ga0070682_100081638 3300005337 Unclassified 2094
30 Ga0070682_100132093 3300005337 Bacteria 1691
31 Ga0068868_100280599 3300005338 Bacteria 1410
32 Ga0070660_100881106 3300005339 Unclassified 754
33 Ga0070689_100223629 3300005340 Bacteria 1545
34 Ga0070689_100517908 3300005340 Bacteria 1024
35 Ga0070691_10168509 3300005341 Bacteria 1133
36 Ga0070661_100004159 3300005344 Bacteria 9984
37 Ga0070661_100357145 3300005344 Bacteria 1148
38 Ga0070661_101839435 3300005344 Unclassified 514
39 Ga0070692_10115577 3300005345 Unclassified 1490
40 Ga0070692_11068417 3300005345 Unclassified 568
41 Ga0070668_100230299 3300005347 Bacteria 1531
42 Ga0070668_100256050 3300005347 Bacteria 1454
43 Ga0070669_100020764 3300005353 Bacteria 4692
44 Ga0070669_100107756 3300005353 Bacteria 2111
45 Ga0070675_100035409 3300005354 Bacteria 4056
46 Ga0070675_100053681 3300005354 Unclassified 3315
47 Ga0070675_100054937 3300005354 Unclassified 3277
48 Ga0070675_100431225 3300005354 Bacteria 1180
49 Ga0070671_100280943 3300005355 Bacteria 1416
50 Ga0070671_100684135 3300005355 Bacteria 889
51 Ga0070671_100773588 3300005355 Bacteria 835
52 Ga0070671_101662693 3300005355 Bacteria 566
53 Ga0070674_100008337 3300005356 Bacteria 6167
54 Ga0070674_100380243 3300005356 Bacteria 1149
55 Ga0070674_100697341 3300005356 Bacteria 868
56 Ga0070673_100091877 3300005364 Unclassified 2481
57 Ga0070673_100247104 3300005364 Bacteria 1553
58 Ga0070673_100545249 3300005364 Bacteria 1053
59 Ga0070673_102101481 3300005364 Bacteria 536
60 Ga0070688_100055638 3300005365 Unclassified 2482
61 Ga0070688_100242569 3300005365 Bacteria 1280
62 Ga0070688_100716808 3300005365 Bacteria 776
63 Ga0070659_100628684 3300005366 Unclassified 924
64 Ga0070667_100000148 3300005367 Bacteria 87700
65 Ga0070667_100142885 3300005367 Bacteria 2097
66 Ga0070667_100144445 3300005367 Unclassified 2086
67 Ga0070667_100307611 3300005367 Bacteria 1428
68 Ga0070667_100426897 3300005367 Bacteria 1209
69 Ga0070667_100459687 3300005367 Bacteria 1164
70 Ga0070667_101888003 3300005367 Unclassified 562
71 Ga0070709_10296770 3300005434 Unclassified 1179
72 Ga0070714_100016852 3300005435 Bacteria 5909
73 Ga0070713_100176963 3300005436 Unclassified 1915
74 Ga0070700_100055666 3300005441 Unclassified 2476
75 Ga0070700_100277862 3300005441 Unclassified 1213
76 Ga0070700_100407766 3300005441 Bacteria 1024
77 Ga0070700_100657870 3300005441 Bacteria 828
78 Ga0070694_100214408 3300005444 Unclassified 1441
79 Ga0070694_100799568 3300005444 Bacteria 773
80 Ga0070663_100151042 3300005455 Bacteria 1781
81 Ga0070663_100806992 3300005455 Bacteria 805
82 Ga0070678_100010553 3300005456 Bacteria 5651
83 Ga0070678_100113421 3300005456 Unclassified 2125
84 Ga0070678_100225205 3300005456 Bacteria 1561
85 Ga0070662_100346272 3300005457 Bacteria 1217
86 Ga0070662_100612164 3300005457 Unclassified 917
87 Ga0070681_10104554 3300005458 Bacteria 2774
88 Ga0068867_100062316 3300005459 Bacteria 2771
89 Ga0068867_100958029 3300005459 Bacteria 773
90 Ga0070685_10292252 3300005466 Bacteria 1095
91 Ga0070685_10310147 3300005466 Bacteria 1066
92 Ga0070685_11115478 3300005466 Unclassified 596
93 Ga0070679_100166754 3300005530 Bacteria 2176
94 Ga0070679_100321909 3300005530 Bacteria 1495
95 Ga0070684_100096206 3300005535 Bacteria 2639
96 Ga0068853_100122912 3300005539 Bacteria 2317
97 Ga0068853_100234260 3300005539 Bacteria 1680
98 Ga0068853_101075088 3300005539 Unclassified 776
99 Ga0070672_100232676 3300005543 Unclassified 1548
100 Ga0070672_100349612 3300005543 Bacteria 1260
101 Ga0070672_100537078 3300005543 Bacteria 1014
102 Ga0070686_100065396 3300005544 Unclassified 2362
103 Ga0070686_100103789 3300005544 Unclassified 1924
104 Ga0070696_100147176 3300005546 Bacteria 1726
105 Ga0070696_100564845 3300005546 Bacteria 913
106 Ga0070665_100021723 3300005548 Bacteria 6453
107 Ga0070665_100089718 3300005548 Bacteria 3080
108 Ga0070665_101178448 3300005548 Bacteria 777
109 Ga0070664_100011825 3300005564 Bacteria 7085
110 Ga0070664_100658944 3300005564 Bacteria 973
111 Ga0068857_100085257 3300005577 Bacteria 2823
112 Ga0068857_100622069 3300005577 Unclassified 1022
113 Ga0068856_100053838 3300005614 Bacteria 3968
114 Ga0068856_100314532 3300005614 Bacteria 1583
115 Ga0068852_100332885 3300005616 Bacteria 1478
116 Ga0068852_101333958 3300005616 Unclassified 739
117 Ga0068859_100066758 3300005617 Bacteria 3632
118 Ga0068859_100115155 3300005617 Bacteria 2753
119 Ga0068859_100607461 3300005617 Bacteria 1187
120 Ga0068864_100289956 3300005618 Unclassified 1530
121 Ga0068864_100763401 3300005618 Bacteria 948
122 Ga0068866_10086952 3300005718 Unclassified 1693
123 Ga0068866_10628399 3300005718 Bacteria 728
124 Ga0068861_100021313 3300005719 Bacteria 4658
125 Ga0068861_100030797 3300005719 Unclassified 3935
126 Ga0068861_100173889 3300005719 Bacteria 1787
127 Ga0068861_100312017 3300005719 Bacteria 1367
128 Ga0068861_100841344 3300005719 Bacteria 864
129 Ga0068851_10030134 3300005834 Bacteria 2690
130 Ga0068851_11033828 3300005834 Unclassified 519
131 Ga0068870_10008453 3300005840 Bacteria 4632
132 Ga0068870_10015184 3300005840 Bacteria 3650
133 Ga0068870_10086831 3300005840 Unclassified 1741
134 Ga0068870_10167927 3300005840 Bacteria 1307
135 Ga0068870_10704731 3300005840 Unclassified 697
136 Ga0068863_100108994 3300005841 Bacteria 2636
137 Ga0068863_100175844 3300005841 Bacteria 2054
138 Ga0068863_100487787 3300005841 Unclassified 1212
139 Ga0068858_100206462 3300005842 Bacteria 1859
140 Ga0068858_100340271 3300005842 Bacteria 1436
141 Ga0068858_100480449 3300005842 Bacteria 1199
142 Ga0068860_100383974 3300005843 Bacteria 1387
143 Ga0068860_101640900 3300005843 Bacteria 665
144 Ga0068862_100135414 3300005844 Bacteria 2183
145 Ga0068862_100207068 3300005844 Bacteria 1771
146 Ga0068862_101449075 3300005844 Bacteria 691
147 Ga0068862_102596944 3300005844 Bacteria 518
148 Ga0070717_10542072 3300006028 Unclassified 1053
149 Ga0070716_100803890 3300006173 Bacteria 728
150 Ga0097621_100008803 3300006237 Bacteria 7294
151 Ga0097621_100025028 3300006237 Bacteria 4666
152 Ga0097621_100401233 3300006237 Unclassified 1227
153 Ga0097621_100421704 3300006237 Bacteria 1198
154 Ga0097621_100631178 3300006237 Unclassified 981
155 Ga0097621_101491935 3300006237 Bacteria 641
156 Ga0097621_102374149 3300006237 Unclassified 507
157 Ga0068871_100011256 3300006358 Bacteria 6558
158 Ga0068871_100192365 3300006358 Bacteria 1758
159 Ga0068871_100681449 3300006358 Unclassified 940
160 Ga0068871_100726279 3300006358 Unclassified 911
161 Ga0075428_100003523 3300006844 Bacteria 17142
162 Ga0075428_100231061 3300006844 Bacteria 1996
163 Ga0075428_101054669 3300006844 Bacteria 859
164 Ga0075431_100856489 3300006847 Unclassified 880
165 Ga0075433_10000660 3300006852 Bacteria 23286
166 Ga0075434_100030048 3300006871 Bacteria 5349
167 Ga0075429_100195011 3300006880 Unclassified 1774
168 Ga0075429_101097059 3300006880 Bacteria 695
169 Ga0068865_100838378 3300006881 Bacteria 796
170 Ga0097620_100066757 3300006931 Bacteria 3632
171 Ga0097620_100115157 3300006931 Bacteria 2753
172 Ga0097620_100607456 3300006931 Bacteria 1187
173 Ga0105250_10025038 3300009092 Unclassified 2405
174 Ga0105240_10039201 3300009093 Bacteria 6070
175 Ga0105240_10046238 3300009093 Bacteria 5517
176 Ga0111539_10000667 3300009094 Bacteria 44305
177 Ga0111539_10077063 3300009094 Bacteria 3925
178 Ga0111539_10450049 3300009094 Bacteria 1499
179 Ga0111539_10727130 3300009094 Bacteria 1156
180 Ga0111539_10937064 3300009094 Bacteria 1007
181 Ga0105245_10198616 3300009098 Bacteria 1925
182 Ga0105245_10587128 3300009098 Bacteria 1139
183 Ga0114129_10026312 3300009147 Bacteria 8239
184 Ga0114129_12348965 3300009147 Bacteria 639
185 Ga0105241_10048168 3300009174 Bacteria 3242
186 Ga0105241_10235304 3300009174 Bacteria 1546
187 Ga0105241_10407893 3300009174 Bacteria 1193
188 Ga0105242_11094952 3300009176 Unclassified 810
189 Ga0105242_11397824 3300009176 Bacteria 727
190 Ga0105242_13293284 3300009176 Bacteria 502
191 Ga0105248_10858760 3300009177 Bacteria 1024
192 Ga0105237_10034062 3300009545 Bacteria 5158
193 Ga0105237_10098005 3300009545 Bacteria 2923
194 Ga0105237_10110149 3300009545 Bacteria 2745
195 Ga0105237_10123329 3300009545 Bacteria 2585
196 Ga0105237_10151186 3300009545 Bacteria 2318
197 Ga0105238_10004452 3300009551 Bacteria 13888
198 Ga0105238_10027145 3300009551 Bacteria 5836
199 Ga0105238_10074668 3300009551 Bacteria 3383
200 Ga0105238_11870870 3300009551 Unclassified 633
201 Ga0105249_10050531 3300009553 Bacteria 3790
202 Ga0105249_10508376 3300009553 Bacteria 1251
203 Ga0105249_11572603 3300009553 Bacteria 730
204 Ga0105239_10036898 3300010375 Bacteria 5362
205 Ga0105239_10037362 3300010375 Bacteria 5324
206 Ga0105239_10703332 3300010375 Bacteria 1156
207 Ga0105246_10013662 3300011119 Bacteria 5095
208 Ga0157373_10239485 3300013100 Bacteria 1282
209 Ga0157373_10422576 3300013100 Bacteria 957
210 Ga0157371_10080322 3300013102 Bacteria 2309
211 Ga0157370_10132869 3300013104 Bacteria 2321
212 Ga0157370_10224099 3300013104 Bacteria 1741
213 Ga0157369_10006603 3300013105 Bacteria 13416
214 Ga0157369_10892780 3300013105 Bacteria 912
215 Ga0157369_11286084 3300013105 Unclassified 746
216 Ga0157374_10029150 3300013296 Unclassified 4994
217 Ga0157374_10534876 3300013296 Bacteria 1179
218 Ga0157378_10114574 3300013297 Bacteria 2476
219 Ga0163162_10040442 3300013306 Bacteria 4662
220 Ga0163162_10071229 3300013306 Bacteria 3529
221 Ga0163162_10177117 3300013306 Bacteria 2258
222 Ga0163162_11857861 3300013306 Bacteria 689
223 Ga0163162_13108211 3300013306 Bacteria 533
224 Ga0157372_10000510 3300013307 Bacteria 42734
225 Ga0157372_10562133 3300013307 Bacteria 1330
226 Ga0157372_11263989 3300013307 Unclassified 852
227 Ga0157375_10039071 3300013308 Bacteria 4563
228 Ga0157375_10091171 3300013308 Bacteria 3109
229 Ga0157375_11267446 3300013308 Bacteria 866
230 Ga0157375_11524185 3300013308 Archaea 789
231 Ga0163163_10000818 3300014325 Bacteria 26518
232 Ga0163163_10017838 3300014325 Bacteria 6626
233 Ga0163163_11501170 3300014325 Bacteria 735
234 Ga0157380_10029420 3300014326 Bacteria 4198
235 Ga0157380_10038743 3300014326 Bacteria 3703
236 Ga0157380_10064249 3300014326 Unclassified 2946
237 Ga0157380_10115115 3300014326 Bacteria 2267
238 Ga0157380_10504403 3300014326 Bacteria 1176
239 Ga0157380_10571763 3300014326 Bacteria 1113
240 Ga0157380_10688128 3300014326 Bacteria 1026
241 Ga0157380_11541529 3300014326 Unclassified 719
242 Ga0157377_10697759 3300014745 Bacteria 736
243 Ga0157379_10608850 3300014968 Bacteria 1020
244 Ga0157379_12484156 3300014968 Bacteria 518
245 Ga0157376_10257815 3300014969 Bacteria 1632
246 Ga0157376_10265834 3300014969 Unclassified 1609
247 Ga0157376_10285548 3300014969 Unclassified 1556
248 Ga0157376_10576507 3300014969 Bacteria 1117
249 Ga0163161_10092270 3300017792 Unclassified 2242
250 Ga0228598_1100643 3300024227 Unclassified 583
251 Ga0209233_1001223 3300025261 Bacteria 10345
252 Ga0207656_10297000 3300025321 Bacteria 799
253 Ga0207682_10004381 3300025893 Bacteria 5914
254 Ga0207682_10006736 3300025893 Bacteria 4614
255 Ga0207642_10066951 3300025899 Unclassified 1693
256 Ga0207710_10032970 3300025900 Bacteria 2270
257 Ga0207688_10861606 3300025901 Unclassified 574
258 Ga0207688_10977955 3300025901 Bacteria 535
259 Ga0207680_10183265 3300025903 Bacteria 1417
260 Ga0207680_10395996 3300025903 Bacteria 975
261 Ga0207680_10886281 3300025903 Bacteria 640
262 Ga0207647_10039602 3300025904 Bacteria 2972
263 Ga0207699_10106140 3300025906 Unclassified 1792
264 Ga0207643_10003323 3300025908 Bacteria 8670
265 Ga0207643_10014679 3300025908 Bacteria 4258
266 Ga0207643_10055809 3300025908 Unclassified 2247
267 Ga0207643_10220516 3300025908 Bacteria 1160
268 Ga0207705_10765099 3300025909 Bacteria 750
269 Ga0207654_10105515 3300025911 Bacteria 1744
270 Ga0207707_10154935 3300025912 Bacteria 2004
271 Ga0207695_10000182 3300025913 Bacteria 184125
272 Ga0207695_10082579 3300025913 Unclassified 3248
273 Ga0207695_10148678 3300025913 Bacteria 2283
274 Ga0207695_10345388 3300025913 Unclassified 1376
275 Ga0207695_10396907 3300025913 Bacteria 1264
276 Ga0207671_10001037 3300025914 Bacteria 33796
277 Ga0207671_10003499 3300025914 Bacteria 15607
278 Ga0207671_10252461 3300025914 Bacteria 1386
279 Ga0207671_10538847 3300025914 Bacteria 931
280 Ga0207663_10445414 3300025916 Bacteria 998
281 Ga0207660_10390560 3300025917 Bacteria 1120
282 Ga0207657_10003480 3300025919 Bacteria 16793
283 Ga0207649_10003639 3300025920 Bacteria 8422
284 Ga0207649_10531616 3300025920 Bacteria 898
285 Ga0207652_10340049 3300025921 Bacteria 1355
286 Ga0207681_10028332 3300025923 Bacteria 3628
287 Ga0207681_10029865 3300025923 Bacteria 3548
288 Ga0207681_10069423 3300025923 Bacteria 2451
289 Ga0207694_10035408 3300025924 Bacteria 3829
290 Ga0207694_10041978 3300025924 Bacteria 3526
291 Ga0207694_10433285 3300025924 Bacteria 1096
292 Ga0207694_10650374 3300025924 Unclassified 888
293 Ga0207650_10130520 3300025925 Unclassified 1966
294 Ga0207650_11795718 3300025925 Unclassified 519
295 Ga0207659_10070606 3300025926 Unclassified 2547
296 Ga0207659_10418312 3300025926 Unclassified 1124
297 Ga0207687_10222958 3300025927 Bacteria 1485
298 Ga0207687_11420292 3300025927 Bacteria 596
299 Ga0207700_10327802 3300025928 Unclassified 1328
300 Ga0207700_10396684 3300025928 Unclassified 1209
301 Ga0207664_10012771 3300025929 Bacteria 6012
302 Ga0207644_10008989 3300025931 Bacteria 6545
303 Ga0207690_10943520 3300025932 Unclassified 717
304 Ga0207690_10949262 3300025932 Bacteria 714
305 Ga0207706_10104420 3300025933 Bacteria 2493
306 Ga0207706_10366370 3300025933 Bacteria 1252
307 Ga0207706_10541893 3300025933 Bacteria 1002
308 Ga0207686_11008538 3300025934 Unclassified 676
309 Ga0207670_11022701 3300025936 Bacteria 696
310 Ga0207669_10007973 3300025937 Bacteria 4942
311 Ga0207669_10020112 3300025937 Bacteria 3492
312 Ga0207669_10145593 3300025937 Unclassified 1651
313 Ga0207669_10145970 3300025937 Bacteria 1650
314 Ga0207704_10111590 3300025938 Unclassified 1850
315 Ga0207704_10882658 3300025938 Unclassified 751
316 Ga0207704_10945226 3300025938 Bacteria 727
317 Ga0207691_10001662 3300025940 Bacteria 22005
318 Ga0207691_10004392 3300025940 Bacteria 13672
319 Ga0207691_10104044 3300025940 Bacteria 2531
320 Ga0207691_10617338 3300025940 Unclassified 917
321 Ga0207691_10673506 3300025940 Bacteria 873
322 Ga0207711_10304743 3300025941 Bacteria 1470
323 Ga0207711_10412588 3300025941 Bacteria 1255
324 Ga0207689_10023342 3300025942 Bacteria 5193
325 Ga0207689_10253127 3300025942 Bacteria 1456
326 Ga0207661_10440795 3300025944 Unclassified 1185
327 Ga0207679_10269638 3300025945 Bacteria 1455
328 Ga0207679_11317188 3300025945 Unclassified 663
329 Ga0207667_10011722 3300025949 Bacteria 10168
330 Ga0207667_10095139 3300025949 Bacteria 3075
331 Ga0207651_10019262 3300025960 Bacteria 4084
332 Ga0207651_10174176 3300025960 Bacteria 1700
333 Ga0207668_10875556 3300025972 Bacteria 798
334 Ga0207640_10030616 3300025981 Bacteria 3316
335 Ga0207640_10736052 3300025981 Unclassified 849
336 Ga0207658_10000139 3300025986 Bacteria 76554
337 Ga0207658_10052905 3300025986 Bacteria 2998
338 Ga0207658_10180062 3300025986 Unclassified 1749
339 Ga0207658_10243182 3300025986 Bacteria 1526
340 Ga0207658_11543010 3300025986 Bacteria 607
341 Ga0207677_10159673 3300026023 Bacteria 1750
342 Ga0207703_10063287 3300026035 Bacteria 3033
343 Ga0207703_11823309 3300026035 Unclassified 584
344 Ga0207639_10058591 3300026041 Bacteria 2963
345 Ga0207678_10271817 3300026067 Bacteria 1453
346 Ga0207678_10328761 3300026067 Bacteria 1316
347 Ga0207708_10019479 3300026075 Bacteria 5115
348 Ga0207708_10129317 3300026075 Bacteria 1973
349 Ga0207708_10146472 3300026075 Unclassified 1856
350 Ga0207702_10201943 3300026078 Unclassified 1843
351 Ga0207702_10718202 3300026078 Bacteria 985
352 Ga0207641_10305721 3300026088 Unclassified 1504
353 Ga0207641_10486928 3300026088 Unclassified 1196
354 Ga0207641_11147195 3300026088 Bacteria 776
355 Ga0207648_10064094 3300026089 Unclassified 3203
356 Ga0207648_10066669 3300026089 Bacteria 3139
357 Ga0207648_10073668 3300026089 Unclassified 2976
358 Ga0207676_10202860 3300026095 Bacteria 1754
359 Ga0207676_10442076 3300026095 Bacteria 1224
360 Ga0207674_10032686 3300026116 Bacteria 5455
361 Ga0207674_10441417 3300026116 Bacteria 1258
362 Ga0207675_100040111 3300026118 Bacteria 4370
363 Ga0207675_100075111 3300026118 Bacteria 3163
364 Ga0207675_100229688 3300026118 Bacteria 1790
365 Ga0207683_10020977 3300026121 Bacteria 5592
366 Ga0207683_10043715 3300026121 Bacteria 3916
367 Ga0207683_10066293 3300026121 Unclassified 3183
368 Ga0207698_11656745 3300026142 Bacteria 655
369 Ga0209984_1029436 3300027424 Unclassified 774
370 Ga0209813_10403846 3300027866 Unclassified 551
371 Ga0209974_10003840 3300027876 Bacteria 5384
372 Ga0209974_10005440 3300027876 Bacteria 4479
373 Ga0207428_10002094 3300027907 Bacteria 20108
374 Ga0268266_10108479 3300028379 Bacteria 2456
375 Ga0268266_10621012 3300028379 Bacteria 1039
376 Ga0268266_11048834 3300028379 Bacteria 789
377 Ga0268265_10114674 3300028380 Bacteria 2207
378 Ga0268265_10119565 3300028380 Bacteria 2168
379 Ga0268265_11509440 3300028380 Bacteria 676
380 Ga0268265_11647191 3300028380 Bacteria 647
381 Ga0268264_11473043 3300028381 Unclassified 691
382 Ga0268264_11515570 3300028381 Unclassified 681
383 Ga0307513_10001404 3300031456 Bacteria 34652
384 Ga0307513_10433151 3300031456 Bacteria 1042
385 Ga0307408_100557506 3300031548 Bacteria 1012
386 Ga0307408_101599220 3300031548 Unclassified 619
387 Ga0307516_10017063 3300031730 Bacteria 7580
388 Ga0307405_10084853 3300031731 Bacteria 2080
389 Ga0307405_10390645 3300031731 Bacteria 1086
390 Ga0307405_10495137 3300031731 Unclassified 978
391 Ga0307405_10696986 3300031731 Bacteria 841
392 Ga0307405_10942671 3300031731 Bacteria 733
393 Ga0307405_11803692 3300031731 Unclassified 544
394 Ga0307413_10003284 3300031824 Bacteria 6783
395 Ga0307413_10771436 3300031824 Bacteria 805
396 Ga0307413_10965568 3300031824 Bacteria 728
397 Ga0307413_11026041 3300031824 Bacteria 708
398 Ga0307413_11685152 3300031824 Bacteria 565
399 Ga0307410_10026205 3300031852 Bacteria 3667
400 Ga0307410_10691355 3300031852 Bacteria 859
401 Ga0307406_10147335 3300031901 Bacteria 1675
402 Ga0307406_10988594 3300031901 Bacteria 721
403 Ga0307406_11550485 3300031901 Unclassified 584
404 Ga0307407_10012436 3300031903 Bacteria 4090
405 Ga0307407_10454785 3300031903 Bacteria 930
406 Ga0307407_10878542 3300031903 Bacteria 687
407 Ga0307407_11185810 3300031903 Unclassified 596
408 Ga0307412_10122841 3300031911 Bacteria 1872
409 Ga0307412_10457218 3300031911 Unclassified 1053
410 Ga0307412_10558397 3300031911 Bacteria 963
411 Ga0307412_10669455 3300031911 Bacteria 887
412 Ga0307412_10708161 3300031911 Bacteria 865
413 Ga0307412_10835858 3300031911 Bacteria 802
414 Ga0307409_100034210 3300031995 Bacteria 3708
415 Ga0307409_100103763 3300031995 Bacteria 2366
416 Ga0307409_101336894 3300031995 Unclassified 742
417 Ga0307409_101557797 3300031995 Unclassified 689
418 Ga0307409_102237402 3300031995 Bacteria 576
419 Ga0307416_100167915 3300032002 Unclassified 2038
420 Ga0307416_100295807 3300032002 Bacteria 1606
421 Ga0307416_100547279 3300032002 Bacteria 1230
422 Ga0307416_100630181 3300032002 Bacteria 1155
423 Ga0307416_101155217 3300032002 Bacteria 879
424 Ga0307416_102619217 3300032002 Unclassified 602
425 Ga0307414_10195381 3300032004 Bacteria 1641
426 Ga0307414_11016962 3300032004 Bacteria 763
427 Ga0307411_10054325 3300032005 Bacteria 2629
428 Ga0307411_10238306 3300032005 Bacteria 1422
429 Ga0307411_10812183 3300032005 Unclassified 824
430 Ga0307411_10957360 3300032005 Bacteria 764
431 Ga0307415_100037630 3300032126 Bacteria 3182
432 Ga0307415_100462998 3300032126 Bacteria 1099
433 Ga0307415_100849974 3300032126 Unclassified 837
434 Ga0307415_102116989 3300032126 Bacteria 549
435 Ga0307507_10165731 3300033179 Unclassified 1620
436 Ga0373952_0003586 3300035092 Bacteria 2798
437 Ga0373931_0360597 3300035691 Bacteria 912
438 Ga0373937_0119804 3300036401 Bacteria 2452
439 Ga0395899_0251062 3300037312 Bacteria 1214
440 Ga0395900_0013053 3300037418 Bacteria 8492
441 Ga0395900_0232578 3300037418 Bacteria 1853
442 Ga0395898_0232948 3300037466 Bacteria 1756
443 Ga0395905_0016092 3300037471 Bacteria 7109
444 Ga0395905_0399893 3300037471 Bacteria 1268
445 Ga0395905_0751644 3300037471 Bacteria 877
446 Ga0439436_0014978 3300041404 Bacteria 2335
447 Ga0439436_0023126 3300041404 Bacteria 1839
448 Ga0439439_0015187 3300041406 Bacteria 1878
449 Ga0439439_0131137 3300041406 Bacteria 704
450 Ga0439461_0197049 3300041410 Unclassified 540
451 Ga0439466_0159569 3300041411 Bacteria 690
452 Ga0439465_0069720 3300041413 Bacteria 1177
453 Ga0439465_0108013 3300041413 Bacteria 966
454 Ga0451789_0759691 3300041443 Bacteria 1840
455 Ga0451797_0453676 3300041453 Bacteria 1691
456 Ga0451798_0004410 3300041458 Bacteria 1197
457 Ga0451800_1406790 3300041459 Unclassified 1091
458 Ga0451802_1220979 3300041460 Unclassified 757
459 Ga0451804_0220208 3300041463 Bacteria 669
460 Ga0451807_0117306 3300041486 Bacteria 2075
461 Ga0451807_1499135 3300041486 Bacteria 541
462 Ga0451807_1642670 3300041486 Bacteria 536
463 Ga0451807_2711958 3300041486 Bacteria 997
464 Ga0451833_0435847 3300041491 Bacteria 1580
465 Ga0451837_0007243 3300041494 Bacteria 1387
466 Ga0451847_0545089 3300041503 Bacteria 944
467 Ga0451849_0388620 3300041505 Unclassified 512
468 Ga0451843_1345615 3300041509 Bacteria 2163
469 Ga0451853_0124748 3300041512 Bacteria 3630
470 Ga0451853_1130242 3300041512 Unclassified 718
471 Ga0451853_1502880 3300041512 Bacteria 1148
472 Ga0451853_1632765 3300041512 Bacteria 705
473 Ga0451853_3234389 3300041512 Unclassified 1211
474 Ga0439448_0015792 3300042005 Bacteria 2290
475 Ga0439432_003736 3300042006 Bacteria 5625
476 Ga0439432_029794 3300042006 Bacteria 1772
477 Ga0439432_052984 3300042006 Bacteria 1262
478 Ga0439449_0001228 3300042007 Bacteria 10048
479 Ga0439449_0009371 3300042007 Bacteria 3713
480 Ga0439462_0039526 3300042015 Bacteria 1258
481 Ga0439462_0116654 3300042015 Bacteria 741
482 Ga0439444_0080963 3300042437 Bacteria 711
483 Ga0439464_0065605 3300042439 Bacteria 1068
484 Ga0466972_0508028 3300044658 Unclassified 567
485 Ga0495590_0022139 3300046457 Bacteria 2249
486 Ga0495638_0005046 3300046460 Bacteria 9904
487 Ga0495638_0165390 3300046460 Bacteria 1273
488 Ga0495582_0239374 3300046473 Unclassified 1040
489 Ga0495616_0013196 3300046513 Bacteria 4668
490 Ga0495616_0136501 3300046513 Bacteria 1120
491 Ga0495616_0234468 3300046513 Unclassified 794
492 Ga0495616_0376646 3300046513 Unclassified 587
493 Ga0495630_1033934 3300046517 Unclassified 624
494 Ga0495663_0001950 3300046525 Bacteria 6353
495 Ga0495656_0028858 3300046615 Bacteria 2228
496 Ga0495656_0052134 3300046615 Bacteria 1753
497 Ga0495668_0153750 3300046616 Archaea 1260
498 Ga0495625_0007729 3300046660 Bacteria 9299
499 Ga0495625_0009779 3300046660 Bacteria 7979
500 Ga0495625_0025334 3300046660 Bacteria 4500
501 Ga0495670_0086285 3300046691 Unclassified 1603
502 Ga0495636_0003323 3300047318 Bacteria 6237
503 Ga0495636_0049266 3300047318 Bacteria 1761
504 Ga0495636_0077446 3300047318 Bacteria 1427
505 Ga0495636_0150413 3300047318 Bacteria 1044
506 Ga0495636_0156002 3300047318 Unclassified 1026
507 Ga0495686_0424512 3300047472 Unclassified 710
508 Ga0495593_0204992 3300047673 Bacteria 991
509 Ga0496100_0070433 3300048903 Bacteria 2332
510 Ga0496100_0605036 3300048903 Bacteria 851
511 Ga0496101_0015491 3300048904 Bacteria 5141
512 Ga0496101_0603256 3300048904 Unclassified 868
513 Ga0496102_0972197 3300048905 Unclassified 770
514 Ga0496106_0485043 3300048909 Unclassified 993
515 Ga0496108_0074258 3300048911 Bacteria 2871
516 Ga0496109_0074857 3300048912 Bacteria 3113
517 Ga0496112_0175883 3300048915 Bacteria 2105
518 Ga0496112_0379277 3300048915 Unclassified 1355
519 Ga0496113_0012879 3300048916 Bacteria 5640
520 Ga0496117_0180168 3300048920 Bacteria 1215
521 Ga0496126_1091847 3300048929 Unclassified 593
522 Ga0501031_0788257 3300049568 Unclassified 609
523 Ga0501036_0548169 3300049572 Bacteria 961
524 Ga0501038_0517740 3300049574 Bacteria 911
525 Ga0501038_0537674 3300049574 Unclassified 890
526 Ga0501039_1182711 3300049575 Unclassified 592
527 Ga0501040_0436791 3300049576 Bacteria 942
528 Ga0501042_0299856 3300049578 Bacteria 1161
529 Ga0501047_0855499 3300049581 Bacteria 723
530 Ga0501067_0313185 3300049583 Bacteria 874
531 Ga0501067_0585989 3300049583 Unclassified 625
532 Ga0501068_0009993 3300049584 Bacteria 5321
533 Ga0501069_0078209 3300049585 Bacteria 1860
534 Ga0501069_0276175 3300049585 Bacteria 983
535 Ga0501070_0284812 3300049586 Bacteria 1348
536 Ga0501071_0004836 3300049587 Bacteria 8585
537 Ga0501071_0455160 3300049587 Bacteria 980
538 Ga0501073_0001347 3300049589 Bacteria 18090
539 Ga0501073_0060157 3300049589 Bacteria 2651
540 Ga0501074_0006171 3300049590 Bacteria 8650
541 Ga0501075_0512371 3300049591 Unclassified 915
542 Ga0501076_0008820 3300049592 Bacteria 7412
543 Ga0501077_0166321 3300049593 Bacteria 1401
544 Ga0501198_083276 3300049649 Bacteria 623
545 Ga0501198_111106 3300049649 Bacteria 567
546 Ga0501216_188177 3300049660 Unclassified 506
547 Ga0501217_182355 3300049661 Unclassified 645
548 Ga0501217_229488 3300049661 Bacteria 590
549 Ga0501223_085807 3300049663 Bacteria 635
550 Ga0501250_020090 3300049680 Bacteria 859
551 Ga0501079_0007324 3300049741 Bacteria 8338
552 Ga0501080_0137030 3300049742 Bacteria 2265
553 Ga0501080_0143824 3300049742 Bacteria 2204
554 Ga0501080_0363330 3300049742 Bacteria 1306
555 Ga0501083_0140547 3300049744 Bacteria 1581
556 Ga0501273_045895 3300049770 Bacteria 657
557 Ga0501274_027585 3300049771 Bacteria 625
558 nmdc:mga03n38_267998_c1 3300050490 Archaea 907
559 nmdc:mga05p37_28502_c1 3300050507 Bacteria 6808
560 nmdc:mga09592_914094_c1 3300050508 Bacteria 737
561 nmdc:mga0qj67_212377_c1 3300050509 Bacteria 1571
562 nmdc:mga06r32_259808_c1 3300050510 Bacteria 1724
563 nmdc:mga08y16_523_c1 3300050511 Bacteria 35463
564 Ga0500644_0099021 3300053088 Unclassified 1105
565 Ga0500651_0000774 3300053093 Bacteria 15630
566 Ga0500556_0103685 3300053104 Bacteria 1098
567 Ga0500616_0000029 3300053153 Bacteria 428959
568 Ga0501084_0022557 3300054114 Bacteria 5254
569 Ga0530510_0571507 3300061734 Bacteria 859
570 Ga0530510_0707563 3300061734 Unclassified 768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041505 Ga0451849_0388620 Ga0451849_0388620_148_489 109
2 3300009094 Ga0111539_10000667 Ga0111539_1000066717 110
3 3300009147 Ga0114129_10026312 Ga0114129_100263125 110
4 3300013308 Ga0157375_11267446 Ga0157375_112674461 110
5 3300014326 Ga0157380_10029420 Ga0157380_100294208 110
6 3300050507 nmdc:mga05p37_28502_c1 nmdc:mga05p37_28502_c1_4578_4910 110
7 3300050511 nmdc:mga08y16_523_c1 nmdc:mga08y16_523_c1_33755_34087 110
8 3300005327 Ga0070658_11282799 Ga0070658_112827991 112
9 3300031911 Ga0307412_10558397 Ga0307412_105583972 112
10 3300041463 Ga0451804_0220208 Ga0451804_0220208_69_497 112
11 3300041486 Ga0451807_1499135 Ga0451807_1499135_142_528 112
12 3300046616 Ga0495668_0153750 Ga0495668_0153750_658_1023 112
13 3300049649 Ga0501198_083276 Ga0501198_083276_114_500 112
14 3300053093 Ga0500651_0000774 Ga0500651_0000774_8982_9359 112
15 3300031995 Ga0307409_102237402 Ga0307409_1022374021 113
16 3300009545 Ga0105237_10098005 Ga0105237_100980054 115
17 3300009553 Ga0105249_10508376 Ga0105249_105083763 115
18 3300010375 Ga0105239_10037362 Ga0105239_100373627 115
19 3300013100 Ga0157373_10239485 Ga0157373_102394851 115
20 3300032126 Ga0307415_100037630 Ga0307415_1000376304 115
21 3300041503 Ga0451847_0545089 Ga0451847_0545089_354_713 115
22 3300006173 Ga0070716_100803890 Ga0070716_1008038902 117
23 3300031731 Ga0307405_10390645 Ga0307405_103906453 118
24 3300031911 Ga0307412_10669455 Ga0307412_106694552 118
25 3300032002 Ga0307416_100167915 Ga0307416_1001679154 118
26 3300032126 Ga0307415_100849974 Ga0307415_1008499742 118
27 3300046473 Ga0495582_0239374 Ga0495582_0239374_429_851 120
28 3300005334 Ga0068869_100294738 Ga0068869_1002947382 121
29 3300005337 Ga0070682_100059937 Ga0070682_1000599374 121
30 3300005354 Ga0070675_100053681 Ga0070675_1000536813 121
31 3300005459 Ga0068867_100062316 Ga0068867_1000623162 121
32 3300005548 Ga0070665_101178448 Ga0070665_1011784482 121
33 3300005719 Ga0068861_100030797 Ga0068861_1000307973 121
34 3300005840 Ga0068870_10086831 Ga0068870_100868311 121
35 3300009094 Ga0111539_10727130 Ga0111539_107271301 121
36 3300013306 Ga0163162_11857861 Ga0163162_118578612 121
37 3300014326 Ga0157380_10064249 Ga0157380_100642492 121
38 3300014745 Ga0157377_10697759 Ga0157377_106977592 121
39 3300025908 Ga0207643_10055809 Ga0207643_100558094 121
40 3300025923 Ga0207681_10028332 Ga0207681_100283323 121
41 3300025937 Ga0207669_10145970 Ga0207669_101459702 121
42 3300025942 Ga0207689_10253127 Ga0207689_102531272 121
43 3300026075 Ga0207708_10019479 Ga0207708_100194794 121
44 3300026089 Ga0207648_10073668 Ga0207648_100736683 121
45 3300026118 Ga0207675_100229688 Ga0207675_1002296882 121
46 3300028379 Ga0268266_11048834 Ga0268266_110488341 121
47 3300028380 Ga0268265_11509440 Ga0268265_115094401 121
48 3300028381 Ga0268264_11515570 Ga0268264_115155701 121
49 3300042439 Ga0439464_0065605 Ga0439464_0065605_671_1036 121
50 3300005337 Ga0070682_100081638 Ga0070682_1000816384 122
51 3300005337 Ga0070682_100132093 Ga0070682_1001320932 122
52 3300005341 Ga0070691_10168509 Ga0070691_101685093 122
53 3300005347 Ga0070668_100256050 Ga0070668_1002560502 122
54 3300005353 Ga0070669_100107756 Ga0070669_1001077562 122
55 3300005444 Ga0070694_100214408 Ga0070694_1002144083 122
56 3300005456 Ga0070678_100010553 Ga0070678_1000105534 122
57 3300005457 Ga0070662_100612164 Ga0070662_1006121642 122
58 3300005577 Ga0068857_100622069 Ga0068857_1006220692 122
59 3300006844 Ga0075428_100003523 Ga0075428_10000352315 122
60 3300006852 Ga0075433_10000660 Ga0075433_100006607 122
61 3300006871 Ga0075434_100030048 Ga0075434_1000300486 122
62 3300006880 Ga0075429_100195011 Ga0075429_1001950112 122
63 3300009094 Ga0111539_10077063 Ga0111539_100770632 122
64 3300014326 Ga0157380_10115115 Ga0157380_101151153 122
65 3300025944 Ga0207661_10440795 Ga0207661_104407952 122
66 3300026116 Ga0207674_10441417 Ga0207674_104414171 122
67 3300026121 Ga0207683_10020977 Ga0207683_100209775 122
68 3300027907 Ga0207428_10002094 Ga0207428_1000209419 122
69 3300031903 Ga0307407_11185810 Ga0307407_111858101 122
70 3300031995 Ga0307409_100103763 Ga0307409_1001037634 122
71 3300046460 Ga0495638_0005046 Ga0495638_0005046_3195_3563 122
72 3300046513 Ga0495616_0136501 Ga0495616_0136501_91_459 122
73 3300046660 Ga0495625_0007729 Ga0495625_0007729_139_507 122
74 3300046660 Ga0495625_0009779 Ga0495625_0009779_1062_1430 122
75 3300047472 Ga0495686_0424512 Ga0495686_0424512_322_690 122
76 3300053088 Ga0500644_0099021 Ga0500644_0099021_63_431 122
77 3300005334 Ga0068869_100555031 Ga0068869_1005550313 123
78 3300005367 Ga0070667_100000148 Ga0070667_10000014851 123
79 3300005842 Ga0068858_100340271 Ga0068858_1003402712 123
80 3300009092 Ga0105250_10025038 Ga0105250_100250383 123
81 3300009545 Ga0105237_10123329 Ga0105237_101233293 123
82 3300009553 Ga0105249_11572603 Ga0105249_115726032 123
83 3300014325 Ga0163163_10017838 Ga0163163_100178385 123
84 3300025900 Ga0207710_10032970 Ga0207710_100329703 123
85 3300025903 Ga0207680_10886281 Ga0207680_108862812 123
86 3300025941 Ga0207711_10412588 Ga0207711_104125882 123
87 3300025945 Ga0207679_11317188 Ga0207679_113171881 123
88 3300025986 Ga0207658_10000139 Ga0207658_1000013928 123
89 3300031731 Ga0307405_10696986 Ga0307405_106969861 123
90 3300049568 Ga0501031_0788257 Ga0501031_0788257_132_503 123
91 3300049572 Ga0501036_0548169 Ga0501036_0548169_484_855 123
92 3300049574 Ga0501038_0537674 Ga0501038_0537674_501_872 123
93 3300049578 Ga0501042_0299856 Ga0501042_0299856_592_963 123
94 3300049583 Ga0501067_0313185 Ga0501067_0313185_319_690 123
95 3300049584 Ga0501068_0009993 Ga0501068_0009993_4692_5063 123
96 3300049585 Ga0501069_0078209 Ga0501069_0078209_1476_1847 123
97 3300049586 Ga0501070_0284812 Ga0501070_0284812_280_651 123
98 3300049587 Ga0501071_0004836 Ga0501071_0004836_715_1086 123
99 3300049589 Ga0501073_0001347 Ga0501073_0001347_9095_9466 123
100 3300049590 Ga0501074_0006171 Ga0501074_0006171_972_1343 123
101 3300049591 Ga0501075_0512371 Ga0501075_0512371_118_489 123
102 3300049592 Ga0501076_0008820 Ga0501076_0008820_3113_3484 123
103 3300049593 Ga0501077_0166321 Ga0501077_0166321_819_1190 123
104 3300049741 Ga0501079_0007324 Ga0501079_0007324_7033_7404 123
105 3300049742 Ga0501080_0143824 Ga0501080_0143824_588_959 123
106 3300049744 Ga0501083_0140547 Ga0501083_0140547_583_954 123
107 3300054114 Ga0501084_0022557 Ga0501084_0022557_203_574 123
108 3300061734 Ga0530510_0571507 Ga0530510_0571507_421_792 123
109 3300003323 rootH1_10201361 rootH1_102013612 124
110 3300005333 Ga0070677_10007898 Ga0070677_100078984 124
111 3300005334 Ga0068869_100701310 Ga0068869_1007013102 124
112 3300005338 Ga0068868_100280599 Ga0068868_1002805993 124
113 3300005340 Ga0070689_100517908 Ga0070689_1005179082 124
114 3300005344 Ga0070661_101839435 Ga0070661_1018394351 124
115 3300005354 Ga0070675_100035409 Ga0070675_1000354092 124
116 3300005356 Ga0070674_100380243 Ga0070674_1003802431 124
117 3300005364 Ga0070673_100247104 Ga0070673_1002471043 124
118 3300005367 Ga0070667_101888003 Ga0070667_1018880031 124
119 3300005434 Ga0070709_10296770 Ga0070709_102967702 124
120 3300005435 Ga0070714_100016852 Ga0070714_1000168525 124
121 3300005436 Ga0070713_100176963 Ga0070713_1001769632 124
122 3300005441 Ga0070700_100657870 Ga0070700_1006578702 124
123 3300005455 Ga0070663_100806992 Ga0070663_1008069922 124
124 3300005530 Ga0070679_100321909 Ga0070679_1003219092 124
125 3300005544 Ga0070686_100065396 Ga0070686_1000653964 124
126 3300005564 Ga0070664_100658944 Ga0070664_1006589442 124
127 3300005617 Ga0068859_100115155 Ga0068859_1001151553 124
128 3300006028 Ga0070717_10542072 Ga0070717_105420721 124
129 3300006237 Ga0097621_100421704 Ga0097621_1004217042 124
130 3300006358 Ga0068871_100681449 Ga0068871_1006814492 124
131 3300006844 Ga0075428_101054669 Ga0075428_1010546692 124
132 3300006931 Ga0097620_100115157 Ga0097620_1001151573 124
133 3300009093 Ga0105240_10046238 Ga0105240_100462383 124
134 3300009094 Ga0111539_10450049 Ga0111539_104500491 124
135 3300009094 Ga0111539_10937064 Ga0111539_109370642 124
136 3300009176 Ga0105242_13293284 Ga0105242_132932841 124
137 3300013296 Ga0157374_10029150 Ga0157374_100291508 124
138 3300014326 Ga0157380_10038743 Ga0157380_100387432 124
139 3300014326 Ga0157380_10504403 Ga0157380_105044032 124
140 3300014969 Ga0157376_10576507 Ga0157376_105765072 124
141 3300025906 Ga0207699_10106140 Ga0207699_101061401 124
142 3300025913 Ga0207695_10148678 Ga0207695_101486784 124
143 3300025928 Ga0207700_10327802 Ga0207700_103278022 124
144 3300025929 Ga0207664_10012771 Ga0207664_100127715 124
145 3300026035 Ga0207703_11823309 Ga0207703_118233092 124
146 3300026067 Ga0207678_10328761 Ga0207678_103287612 124
147 3300027866 Ga0209813_10403846 Ga0209813_104038461 124
148 3300031548 Ga0307408_100557506 Ga0307408_1005575062 124
149 3300031731 Ga0307405_10084853 Ga0307405_100848532 124
150 3300031824 Ga0307413_10003284 Ga0307413_100032843 124
151 3300031852 Ga0307410_10026205 Ga0307410_100262053 124
152 3300031903 Ga0307407_10012436 Ga0307407_100124365 124
153 3300031995 Ga0307409_100034210 Ga0307409_1000342104 124
154 3300032002 Ga0307416_100547279 Ga0307416_1005472792 124
155 3300032005 Ga0307411_10238306 Ga0307411_102383063 124
156 3300032126 Ga0307415_100462998 Ga0307415_1004629982 124
157 3300041443 Ga0451789_0759691 Ga0451789_0759691_283_663 124
158 3300041453 Ga0451797_0453676 Ga0451797_0453676_189_569 124
159 3300041458 Ga0451798_0004410 Ga0451798_0004410_226_606 124
160 3300041459 Ga0451800_1406790 Ga0451800_1406790_353_733 124
161 3300041460 Ga0451802_1220979 Ga0451802_1220979_350_730 124
162 3300041486 Ga0451807_0117306 Ga0451807_0117306_277_657 124
163 3300041512 Ga0451853_0124748 Ga0451853_0124748_710_1087 124
164 3300041512 Ga0451853_1632765 Ga0451853_1632765_301_687 124
165 3300046457 Ga0495590_0022139 Ga0495590_0022139_121_501 124
166 3300046460 Ga0495638_0165390 Ga0495638_0165390_15_395 124
167 3300046513 Ga0495616_0013196 Ga0495616_0013196_2040_2423 124
168 3300046513 Ga0495616_0376646 Ga0495616_0376646_149_529 124
169 3300046660 Ga0495625_0025334 Ga0495625_0025334_3995_4378 124
170 3300048904 Ga0496101_0603256 Ga0496101_0603256_302_679 124
171 3300048905 Ga0496102_0972197 Ga0496102_0972197_263_640 124
172 3300048909 Ga0496106_0485043 Ga0496106_0485043_49_426 124
173 3300048915 Ga0496112_0379277 Ga0496112_0379277_895_1272 124
174 3300048929 Ga0496126_1091847 Ga0496126_1091847_42_416 124
175 3300049574 Ga0501038_0517740 Ga0501038_0517740_257_631 124
176 3300049575 Ga0501039_1182711 Ga0501039_1182711_80_454 124
177 3300049576 Ga0501040_0436791 Ga0501040_0436791_519_893 124
178 3300049587 Ga0501071_0455160 Ga0501071_0455160_490_864 124
179 3300049742 Ga0501080_0363330 Ga0501080_0363330_618_995 124
180 3300061734 Ga0530510_0707563 Ga0530510_0707563_167_541 124
181 3300003320 rootH2_10066473 rootH2_100664733 125
182 3300003322 rootL2_10321089 rootL2_103210893 125
183 3300003323 rootH1_10321975 rootH1_103219752 125
184 3300005290 Ga0065712_10305834 Ga0065712_103058342 125
185 3300005293 Ga0065715_10009804 Ga0065715_100098042 125
186 3300005293 Ga0065715_10040101 Ga0065715_100401013 125
187 3300005293 Ga0065715_10056605 Ga0065715_100566052 125
188 3300005295 Ga0065707_10082412 Ga0065707_100824123 125
189 3300005327 Ga0070658_10493648 Ga0070658_104936482 125
190 3300005328 Ga0070676_10477852 Ga0070676_104778521 125
191 3300005328 Ga0070676_10646191 Ga0070676_106461911 125
192 3300005328 Ga0070676_11120941 Ga0070676_111209411 125
193 3300005329 Ga0070683_100364897 Ga0070683_1003648972 125
194 3300005330 Ga0070690_100632418 Ga0070690_1006324181 125
195 3300005331 Ga0070670_100259762 Ga0070670_1002597623 125
196 3300005331 Ga0070670_102190301 Ga0070670_1021903011 125
197 3300005333 Ga0070677_10017588 Ga0070677_100175882 125
198 3300005334 Ga0068869_100021885 Ga0068869_1000218852 125
199 3300005335 Ga0070666_10091530 Ga0070666_100915302 125
200 3300005335 Ga0070666_10132730 Ga0070666_101327303 125
201 3300005335 Ga0070666_10231794 Ga0070666_102317943 125
202 3300005339 Ga0070660_100881106 Ga0070660_1008811062 125
203 3300005340 Ga0070689_100223629 Ga0070689_1002236292 125
204 3300005344 Ga0070661_100004159 Ga0070661_1000041596 125
205 3300005344 Ga0070661_100357145 Ga0070661_1003571452 125
206 3300005345 Ga0070692_10115577 Ga0070692_101155772 125
207 3300005345 Ga0070692_11068417 Ga0070692_110684171 125
208 3300005347 Ga0070668_100230299 Ga0070668_1002302992 125
209 3300005353 Ga0070669_100020764 Ga0070669_1000207646 125
210 3300005354 Ga0070675_100054937 Ga0070675_1000549375 125
211 3300005354 Ga0070675_100431225 Ga0070675_1004312253 125
212 3300005355 Ga0070671_100280943 Ga0070671_1002809432 125
213 3300005355 Ga0070671_100684135 Ga0070671_1006841352 125
214 3300005355 Ga0070671_100773588 Ga0070671_1007735882 125
215 3300005355 Ga0070671_101662693 Ga0070671_1016626931 125
216 3300005356 Ga0070674_100008337 Ga0070674_1000083376 125
217 3300005356 Ga0070674_100697341 Ga0070674_1006973412 125
218 3300005364 Ga0070673_100091877 Ga0070673_1000918774 125
219 3300005364 Ga0070673_100545249 Ga0070673_1005452492 125
220 3300005364 Ga0070673_102101481 Ga0070673_1021014811 125
221 3300005365 Ga0070688_100055638 Ga0070688_1000556384 125
222 3300005365 Ga0070688_100242569 Ga0070688_1002425691 125
223 3300005365 Ga0070688_100716808 Ga0070688_1007168082 125
224 3300005366 Ga0070659_100628684 Ga0070659_1006286842 125
225 3300005367 Ga0070667_100142885 Ga0070667_1001428855 125
226 3300005367 Ga0070667_100144445 Ga0070667_1001444453 125
227 3300005367 Ga0070667_100307611 Ga0070667_1003076112 125
228 3300005367 Ga0070667_100426897 Ga0070667_1004268972 125
229 3300005367 Ga0070667_100459687 Ga0070667_1004596872 125
230 3300005441 Ga0070700_100055666 Ga0070700_1000556663 125
231 3300005441 Ga0070700_100277862 Ga0070700_1002778622 125
232 3300005441 Ga0070700_100407766 Ga0070700_1004077662 125
233 3300005444 Ga0070694_100799568 Ga0070694_1007995681 125
234 3300005455 Ga0070663_100151042 Ga0070663_1001510422 125
235 3300005456 Ga0070678_100113421 Ga0070678_1001134213 125
236 3300005456 Ga0070678_100225205 Ga0070678_1002252051 125
237 3300005457 Ga0070662_100346272 Ga0070662_1003462723 125
238 3300005458 Ga0070681_10104554 Ga0070681_101045543 125
239 3300005459 Ga0068867_100958029 Ga0068867_1009580292 125
240 3300005466 Ga0070685_10292252 Ga0070685_102922523 125
241 3300005466 Ga0070685_10310147 Ga0070685_103101471 125
242 3300005466 Ga0070685_11115478 Ga0070685_111154782 125
243 3300005530 Ga0070679_100166754 Ga0070679_1001667545 125
244 3300005535 Ga0070684_100096206 Ga0070684_1000962063 125
245 3300005539 Ga0068853_100122912 Ga0068853_1001229123 125
246 3300005539 Ga0068853_100234260 Ga0068853_1002342602 125
247 3300005539 Ga0068853_101075088 Ga0068853_1010750882 125
248 3300005543 Ga0070672_100232676 Ga0070672_1002326763 125
249 3300005543 Ga0070672_100349612 Ga0070672_1003496122 125
250 3300005543 Ga0070672_100537078 Ga0070672_1005370782 125
251 3300005544 Ga0070686_100103789 Ga0070686_1001037894 125
252 3300005546 Ga0070696_100147176 Ga0070696_1001471763 125
253 3300005546 Ga0070696_100564845 Ga0070696_1005648452 125
254 3300005548 Ga0070665_100021723 Ga0070665_10002172311 125
255 3300005548 Ga0070665_100089718 Ga0070665_1000897182 125
256 3300005564 Ga0070664_100011825 Ga0070664_1000118256 125
257 3300005577 Ga0068857_100085257 Ga0068857_1000852574 125
258 3300005614 Ga0068856_100053838 Ga0068856_1000538382 125
259 3300005614 Ga0068856_100314532 Ga0068856_1003145323 125
260 3300005616 Ga0068852_100332885 Ga0068852_1003328852 125
261 3300005616 Ga0068852_101333958 Ga0068852_1013339582 125
262 3300005617 Ga0068859_100066758 Ga0068859_1000667583 125
263 3300005617 Ga0068859_100607461 Ga0068859_1006074612 125
264 3300005618 Ga0068864_100289956 Ga0068864_1002899563 125
265 3300005618 Ga0068864_100763401 Ga0068864_1007634011 125
266 3300005718 Ga0068866_10086952 Ga0068866_100869523 125
267 3300005718 Ga0068866_10628399 Ga0068866_106283992 125
268 3300005719 Ga0068861_100021313 Ga0068861_1000213137 125
269 3300005719 Ga0068861_100173889 Ga0068861_1001738892 125
270 3300005719 Ga0068861_100312017 Ga0068861_1003120172 125
271 3300005719 Ga0068861_100841344 Ga0068861_1008413442 125
272 3300005834 Ga0068851_10030134 Ga0068851_100301342 125
273 3300005834 Ga0068851_11033828 Ga0068851_110338281 125
274 3300005840 Ga0068870_10008453 Ga0068870_100084535 125
275 3300005840 Ga0068870_10015184 Ga0068870_100151845 125
276 3300005840 Ga0068870_10167927 Ga0068870_101679271 125
277 3300005840 Ga0068870_10704731 Ga0068870_107047312 125
278 3300005841 Ga0068863_100108994 Ga0068863_1001089944 125
279 3300005841 Ga0068863_100175844 Ga0068863_1001758442 125
280 3300005841 Ga0068863_100487787 Ga0068863_1004877873 125
281 3300005842 Ga0068858_100206462 Ga0068858_1002064622 125
282 3300005842 Ga0068858_100480449 Ga0068858_1004804493 125
283 3300005843 Ga0068860_100383974 Ga0068860_1003839742 125
284 3300005843 Ga0068860_101640900 Ga0068860_1016409002 125
285 3300005844 Ga0068862_100135414 Ga0068862_1001354143 125
286 3300005844 Ga0068862_100207068 Ga0068862_1002070682 125
287 3300005844 Ga0068862_101449075 Ga0068862_1014490752 125
288 3300005844 Ga0068862_102596944 Ga0068862_1025969441 125
289 3300006237 Ga0097621_100008803 Ga0097621_10000880312 125
290 3300006237 Ga0097621_100025028 Ga0097621_1000250285 125
291 3300006237 Ga0097621_100401233 Ga0097621_1004012332 125
292 3300006237 Ga0097621_100631178 Ga0097621_1006311781 125
293 3300006237 Ga0097621_101491935 Ga0097621_1014919351 125
294 3300006237 Ga0097621_102374149 Ga0097621_1023741491 125
295 3300006358 Ga0068871_100011256 Ga0068871_1000112564 125
296 3300006358 Ga0068871_100192365 Ga0068871_1001923652 125
297 3300006358 Ga0068871_100726279 Ga0068871_1007262792 125
298 3300006844 Ga0075428_100231061 Ga0075428_1002310612 125
299 3300006847 Ga0075431_100856489 Ga0075431_1008564892 125
300 3300006880 Ga0075429_101097059 Ga0075429_1010970592 125
301 3300006881 Ga0068865_100838378 Ga0068865_1008383782 125
302 3300006931 Ga0097620_100066757 Ga0097620_1000667573 125
303 3300006931 Ga0097620_100607456 Ga0097620_1006074562 125
304 3300009093 Ga0105240_10039201 Ga0105240_100392013 125
305 3300009098 Ga0105245_10198616 Ga0105245_101986163 125
306 3300009098 Ga0105245_10587128 Ga0105245_105871282 125
307 3300009147 Ga0114129_12348965 Ga0114129_123489652 125
308 3300009174 Ga0105241_10048168 Ga0105241_100481683 125
309 3300009174 Ga0105241_10235304 Ga0105241_102353043 125
310 3300009174 Ga0105241_10407893 Ga0105241_104078931 125
311 3300009176 Ga0105242_11094952 Ga0105242_110949521 125
312 3300009176 Ga0105242_11397824 Ga0105242_113978242 125
313 3300009177 Ga0105248_10858760 Ga0105248_108587601 125
314 3300009545 Ga0105237_10034062 Ga0105237_100340625 125
315 3300009545 Ga0105237_10110149 Ga0105237_101101492 125
316 3300009545 Ga0105237_10151186 Ga0105237_101511863 125
317 3300009551 Ga0105238_10004452 Ga0105238_100044527 125
318 3300009551 Ga0105238_10027145 Ga0105238_100271456 125
319 3300009551 Ga0105238_10074668 Ga0105238_100746685 125
320 3300009551 Ga0105238_11870870 Ga0105238_118708702 125
321 3300009553 Ga0105249_10050531 Ga0105249_100505311 125
322 3300010375 Ga0105239_10036898 Ga0105239_100368983 125
323 3300010375 Ga0105239_10703332 Ga0105239_107033322 125
324 3300011119 Ga0105246_10013662 Ga0105246_100136624 125
325 3300013100 Ga0157373_10422576 Ga0157373_104225762 125
326 3300013102 Ga0157371_10080322 Ga0157371_100803222 125
327 3300013104 Ga0157370_10132869 Ga0157370_101328692 125
328 3300013104 Ga0157370_10224099 Ga0157370_102240992 125
329 3300013105 Ga0157369_10006603 Ga0157369_100066036 125
330 3300013105 Ga0157369_10892780 Ga0157369_108927802 125
331 3300013105 Ga0157369_11286084 Ga0157369_112860841 125
332 3300013296 Ga0157374_10534876 Ga0157374_105348763 125
333 3300013297 Ga0157378_10114574 Ga0157378_101145742 125
334 3300013306 Ga0163162_10040442 Ga0163162_100404427 125
335 3300013306 Ga0163162_10071229 Ga0163162_100712296 125
336 3300013306 Ga0163162_10177117 Ga0163162_101771173 125
337 3300013306 Ga0163162_13108211 Ga0163162_131082111 125
338 3300013307 Ga0157372_10000510 Ga0157372_1000051017 125
339 3300013307 Ga0157372_10562133 Ga0157372_105621332 125
340 3300013307 Ga0157372_11263989 Ga0157372_112639892 125
341 3300013308 Ga0157375_10039071 Ga0157375_100390717 125
342 3300013308 Ga0157375_10091171 Ga0157375_100911715 125
343 3300013308 Ga0157375_11524185 Ga0157375_115241851 125
344 3300014325 Ga0163163_10000818 Ga0163163_1000081822 125
345 3300014325 Ga0163163_11501170 Ga0163163_115011701 125
346 3300014326 Ga0157380_10571763 Ga0157380_105717632 125
347 3300014326 Ga0157380_10688128 Ga0157380_106881282 125
348 3300014326 Ga0157380_11541529 Ga0157380_115415292 125
349 3300014968 Ga0157379_10608850 Ga0157379_106088503 125
350 3300014968 Ga0157379_12484156 Ga0157379_124841561 125
351 3300014969 Ga0157376_10257815 Ga0157376_102578153 125
352 3300014969 Ga0157376_10265834 Ga0157376_102658343 125
353 3300014969 Ga0157376_10285548 Ga0157376_102855482 125
354 3300017792 Ga0163161_10092270 Ga0163161_100922704 125
355 3300024227 Ga0228598_1100643 Ga0228598_11006431 125
356 3300025261 Ga0209233_1001223 Ga0209233_10012239 125
357 3300025321 Ga0207656_10297000 Ga0207656_102970002 125
358 3300025893 Ga0207682_10004381 Ga0207682_100043813 125
359 3300025893 Ga0207682_10006736 Ga0207682_100067365 125
360 3300025899 Ga0207642_10066951 Ga0207642_100669514 125
361 3300025901 Ga0207688_10861606 Ga0207688_108616061 125
362 3300025901 Ga0207688_10977955 Ga0207688_109779551 125
363 3300025903 Ga0207680_10183265 Ga0207680_101832652 125
364 3300025903 Ga0207680_10395996 Ga0207680_103959961 125
365 3300025904 Ga0207647_10039602 Ga0207647_100396025 125
366 3300025908 Ga0207643_10003323 Ga0207643_100033234 125
367 3300025908 Ga0207643_10014679 Ga0207643_100146794 125
368 3300025908 Ga0207643_10220516 Ga0207643_102205162 125
369 3300025909 Ga0207705_10765099 Ga0207705_107650992 125
370 3300025911 Ga0207654_10105515 Ga0207654_101055153 125
371 3300025912 Ga0207707_10154935 Ga0207707_101549353 125
372 3300025913 Ga0207695_10000182 Ga0207695_1000018237 125
373 3300025913 Ga0207695_10082579 Ga0207695_100825792 125
374 3300025913 Ga0207695_10345388 Ga0207695_103453882 125
375 3300025913 Ga0207695_10396907 Ga0207695_103969072 125
376 3300025914 Ga0207671_10001037 Ga0207671_100010372 125
377 3300025914 Ga0207671_10003499 Ga0207671_1000349913 125
378 3300025914 Ga0207671_10252461 Ga0207671_102524612 125
379 3300025914 Ga0207671_10538847 Ga0207671_105388472 125
380 3300025916 Ga0207663_10445414 Ga0207663_104454142 125
381 3300025917 Ga0207660_10390560 Ga0207660_103905602 125
382 3300025919 Ga0207657_10003480 Ga0207657_100034808 125
383 3300025920 Ga0207649_10003639 Ga0207649_100036396 125
384 3300025920 Ga0207649_10531616 Ga0207649_105316162 125
385 3300025921 Ga0207652_10340049 Ga0207652_103400492 125
386 3300025923 Ga0207681_10029865 Ga0207681_100298652 125
387 3300025923 Ga0207681_10069423 Ga0207681_100694233 125
388 3300025924 Ga0207694_10035408 Ga0207694_100354085 125
389 3300025924 Ga0207694_10041978 Ga0207694_100419786 125
390 3300025924 Ga0207694_10433285 Ga0207694_104332853 125
391 3300025924 Ga0207694_10650374 Ga0207694_106503742 125
392 3300025925 Ga0207650_10130520 Ga0207650_101305203 125
393 3300025925 Ga0207650_11795718 Ga0207650_117957181 125
394 3300025926 Ga0207659_10070606 Ga0207659_100706064 125
395 3300025926 Ga0207659_10418312 Ga0207659_104183122 125
396 3300025927 Ga0207687_10222958 Ga0207687_102229583 125
397 3300025927 Ga0207687_11420292 Ga0207687_114202921 125
398 3300025928 Ga0207700_10396684 Ga0207700_103966842 125
399 3300025931 Ga0207644_10008989 Ga0207644_100089897 125
400 3300025932 Ga0207690_10943520 Ga0207690_109435202 125
401 3300025932 Ga0207690_10949262 Ga0207690_109492622 125
402 3300025933 Ga0207706_10104420 Ga0207706_101044202 125
403 3300025933 Ga0207706_10366370 Ga0207706_103663701 125
404 3300025933 Ga0207706_10541893 Ga0207706_105418931 125
405 3300025934 Ga0207686_11008538 Ga0207686_110085381 125
406 3300025936 Ga0207670_11022701 Ga0207670_110227011 125
407 3300025937 Ga0207669_10007973 Ga0207669_100079733 125
408 3300025937 Ga0207669_10020112 Ga0207669_100201124 125
409 3300025937 Ga0207669_10145593 Ga0207669_101455932 125
410 3300025938 Ga0207704_10111590 Ga0207704_101115903 125
411 3300025938 Ga0207704_10882658 Ga0207704_108826582 125
412 3300025938 Ga0207704_10945226 Ga0207704_109452262 125
413 3300025940 Ga0207691_10001662 Ga0207691_100016629 125
414 3300025940 Ga0207691_10004392 Ga0207691_1000439215 125
415 3300025940 Ga0207691_10104044 Ga0207691_101040442 125
416 3300025940 Ga0207691_10617338 Ga0207691_106173382 125
417 3300025940 Ga0207691_10673506 Ga0207691_106735062 125
418 3300025941 Ga0207711_10304743 Ga0207711_103047432 125
419 3300025942 Ga0207689_10023342 Ga0207689_100233424 125
420 3300025945 Ga0207679_10269638 Ga0207679_102696382 125
421 3300025949 Ga0207667_10011722 Ga0207667_100117222 125
422 3300025949 Ga0207667_10095139 Ga0207667_100951395 125
423 3300025960 Ga0207651_10019262 Ga0207651_100192624 125
424 3300025960 Ga0207651_10174176 Ga0207651_101741763 125
425 3300025972 Ga0207668_10875556 Ga0207668_108755562 125
426 3300025981 Ga0207640_10030616 Ga0207640_100306166 125
427 3300025981 Ga0207640_10736052 Ga0207640_107360522 125
428 3300025986 Ga0207658_10052905 Ga0207658_100529052 125
429 3300025986 Ga0207658_10180062 Ga0207658_101800622 125
430 3300025986 Ga0207658_10243182 Ga0207658_102431822 125
431 3300025986 Ga0207658_11543010 Ga0207658_115430101 125
432 3300026023 Ga0207677_10159673 Ga0207677_101596733 125
433 3300026035 Ga0207703_10063287 Ga0207703_100632873 125
434 3300026041 Ga0207639_10058591 Ga0207639_100585913 125
435 3300026067 Ga0207678_10271817 Ga0207678_102718172 125
436 3300026075 Ga0207708_10129317 Ga0207708_101293173 125
437 3300026075 Ga0207708_10146472 Ga0207708_101464723 125
438 3300026078 Ga0207702_10201943 Ga0207702_102019434 125
439 3300026078 Ga0207702_10718202 Ga0207702_107182023 125
440 3300026088 Ga0207641_10305721 Ga0207641_103057211 125
441 3300026088 Ga0207641_10486928 Ga0207641_104869282 125
442 3300026088 Ga0207641_11147195 Ga0207641_111471952 125
443 3300026089 Ga0207648_10064094 Ga0207648_100640945 125
444 3300026089 Ga0207648_10066669 Ga0207648_100666693 125
445 3300026095 Ga0207676_10202860 Ga0207676_102028603 125
446 3300026095 Ga0207676_10442076 Ga0207676_104420763 125
447 3300026116 Ga0207674_10032686 Ga0207674_100326864 125
448 3300026118 Ga0207675_100040111 Ga0207675_1000401112 125
449 3300026118 Ga0207675_100075111 Ga0207675_1000751113 125
450 3300026121 Ga0207683_10043715 Ga0207683_100437154 125
451 3300026121 Ga0207683_10066293 Ga0207683_100662933 125
452 3300026142 Ga0207698_11656745 Ga0207698_116567451 125
453 3300027424 Ga0209984_1029436 Ga0209984_10294362 125
454 3300027876 Ga0209974_10003840 Ga0209974_100038408 125
455 3300027876 Ga0209974_10005440 Ga0209974_100054405 125
456 3300028379 Ga0268266_10108479 Ga0268266_101084793 125
457 3300028379 Ga0268266_10621012 Ga0268266_106210122 125
458 3300028380 Ga0268265_10114674 Ga0268265_101146743 125
459 3300028380 Ga0268265_10119565 Ga0268265_101195653 125
460 3300028380 Ga0268265_11647191 Ga0268265_116471912 125
461 3300028381 Ga0268264_11473043 Ga0268264_114730432 125
462 3300031456 Ga0307513_10001404 Ga0307513_1000140423 125
463 3300031456 Ga0307513_10433151 Ga0307513_104331512 125
464 3300031548 Ga0307408_101599220 Ga0307408_1015992202 125
465 3300031730 Ga0307516_10017063 Ga0307516_100170635 125
466 3300031731 Ga0307405_10495137 Ga0307405_104951373 125
467 3300031731 Ga0307405_10942671 Ga0307405_109426712 125
468 3300031731 Ga0307405_11803692 Ga0307405_118036922 125
469 3300031824 Ga0307413_10771436 Ga0307413_107714362 125
470 3300031824 Ga0307413_10965568 Ga0307413_109655682 125
471 3300031824 Ga0307413_11026041 Ga0307413_110260412 125
472 3300031824 Ga0307413_11685152 Ga0307413_116851522 125
473 3300031852 Ga0307410_10691355 Ga0307410_106913552 125
474 3300031901 Ga0307406_10147335 Ga0307406_101473353 125
475 3300031901 Ga0307406_10988594 Ga0307406_109885942 125
476 3300031901 Ga0307406_11550485 Ga0307406_115504851 125
477 3300031903 Ga0307407_10454785 Ga0307407_104547852 125
478 3300031903 Ga0307407_10878542 Ga0307407_108785422 125
479 3300031911 Ga0307412_10122841 Ga0307412_101228413 125
480 3300031911 Ga0307412_10457218 Ga0307412_104572182 125
481 3300031911 Ga0307412_10708161 Ga0307412_107081612 125
482 3300031911 Ga0307412_10835858 Ga0307412_108358581 125
483 3300031995 Ga0307409_101336894 Ga0307409_1013368942 125
484 3300031995 Ga0307409_101557797 Ga0307409_1015577972 125
485 3300032002 Ga0307416_100295807 Ga0307416_1002958074 125
486 3300032002 Ga0307416_100630181 Ga0307416_1006301813 125
487 3300032002 Ga0307416_101155217 Ga0307416_1011552172 125
488 3300032002 Ga0307416_102619217 Ga0307416_1026192172 125
489 3300032004 Ga0307414_10195381 Ga0307414_101953813 125
490 3300032004 Ga0307414_11016962 Ga0307414_110169622 125
491 3300032005 Ga0307411_10054325 Ga0307411_100543253 125
492 3300032005 Ga0307411_10812183 Ga0307411_108121831 125
493 3300032005 Ga0307411_10957360 Ga0307411_109573602 125
494 3300032126 Ga0307415_102116989 Ga0307415_1021169891 125
495 3300033179 Ga0307507_10165731 Ga0307507_101657312 125
496 3300035092 Ga0373952_0003586 Ga0373952_0003586_699_1097 125
497 3300035691 Ga0373931_0360597 Ga0373931_0360597_296_694 125
498 3300036401 Ga0373937_0119804 Ga0373937_0119804_1705_2082 125
499 3300037312 Ga0395899_0251062 Ga0395899_0251062_341_742 125
500 3300037418 Ga0395900_0013053 Ga0395900_0013053_5250_5651 125
501 3300037418 Ga0395900_0232578 Ga0395900_0232578_1353_1754 125
502 3300037466 Ga0395898_0232948 Ga0395898_0232948_184_585 125
503 3300037471 Ga0395905_0016092 Ga0395905_0016092_1095_1496 125
504 3300037471 Ga0395905_0399893 Ga0395905_0399893_836_1240 125
505 3300037471 Ga0395905_0751644 Ga0395905_0751644_458_859 125
506 3300041404 Ga0439436_0014978 Ga0439436_0014978_1694_2092 125
507 3300041404 Ga0439436_0023126 Ga0439436_0023126_421_819 125
508 3300041406 Ga0439439_0015187 Ga0439439_0015187_40_438 125
509 3300041406 Ga0439439_0131137 Ga0439439_0131137_110_508 125
510 3300041410 Ga0439461_0197049 Ga0439461_0197049_44_442 125
511 3300041411 Ga0439466_0159569 Ga0439466_0159569_151_549 125
512 3300041413 Ga0439465_0069720 Ga0439465_0069720_293_691 125
513 3300041413 Ga0439465_0108013 Ga0439465_0108013_133_531 125
514 3300041486 Ga0451807_1642670 Ga0451807_1642670_48_428 125
515 3300041486 Ga0451807_2711958 Ga0451807_2711958_362_739 125
516 3300041491 Ga0451833_0435847 Ga0451833_0435847_610_999 125
517 3300041494 Ga0451837_0007243 Ga0451837_0007243_526_915 125
518 3300041509 Ga0451843_1345615 Ga0451843_1345615_1360_1749 125
519 3300041512 Ga0451853_1130242 Ga0451853_1130242_293_682 125
520 3300041512 Ga0451853_1502880 Ga0451853_1502880_719_1123 125
521 3300041512 Ga0451853_3234389 Ga0451853_3234389_603_992 125
522 3300042005 Ga0439448_0015792 Ga0439448_0015792_34_411 125
523 3300042006 Ga0439432_003736 Ga0439432_003736_2288_2686 125
524 3300042006 Ga0439432_029794 Ga0439432_029794_181_579 125
525 3300042006 Ga0439432_052984 Ga0439432_052984_98_496 125
526 3300042007 Ga0439449_0001228 Ga0439449_0001228_569_994 125
527 3300042007 Ga0439449_0009371 Ga0439449_0009371_2813_3211 125
528 3300042015 Ga0439462_0039526 Ga0439462_0039526_533_931 125
529 3300042015 Ga0439462_0116654 Ga0439462_0116654_237_635 125
530 3300042437 Ga0439444_0080963 Ga0439444_0080963_42_422 125
531 3300044658 Ga0466972_0508028 Ga0466972_0508028_124_507 125
532 3300046513 Ga0495616_0234468 Ga0495616_0234468_376_774 125
533 3300046517 Ga0495630_1033934 Ga0495630_1033934_14_412 125
534 3300046525 Ga0495663_0001950 Ga0495663_0001950_3984_4382 125
535 3300046615 Ga0495656_0028858 Ga0495656_0028858_1605_2003 125
536 3300046615 Ga0495656_0052134 Ga0495656_0052134_1030_1428 125
537 3300046691 Ga0495670_0086285 Ga0495670_0086285_215_613 125
538 3300047318 Ga0495636_0003323 Ga0495636_0003323_3925_4323 125
539 3300047318 Ga0495636_0049266 Ga0495636_0049266_899_1297 125
540 3300047318 Ga0495636_0077446 Ga0495636_0077446_211_609 125
541 3300047318 Ga0495636_0150413 Ga0495636_0150413_98_496 125
542 3300047318 Ga0495636_0156002 Ga0495636_0156002_58_456 125
543 3300047673 Ga0495593_0204992 Ga0495593_0204992_574_972 125
544 3300048903 Ga0496100_0070433 Ga0496100_0070433_1234_1635 125
545 3300048903 Ga0496100_0605036 Ga0496100_0605036_160_570 125
546 3300048904 Ga0496101_0015491 Ga0496101_0015491_667_1068 125
547 3300048911 Ga0496108_0074258 Ga0496108_0074258_836_1237 125
548 3300048912 Ga0496109_0074857 Ga0496109_0074857_1768_2169 125
549 3300048915 Ga0496112_0175883 Ga0496112_0175883_644_1045 125
550 3300048916 Ga0496113_0012879 Ga0496113_0012879_658_1059 125
551 3300048920 Ga0496117_0180168 Ga0496117_0180168_410_805 125
552 3300049581 Ga0501047_0855499 Ga0501047_0855499_163_543 125
553 3300049583 Ga0501067_0585989 Ga0501067_0585989_231_611 125
554 3300049585 Ga0501069_0276175 Ga0501069_0276175_280_660 125
555 3300049589 Ga0501073_0060157 Ga0501073_0060157_156_536 125
556 3300049649 Ga0501198_111106 Ga0501198_111106_104_502 125
557 3300049660 Ga0501216_188177 Ga0501216_188177_22_447 125
558 3300049661 Ga0501217_182355 Ga0501217_182355_220_618 125
559 3300049661 Ga0501217_229488 Ga0501217_229488_60_458 125
560 3300049663 Ga0501223_085807 Ga0501223_085807_19_399 125
561 3300049680 Ga0501250_020090 Ga0501250_020090_376_774 125
562 3300049742 Ga0501080_0137030 Ga0501080_0137030_1783_2163 125
563 3300049770 Ga0501273_045895 Ga0501273_045895_45_470 125
564 3300049771 Ga0501274_027585 Ga0501274_027585_47_427 125
565 3300050490 nmdc:mga03n38_267998_c1 nmdc:mga03n38_267998_c1_118_513 125
566 3300050508 nmdc:mga09592_914094_c1 nmdc:mga09592_914094_c1_142_528 125
567 3300050509 nmdc:mga0qj67_212377_c1 nmdc:mga0qj67_212377_c1_471_857 125
568 3300050510 nmdc:mga06r32_259808_c1 nmdc:mga06r32_259808_c1_167_553 125
569 3300053104 Ga0500556_0103685 Ga0500556_0103685_279_662 125
570 3300053153 Ga0500616_0000029 Ga0500616_0000029_350593_350973 125
571 iso_pu_bacteria 2643221695 2644530152 125

Feature Viewer

pLDDT pTM Quality
67.02 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map