F464965
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 571 | 276 | 570 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300031911|Ga0307412_10558397|Ga0307412_105583972 |
| Length | 115 |
| Sequence | MTESNPHARNVGVAVGTLLASSSTLICCVLPAVMVSLGAGAALAGLVTAVPQLVWLSEHKSGAMLWRARSLPCPVDARAARSCARLRRISAILYGVSLVAYVAGATFAFLLPALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 191 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 192 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 193 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 203 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 204 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 205 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 206 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 207 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 210 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 211 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 212 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 213 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 238 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 257 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 258 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 264 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 265 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 273 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 274 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.23 |
| Nodule | 0 |
| Rhizoplane | 3.68 |
| Rhizosphere | 91.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10066473 | 3300003320 | Bacteria | 2169 |
| 2 | rootL2_10321089 | 3300003322 | Bacteria | 2443 |
| 3 | rootH1_10201361 | 3300003323 | Bacteria | 1410 |
| 4 | rootH1_10321975 | 3300003323 | Unclassified | 1564 |
| 5 | Ga0065712_10305834 | 3300005290 | Bacteria | 846 |
| 6 | Ga0065715_10009804 | 3300005293 | Bacteria | 2292 |
| 7 | Ga0065715_10040101 | 3300005293 | Bacteria | 1319 |
| 8 | Ga0065715_10056605 | 3300005293 | Bacteria | 1019 |
| 9 | Ga0065707_10082412 | 3300005295 | Bacteria | 15474 |
| 10 | Ga0070658_10493648 | 3300005327 | Bacteria | 1057 |
| 11 | Ga0070658_11282799 | 3300005327 | Unclassified | 636 |
| 12 | Ga0070676_10477852 | 3300005328 | Bacteria | 881 |
| 13 | Ga0070676_10646191 | 3300005328 | Bacteria | 767 |
| 14 | Ga0070676_11120941 | 3300005328 | Unclassified | 595 |
| 15 | Ga0070683_100364897 | 3300005329 | Bacteria | 1375 |
| 16 | Ga0070690_100632418 | 3300005330 | Bacteria | 815 |
| 17 | Ga0070670_100259762 | 3300005331 | Unclassified | 1514 |
| 18 | Ga0070670_102190301 | 3300005331 | Unclassified | 509 |
| 19 | Ga0070677_10007898 | 3300005333 | Bacteria | 3562 |
| 20 | Ga0070677_10017588 | 3300005333 | Unclassified | 2561 |
| 21 | Ga0068869_100021885 | 3300005334 | Bacteria | 4400 |
| 22 | Ga0068869_100294738 | 3300005334 | Bacteria | 1308 |
| 23 | Ga0068869_100555031 | 3300005334 | Bacteria | 965 |
| 24 | Ga0068869_100701310 | 3300005334 | Bacteria | 863 |
| 25 | Ga0070666_10091530 | 3300005335 | Bacteria | 2089 |
| 26 | Ga0070666_10132730 | 3300005335 | Bacteria | 1731 |
| 27 | Ga0070666_10231794 | 3300005335 | Unclassified | 1304 |
| 28 | Ga0070682_100059937 | 3300005337 | Bacteria | 2405 |
| 29 | Ga0070682_100081638 | 3300005337 | Unclassified | 2094 |
| 30 | Ga0070682_100132093 | 3300005337 | Bacteria | 1691 |
| 31 | Ga0068868_100280599 | 3300005338 | Bacteria | 1410 |
| 32 | Ga0070660_100881106 | 3300005339 | Unclassified | 754 |
| 33 | Ga0070689_100223629 | 3300005340 | Bacteria | 1545 |
| 34 | Ga0070689_100517908 | 3300005340 | Bacteria | 1024 |
| 35 | Ga0070691_10168509 | 3300005341 | Bacteria | 1133 |
| 36 | Ga0070661_100004159 | 3300005344 | Bacteria | 9984 |
| 37 | Ga0070661_100357145 | 3300005344 | Bacteria | 1148 |
| 38 | Ga0070661_101839435 | 3300005344 | Unclassified | 514 |
| 39 | Ga0070692_10115577 | 3300005345 | Unclassified | 1490 |
| 40 | Ga0070692_11068417 | 3300005345 | Unclassified | 568 |
| 41 | Ga0070668_100230299 | 3300005347 | Bacteria | 1531 |
| 42 | Ga0070668_100256050 | 3300005347 | Bacteria | 1454 |
| 43 | Ga0070669_100020764 | 3300005353 | Bacteria | 4692 |
| 44 | Ga0070669_100107756 | 3300005353 | Bacteria | 2111 |
| 45 | Ga0070675_100035409 | 3300005354 | Bacteria | 4056 |
| 46 | Ga0070675_100053681 | 3300005354 | Unclassified | 3315 |
| 47 | Ga0070675_100054937 | 3300005354 | Unclassified | 3277 |
| 48 | Ga0070675_100431225 | 3300005354 | Bacteria | 1180 |
| 49 | Ga0070671_100280943 | 3300005355 | Bacteria | 1416 |
| 50 | Ga0070671_100684135 | 3300005355 | Bacteria | 889 |
| 51 | Ga0070671_100773588 | 3300005355 | Bacteria | 835 |
| 52 | Ga0070671_101662693 | 3300005355 | Bacteria | 566 |
| 53 | Ga0070674_100008337 | 3300005356 | Bacteria | 6167 |
| 54 | Ga0070674_100380243 | 3300005356 | Bacteria | 1149 |
| 55 | Ga0070674_100697341 | 3300005356 | Bacteria | 868 |
| 56 | Ga0070673_100091877 | 3300005364 | Unclassified | 2481 |
| 57 | Ga0070673_100247104 | 3300005364 | Bacteria | 1553 |
| 58 | Ga0070673_100545249 | 3300005364 | Bacteria | 1053 |
| 59 | Ga0070673_102101481 | 3300005364 | Bacteria | 536 |
| 60 | Ga0070688_100055638 | 3300005365 | Unclassified | 2482 |
| 61 | Ga0070688_100242569 | 3300005365 | Bacteria | 1280 |
| 62 | Ga0070688_100716808 | 3300005365 | Bacteria | 776 |
| 63 | Ga0070659_100628684 | 3300005366 | Unclassified | 924 |
| 64 | Ga0070667_100000148 | 3300005367 | Bacteria | 87700 |
| 65 | Ga0070667_100142885 | 3300005367 | Bacteria | 2097 |
| 66 | Ga0070667_100144445 | 3300005367 | Unclassified | 2086 |
| 67 | Ga0070667_100307611 | 3300005367 | Bacteria | 1428 |
| 68 | Ga0070667_100426897 | 3300005367 | Bacteria | 1209 |
| 69 | Ga0070667_100459687 | 3300005367 | Bacteria | 1164 |
| 70 | Ga0070667_101888003 | 3300005367 | Unclassified | 562 |
| 71 | Ga0070709_10296770 | 3300005434 | Unclassified | 1179 |
| 72 | Ga0070714_100016852 | 3300005435 | Bacteria | 5909 |
| 73 | Ga0070713_100176963 | 3300005436 | Unclassified | 1915 |
| 74 | Ga0070700_100055666 | 3300005441 | Unclassified | 2476 |
| 75 | Ga0070700_100277862 | 3300005441 | Unclassified | 1213 |
| 76 | Ga0070700_100407766 | 3300005441 | Bacteria | 1024 |
| 77 | Ga0070700_100657870 | 3300005441 | Bacteria | 828 |
| 78 | Ga0070694_100214408 | 3300005444 | Unclassified | 1441 |
| 79 | Ga0070694_100799568 | 3300005444 | Bacteria | 773 |
| 80 | Ga0070663_100151042 | 3300005455 | Bacteria | 1781 |
| 81 | Ga0070663_100806992 | 3300005455 | Bacteria | 805 |
| 82 | Ga0070678_100010553 | 3300005456 | Bacteria | 5651 |
| 83 | Ga0070678_100113421 | 3300005456 | Unclassified | 2125 |
| 84 | Ga0070678_100225205 | 3300005456 | Bacteria | 1561 |
| 85 | Ga0070662_100346272 | 3300005457 | Bacteria | 1217 |
| 86 | Ga0070662_100612164 | 3300005457 | Unclassified | 917 |
| 87 | Ga0070681_10104554 | 3300005458 | Bacteria | 2774 |
| 88 | Ga0068867_100062316 | 3300005459 | Bacteria | 2771 |
| 89 | Ga0068867_100958029 | 3300005459 | Bacteria | 773 |
| 90 | Ga0070685_10292252 | 3300005466 | Bacteria | 1095 |
| 91 | Ga0070685_10310147 | 3300005466 | Bacteria | 1066 |
| 92 | Ga0070685_11115478 | 3300005466 | Unclassified | 596 |
| 93 | Ga0070679_100166754 | 3300005530 | Bacteria | 2176 |
| 94 | Ga0070679_100321909 | 3300005530 | Bacteria | 1495 |
| 95 | Ga0070684_100096206 | 3300005535 | Bacteria | 2639 |
| 96 | Ga0068853_100122912 | 3300005539 | Bacteria | 2317 |
| 97 | Ga0068853_100234260 | 3300005539 | Bacteria | 1680 |
| 98 | Ga0068853_101075088 | 3300005539 | Unclassified | 776 |
| 99 | Ga0070672_100232676 | 3300005543 | Unclassified | 1548 |
| 100 | Ga0070672_100349612 | 3300005543 | Bacteria | 1260 |
| 101 | Ga0070672_100537078 | 3300005543 | Bacteria | 1014 |
| 102 | Ga0070686_100065396 | 3300005544 | Unclassified | 2362 |
| 103 | Ga0070686_100103789 | 3300005544 | Unclassified | 1924 |
| 104 | Ga0070696_100147176 | 3300005546 | Bacteria | 1726 |
| 105 | Ga0070696_100564845 | 3300005546 | Bacteria | 913 |
| 106 | Ga0070665_100021723 | 3300005548 | Bacteria | 6453 |
| 107 | Ga0070665_100089718 | 3300005548 | Bacteria | 3080 |
| 108 | Ga0070665_101178448 | 3300005548 | Bacteria | 777 |
| 109 | Ga0070664_100011825 | 3300005564 | Bacteria | 7085 |
| 110 | Ga0070664_100658944 | 3300005564 | Bacteria | 973 |
| 111 | Ga0068857_100085257 | 3300005577 | Bacteria | 2823 |
| 112 | Ga0068857_100622069 | 3300005577 | Unclassified | 1022 |
| 113 | Ga0068856_100053838 | 3300005614 | Bacteria | 3968 |
| 114 | Ga0068856_100314532 | 3300005614 | Bacteria | 1583 |
| 115 | Ga0068852_100332885 | 3300005616 | Bacteria | 1478 |
| 116 | Ga0068852_101333958 | 3300005616 | Unclassified | 739 |
| 117 | Ga0068859_100066758 | 3300005617 | Bacteria | 3632 |
| 118 | Ga0068859_100115155 | 3300005617 | Bacteria | 2753 |
| 119 | Ga0068859_100607461 | 3300005617 | Bacteria | 1187 |
| 120 | Ga0068864_100289956 | 3300005618 | Unclassified | 1530 |
| 121 | Ga0068864_100763401 | 3300005618 | Bacteria | 948 |
| 122 | Ga0068866_10086952 | 3300005718 | Unclassified | 1693 |
| 123 | Ga0068866_10628399 | 3300005718 | Bacteria | 728 |
| 124 | Ga0068861_100021313 | 3300005719 | Bacteria | 4658 |
| 125 | Ga0068861_100030797 | 3300005719 | Unclassified | 3935 |
| 126 | Ga0068861_100173889 | 3300005719 | Bacteria | 1787 |
| 127 | Ga0068861_100312017 | 3300005719 | Bacteria | 1367 |
| 128 | Ga0068861_100841344 | 3300005719 | Bacteria | 864 |
| 129 | Ga0068851_10030134 | 3300005834 | Bacteria | 2690 |
| 130 | Ga0068851_11033828 | 3300005834 | Unclassified | 519 |
| 131 | Ga0068870_10008453 | 3300005840 | Bacteria | 4632 |
| 132 | Ga0068870_10015184 | 3300005840 | Bacteria | 3650 |
| 133 | Ga0068870_10086831 | 3300005840 | Unclassified | 1741 |
| 134 | Ga0068870_10167927 | 3300005840 | Bacteria | 1307 |
| 135 | Ga0068870_10704731 | 3300005840 | Unclassified | 697 |
| 136 | Ga0068863_100108994 | 3300005841 | Bacteria | 2636 |
| 137 | Ga0068863_100175844 | 3300005841 | Bacteria | 2054 |
| 138 | Ga0068863_100487787 | 3300005841 | Unclassified | 1212 |
| 139 | Ga0068858_100206462 | 3300005842 | Bacteria | 1859 |
| 140 | Ga0068858_100340271 | 3300005842 | Bacteria | 1436 |
| 141 | Ga0068858_100480449 | 3300005842 | Bacteria | 1199 |
| 142 | Ga0068860_100383974 | 3300005843 | Bacteria | 1387 |
| 143 | Ga0068860_101640900 | 3300005843 | Bacteria | 665 |
| 144 | Ga0068862_100135414 | 3300005844 | Bacteria | 2183 |
| 145 | Ga0068862_100207068 | 3300005844 | Bacteria | 1771 |
| 146 | Ga0068862_101449075 | 3300005844 | Bacteria | 691 |
| 147 | Ga0068862_102596944 | 3300005844 | Bacteria | 518 |
| 148 | Ga0070717_10542072 | 3300006028 | Unclassified | 1053 |
| 149 | Ga0070716_100803890 | 3300006173 | Bacteria | 728 |
| 150 | Ga0097621_100008803 | 3300006237 | Bacteria | 7294 |
| 151 | Ga0097621_100025028 | 3300006237 | Bacteria | 4666 |
| 152 | Ga0097621_100401233 | 3300006237 | Unclassified | 1227 |
| 153 | Ga0097621_100421704 | 3300006237 | Bacteria | 1198 |
| 154 | Ga0097621_100631178 | 3300006237 | Unclassified | 981 |
| 155 | Ga0097621_101491935 | 3300006237 | Bacteria | 641 |
| 156 | Ga0097621_102374149 | 3300006237 | Unclassified | 507 |
| 157 | Ga0068871_100011256 | 3300006358 | Bacteria | 6558 |
| 158 | Ga0068871_100192365 | 3300006358 | Bacteria | 1758 |
| 159 | Ga0068871_100681449 | 3300006358 | Unclassified | 940 |
| 160 | Ga0068871_100726279 | 3300006358 | Unclassified | 911 |
| 161 | Ga0075428_100003523 | 3300006844 | Bacteria | 17142 |
| 162 | Ga0075428_100231061 | 3300006844 | Bacteria | 1996 |
| 163 | Ga0075428_101054669 | 3300006844 | Bacteria | 859 |
| 164 | Ga0075431_100856489 | 3300006847 | Unclassified | 880 |
| 165 | Ga0075433_10000660 | 3300006852 | Bacteria | 23286 |
| 166 | Ga0075434_100030048 | 3300006871 | Bacteria | 5349 |
| 167 | Ga0075429_100195011 | 3300006880 | Unclassified | 1774 |
| 168 | Ga0075429_101097059 | 3300006880 | Bacteria | 695 |
| 169 | Ga0068865_100838378 | 3300006881 | Bacteria | 796 |
| 170 | Ga0097620_100066757 | 3300006931 | Bacteria | 3632 |
| 171 | Ga0097620_100115157 | 3300006931 | Bacteria | 2753 |
| 172 | Ga0097620_100607456 | 3300006931 | Bacteria | 1187 |
| 173 | Ga0105250_10025038 | 3300009092 | Unclassified | 2405 |
| 174 | Ga0105240_10039201 | 3300009093 | Bacteria | 6070 |
| 175 | Ga0105240_10046238 | 3300009093 | Bacteria | 5517 |
| 176 | Ga0111539_10000667 | 3300009094 | Bacteria | 44305 |
| 177 | Ga0111539_10077063 | 3300009094 | Bacteria | 3925 |
| 178 | Ga0111539_10450049 | 3300009094 | Bacteria | 1499 |
| 179 | Ga0111539_10727130 | 3300009094 | Bacteria | 1156 |
| 180 | Ga0111539_10937064 | 3300009094 | Bacteria | 1007 |
| 181 | Ga0105245_10198616 | 3300009098 | Bacteria | 1925 |
| 182 | Ga0105245_10587128 | 3300009098 | Bacteria | 1139 |
| 183 | Ga0114129_10026312 | 3300009147 | Bacteria | 8239 |
| 184 | Ga0114129_12348965 | 3300009147 | Bacteria | 639 |
| 185 | Ga0105241_10048168 | 3300009174 | Bacteria | 3242 |
| 186 | Ga0105241_10235304 | 3300009174 | Bacteria | 1546 |
| 187 | Ga0105241_10407893 | 3300009174 | Bacteria | 1193 |
| 188 | Ga0105242_11094952 | 3300009176 | Unclassified | 810 |
| 189 | Ga0105242_11397824 | 3300009176 | Bacteria | 727 |
| 190 | Ga0105242_13293284 | 3300009176 | Bacteria | 502 |
| 191 | Ga0105248_10858760 | 3300009177 | Bacteria | 1024 |
| 192 | Ga0105237_10034062 | 3300009545 | Bacteria | 5158 |
| 193 | Ga0105237_10098005 | 3300009545 | Bacteria | 2923 |
| 194 | Ga0105237_10110149 | 3300009545 | Bacteria | 2745 |
| 195 | Ga0105237_10123329 | 3300009545 | Bacteria | 2585 |
| 196 | Ga0105237_10151186 | 3300009545 | Bacteria | 2318 |
| 197 | Ga0105238_10004452 | 3300009551 | Bacteria | 13888 |
| 198 | Ga0105238_10027145 | 3300009551 | Bacteria | 5836 |
| 199 | Ga0105238_10074668 | 3300009551 | Bacteria | 3383 |
| 200 | Ga0105238_11870870 | 3300009551 | Unclassified | 633 |
| 201 | Ga0105249_10050531 | 3300009553 | Bacteria | 3790 |
| 202 | Ga0105249_10508376 | 3300009553 | Bacteria | 1251 |
| 203 | Ga0105249_11572603 | 3300009553 | Bacteria | 730 |
| 204 | Ga0105239_10036898 | 3300010375 | Bacteria | 5362 |
| 205 | Ga0105239_10037362 | 3300010375 | Bacteria | 5324 |
| 206 | Ga0105239_10703332 | 3300010375 | Bacteria | 1156 |
| 207 | Ga0105246_10013662 | 3300011119 | Bacteria | 5095 |
| 208 | Ga0157373_10239485 | 3300013100 | Bacteria | 1282 |
| 209 | Ga0157373_10422576 | 3300013100 | Bacteria | 957 |
| 210 | Ga0157371_10080322 | 3300013102 | Bacteria | 2309 |
| 211 | Ga0157370_10132869 | 3300013104 | Bacteria | 2321 |
| 212 | Ga0157370_10224099 | 3300013104 | Bacteria | 1741 |
| 213 | Ga0157369_10006603 | 3300013105 | Bacteria | 13416 |
| 214 | Ga0157369_10892780 | 3300013105 | Bacteria | 912 |
| 215 | Ga0157369_11286084 | 3300013105 | Unclassified | 746 |
| 216 | Ga0157374_10029150 | 3300013296 | Unclassified | 4994 |
| 217 | Ga0157374_10534876 | 3300013296 | Bacteria | 1179 |
| 218 | Ga0157378_10114574 | 3300013297 | Bacteria | 2476 |
| 219 | Ga0163162_10040442 | 3300013306 | Bacteria | 4662 |
| 220 | Ga0163162_10071229 | 3300013306 | Bacteria | 3529 |
| 221 | Ga0163162_10177117 | 3300013306 | Bacteria | 2258 |
| 222 | Ga0163162_11857861 | 3300013306 | Bacteria | 689 |
| 223 | Ga0163162_13108211 | 3300013306 | Bacteria | 533 |
| 224 | Ga0157372_10000510 | 3300013307 | Bacteria | 42734 |
| 225 | Ga0157372_10562133 | 3300013307 | Bacteria | 1330 |
| 226 | Ga0157372_11263989 | 3300013307 | Unclassified | 852 |
| 227 | Ga0157375_10039071 | 3300013308 | Bacteria | 4563 |
| 228 | Ga0157375_10091171 | 3300013308 | Bacteria | 3109 |
| 229 | Ga0157375_11267446 | 3300013308 | Bacteria | 866 |
| 230 | Ga0157375_11524185 | 3300013308 | Archaea | 789 |
| 231 | Ga0163163_10000818 | 3300014325 | Bacteria | 26518 |
| 232 | Ga0163163_10017838 | 3300014325 | Bacteria | 6626 |
| 233 | Ga0163163_11501170 | 3300014325 | Bacteria | 735 |
| 234 | Ga0157380_10029420 | 3300014326 | Bacteria | 4198 |
| 235 | Ga0157380_10038743 | 3300014326 | Bacteria | 3703 |
| 236 | Ga0157380_10064249 | 3300014326 | Unclassified | 2946 |
| 237 | Ga0157380_10115115 | 3300014326 | Bacteria | 2267 |
| 238 | Ga0157380_10504403 | 3300014326 | Bacteria | 1176 |
| 239 | Ga0157380_10571763 | 3300014326 | Bacteria | 1113 |
| 240 | Ga0157380_10688128 | 3300014326 | Bacteria | 1026 |
| 241 | Ga0157380_11541529 | 3300014326 | Unclassified | 719 |
| 242 | Ga0157377_10697759 | 3300014745 | Bacteria | 736 |
| 243 | Ga0157379_10608850 | 3300014968 | Bacteria | 1020 |
| 244 | Ga0157379_12484156 | 3300014968 | Bacteria | 518 |
| 245 | Ga0157376_10257815 | 3300014969 | Bacteria | 1632 |
| 246 | Ga0157376_10265834 | 3300014969 | Unclassified | 1609 |
| 247 | Ga0157376_10285548 | 3300014969 | Unclassified | 1556 |
| 248 | Ga0157376_10576507 | 3300014969 | Bacteria | 1117 |
| 249 | Ga0163161_10092270 | 3300017792 | Unclassified | 2242 |
| 250 | Ga0228598_1100643 | 3300024227 | Unclassified | 583 |
| 251 | Ga0209233_1001223 | 3300025261 | Bacteria | 10345 |
| 252 | Ga0207656_10297000 | 3300025321 | Bacteria | 799 |
| 253 | Ga0207682_10004381 | 3300025893 | Bacteria | 5914 |
| 254 | Ga0207682_10006736 | 3300025893 | Bacteria | 4614 |
| 255 | Ga0207642_10066951 | 3300025899 | Unclassified | 1693 |
| 256 | Ga0207710_10032970 | 3300025900 | Bacteria | 2270 |
| 257 | Ga0207688_10861606 | 3300025901 | Unclassified | 574 |
| 258 | Ga0207688_10977955 | 3300025901 | Bacteria | 535 |
| 259 | Ga0207680_10183265 | 3300025903 | Bacteria | 1417 |
| 260 | Ga0207680_10395996 | 3300025903 | Bacteria | 975 |
| 261 | Ga0207680_10886281 | 3300025903 | Bacteria | 640 |
| 262 | Ga0207647_10039602 | 3300025904 | Bacteria | 2972 |
| 263 | Ga0207699_10106140 | 3300025906 | Unclassified | 1792 |
| 264 | Ga0207643_10003323 | 3300025908 | Bacteria | 8670 |
| 265 | Ga0207643_10014679 | 3300025908 | Bacteria | 4258 |
| 266 | Ga0207643_10055809 | 3300025908 | Unclassified | 2247 |
| 267 | Ga0207643_10220516 | 3300025908 | Bacteria | 1160 |
| 268 | Ga0207705_10765099 | 3300025909 | Bacteria | 750 |
| 269 | Ga0207654_10105515 | 3300025911 | Bacteria | 1744 |
| 270 | Ga0207707_10154935 | 3300025912 | Bacteria | 2004 |
| 271 | Ga0207695_10000182 | 3300025913 | Bacteria | 184125 |
| 272 | Ga0207695_10082579 | 3300025913 | Unclassified | 3248 |
| 273 | Ga0207695_10148678 | 3300025913 | Bacteria | 2283 |
| 274 | Ga0207695_10345388 | 3300025913 | Unclassified | 1376 |
| 275 | Ga0207695_10396907 | 3300025913 | Bacteria | 1264 |
| 276 | Ga0207671_10001037 | 3300025914 | Bacteria | 33796 |
| 277 | Ga0207671_10003499 | 3300025914 | Bacteria | 15607 |
| 278 | Ga0207671_10252461 | 3300025914 | Bacteria | 1386 |
| 279 | Ga0207671_10538847 | 3300025914 | Bacteria | 931 |
| 280 | Ga0207663_10445414 | 3300025916 | Bacteria | 998 |
| 281 | Ga0207660_10390560 | 3300025917 | Bacteria | 1120 |
| 282 | Ga0207657_10003480 | 3300025919 | Bacteria | 16793 |
| 283 | Ga0207649_10003639 | 3300025920 | Bacteria | 8422 |
| 284 | Ga0207649_10531616 | 3300025920 | Bacteria | 898 |
| 285 | Ga0207652_10340049 | 3300025921 | Bacteria | 1355 |
| 286 | Ga0207681_10028332 | 3300025923 | Bacteria | 3628 |
| 287 | Ga0207681_10029865 | 3300025923 | Bacteria | 3548 |
| 288 | Ga0207681_10069423 | 3300025923 | Bacteria | 2451 |
| 289 | Ga0207694_10035408 | 3300025924 | Bacteria | 3829 |
| 290 | Ga0207694_10041978 | 3300025924 | Bacteria | 3526 |
| 291 | Ga0207694_10433285 | 3300025924 | Bacteria | 1096 |
| 292 | Ga0207694_10650374 | 3300025924 | Unclassified | 888 |
| 293 | Ga0207650_10130520 | 3300025925 | Unclassified | 1966 |
| 294 | Ga0207650_11795718 | 3300025925 | Unclassified | 519 |
| 295 | Ga0207659_10070606 | 3300025926 | Unclassified | 2547 |
| 296 | Ga0207659_10418312 | 3300025926 | Unclassified | 1124 |
| 297 | Ga0207687_10222958 | 3300025927 | Bacteria | 1485 |
| 298 | Ga0207687_11420292 | 3300025927 | Bacteria | 596 |
| 299 | Ga0207700_10327802 | 3300025928 | Unclassified | 1328 |
| 300 | Ga0207700_10396684 | 3300025928 | Unclassified | 1209 |
| 301 | Ga0207664_10012771 | 3300025929 | Bacteria | 6012 |
| 302 | Ga0207644_10008989 | 3300025931 | Bacteria | 6545 |
| 303 | Ga0207690_10943520 | 3300025932 | Unclassified | 717 |
| 304 | Ga0207690_10949262 | 3300025932 | Bacteria | 714 |
| 305 | Ga0207706_10104420 | 3300025933 | Bacteria | 2493 |
| 306 | Ga0207706_10366370 | 3300025933 | Bacteria | 1252 |
| 307 | Ga0207706_10541893 | 3300025933 | Bacteria | 1002 |
| 308 | Ga0207686_11008538 | 3300025934 | Unclassified | 676 |
| 309 | Ga0207670_11022701 | 3300025936 | Bacteria | 696 |
| 310 | Ga0207669_10007973 | 3300025937 | Bacteria | 4942 |
| 311 | Ga0207669_10020112 | 3300025937 | Bacteria | 3492 |
| 312 | Ga0207669_10145593 | 3300025937 | Unclassified | 1651 |
| 313 | Ga0207669_10145970 | 3300025937 | Bacteria | 1650 |
| 314 | Ga0207704_10111590 | 3300025938 | Unclassified | 1850 |
| 315 | Ga0207704_10882658 | 3300025938 | Unclassified | 751 |
| 316 | Ga0207704_10945226 | 3300025938 | Bacteria | 727 |
| 317 | Ga0207691_10001662 | 3300025940 | Bacteria | 22005 |
| 318 | Ga0207691_10004392 | 3300025940 | Bacteria | 13672 |
| 319 | Ga0207691_10104044 | 3300025940 | Bacteria | 2531 |
| 320 | Ga0207691_10617338 | 3300025940 | Unclassified | 917 |
| 321 | Ga0207691_10673506 | 3300025940 | Bacteria | 873 |
| 322 | Ga0207711_10304743 | 3300025941 | Bacteria | 1470 |
| 323 | Ga0207711_10412588 | 3300025941 | Bacteria | 1255 |
| 324 | Ga0207689_10023342 | 3300025942 | Bacteria | 5193 |
| 325 | Ga0207689_10253127 | 3300025942 | Bacteria | 1456 |
| 326 | Ga0207661_10440795 | 3300025944 | Unclassified | 1185 |
| 327 | Ga0207679_10269638 | 3300025945 | Bacteria | 1455 |
| 328 | Ga0207679_11317188 | 3300025945 | Unclassified | 663 |
| 329 | Ga0207667_10011722 | 3300025949 | Bacteria | 10168 |
| 330 | Ga0207667_10095139 | 3300025949 | Bacteria | 3075 |
| 331 | Ga0207651_10019262 | 3300025960 | Bacteria | 4084 |
| 332 | Ga0207651_10174176 | 3300025960 | Bacteria | 1700 |
| 333 | Ga0207668_10875556 | 3300025972 | Bacteria | 798 |
| 334 | Ga0207640_10030616 | 3300025981 | Bacteria | 3316 |
| 335 | Ga0207640_10736052 | 3300025981 | Unclassified | 849 |
| 336 | Ga0207658_10000139 | 3300025986 | Bacteria | 76554 |
| 337 | Ga0207658_10052905 | 3300025986 | Bacteria | 2998 |
| 338 | Ga0207658_10180062 | 3300025986 | Unclassified | 1749 |
| 339 | Ga0207658_10243182 | 3300025986 | Bacteria | 1526 |
| 340 | Ga0207658_11543010 | 3300025986 | Bacteria | 607 |
| 341 | Ga0207677_10159673 | 3300026023 | Bacteria | 1750 |
| 342 | Ga0207703_10063287 | 3300026035 | Bacteria | 3033 |
| 343 | Ga0207703_11823309 | 3300026035 | Unclassified | 584 |
| 344 | Ga0207639_10058591 | 3300026041 | Bacteria | 2963 |
| 345 | Ga0207678_10271817 | 3300026067 | Bacteria | 1453 |
| 346 | Ga0207678_10328761 | 3300026067 | Bacteria | 1316 |
| 347 | Ga0207708_10019479 | 3300026075 | Bacteria | 5115 |
| 348 | Ga0207708_10129317 | 3300026075 | Bacteria | 1973 |
| 349 | Ga0207708_10146472 | 3300026075 | Unclassified | 1856 |
| 350 | Ga0207702_10201943 | 3300026078 | Unclassified | 1843 |
| 351 | Ga0207702_10718202 | 3300026078 | Bacteria | 985 |
| 352 | Ga0207641_10305721 | 3300026088 | Unclassified | 1504 |
| 353 | Ga0207641_10486928 | 3300026088 | Unclassified | 1196 |
| 354 | Ga0207641_11147195 | 3300026088 | Bacteria | 776 |
| 355 | Ga0207648_10064094 | 3300026089 | Unclassified | 3203 |
| 356 | Ga0207648_10066669 | 3300026089 | Bacteria | 3139 |
| 357 | Ga0207648_10073668 | 3300026089 | Unclassified | 2976 |
| 358 | Ga0207676_10202860 | 3300026095 | Bacteria | 1754 |
| 359 | Ga0207676_10442076 | 3300026095 | Bacteria | 1224 |
| 360 | Ga0207674_10032686 | 3300026116 | Bacteria | 5455 |
| 361 | Ga0207674_10441417 | 3300026116 | Bacteria | 1258 |
| 362 | Ga0207675_100040111 | 3300026118 | Bacteria | 4370 |
| 363 | Ga0207675_100075111 | 3300026118 | Bacteria | 3163 |
| 364 | Ga0207675_100229688 | 3300026118 | Bacteria | 1790 |
| 365 | Ga0207683_10020977 | 3300026121 | Bacteria | 5592 |
| 366 | Ga0207683_10043715 | 3300026121 | Bacteria | 3916 |
| 367 | Ga0207683_10066293 | 3300026121 | Unclassified | 3183 |
| 368 | Ga0207698_11656745 | 3300026142 | Bacteria | 655 |
| 369 | Ga0209984_1029436 | 3300027424 | Unclassified | 774 |
| 370 | Ga0209813_10403846 | 3300027866 | Unclassified | 551 |
| 371 | Ga0209974_10003840 | 3300027876 | Bacteria | 5384 |
| 372 | Ga0209974_10005440 | 3300027876 | Bacteria | 4479 |
| 373 | Ga0207428_10002094 | 3300027907 | Bacteria | 20108 |
| 374 | Ga0268266_10108479 | 3300028379 | Bacteria | 2456 |
| 375 | Ga0268266_10621012 | 3300028379 | Bacteria | 1039 |
| 376 | Ga0268266_11048834 | 3300028379 | Bacteria | 789 |
| 377 | Ga0268265_10114674 | 3300028380 | Bacteria | 2207 |
| 378 | Ga0268265_10119565 | 3300028380 | Bacteria | 2168 |
| 379 | Ga0268265_11509440 | 3300028380 | Bacteria | 676 |
| 380 | Ga0268265_11647191 | 3300028380 | Bacteria | 647 |
| 381 | Ga0268264_11473043 | 3300028381 | Unclassified | 691 |
| 382 | Ga0268264_11515570 | 3300028381 | Unclassified | 681 |
| 383 | Ga0307513_10001404 | 3300031456 | Bacteria | 34652 |
| 384 | Ga0307513_10433151 | 3300031456 | Bacteria | 1042 |
| 385 | Ga0307408_100557506 | 3300031548 | Bacteria | 1012 |
| 386 | Ga0307408_101599220 | 3300031548 | Unclassified | 619 |
| 387 | Ga0307516_10017063 | 3300031730 | Bacteria | 7580 |
| 388 | Ga0307405_10084853 | 3300031731 | Bacteria | 2080 |
| 389 | Ga0307405_10390645 | 3300031731 | Bacteria | 1086 |
| 390 | Ga0307405_10495137 | 3300031731 | Unclassified | 978 |
| 391 | Ga0307405_10696986 | 3300031731 | Bacteria | 841 |
| 392 | Ga0307405_10942671 | 3300031731 | Bacteria | 733 |
| 393 | Ga0307405_11803692 | 3300031731 | Unclassified | 544 |
| 394 | Ga0307413_10003284 | 3300031824 | Bacteria | 6783 |
| 395 | Ga0307413_10771436 | 3300031824 | Bacteria | 805 |
| 396 | Ga0307413_10965568 | 3300031824 | Bacteria | 728 |
| 397 | Ga0307413_11026041 | 3300031824 | Bacteria | 708 |
| 398 | Ga0307413_11685152 | 3300031824 | Bacteria | 565 |
| 399 | Ga0307410_10026205 | 3300031852 | Bacteria | 3667 |
| 400 | Ga0307410_10691355 | 3300031852 | Bacteria | 859 |
| 401 | Ga0307406_10147335 | 3300031901 | Bacteria | 1675 |
| 402 | Ga0307406_10988594 | 3300031901 | Bacteria | 721 |
| 403 | Ga0307406_11550485 | 3300031901 | Unclassified | 584 |
| 404 | Ga0307407_10012436 | 3300031903 | Bacteria | 4090 |
| 405 | Ga0307407_10454785 | 3300031903 | Bacteria | 930 |
| 406 | Ga0307407_10878542 | 3300031903 | Bacteria | 687 |
| 407 | Ga0307407_11185810 | 3300031903 | Unclassified | 596 |
| 408 | Ga0307412_10122841 | 3300031911 | Bacteria | 1872 |
| 409 | Ga0307412_10457218 | 3300031911 | Unclassified | 1053 |
| 410 | Ga0307412_10558397 | 3300031911 | Bacteria | 963 |
| 411 | Ga0307412_10669455 | 3300031911 | Bacteria | 887 |
| 412 | Ga0307412_10708161 | 3300031911 | Bacteria | 865 |
| 413 | Ga0307412_10835858 | 3300031911 | Bacteria | 802 |
| 414 | Ga0307409_100034210 | 3300031995 | Bacteria | 3708 |
| 415 | Ga0307409_100103763 | 3300031995 | Bacteria | 2366 |
| 416 | Ga0307409_101336894 | 3300031995 | Unclassified | 742 |
| 417 | Ga0307409_101557797 | 3300031995 | Unclassified | 689 |
| 418 | Ga0307409_102237402 | 3300031995 | Bacteria | 576 |
| 419 | Ga0307416_100167915 | 3300032002 | Unclassified | 2038 |
| 420 | Ga0307416_100295807 | 3300032002 | Bacteria | 1606 |
| 421 | Ga0307416_100547279 | 3300032002 | Bacteria | 1230 |
| 422 | Ga0307416_100630181 | 3300032002 | Bacteria | 1155 |
| 423 | Ga0307416_101155217 | 3300032002 | Bacteria | 879 |
| 424 | Ga0307416_102619217 | 3300032002 | Unclassified | 602 |
| 425 | Ga0307414_10195381 | 3300032004 | Bacteria | 1641 |
| 426 | Ga0307414_11016962 | 3300032004 | Bacteria | 763 |
| 427 | Ga0307411_10054325 | 3300032005 | Bacteria | 2629 |
| 428 | Ga0307411_10238306 | 3300032005 | Bacteria | 1422 |
| 429 | Ga0307411_10812183 | 3300032005 | Unclassified | 824 |
| 430 | Ga0307411_10957360 | 3300032005 | Bacteria | 764 |
| 431 | Ga0307415_100037630 | 3300032126 | Bacteria | 3182 |
| 432 | Ga0307415_100462998 | 3300032126 | Bacteria | 1099 |
| 433 | Ga0307415_100849974 | 3300032126 | Unclassified | 837 |
| 434 | Ga0307415_102116989 | 3300032126 | Bacteria | 549 |
| 435 | Ga0307507_10165731 | 3300033179 | Unclassified | 1620 |
| 436 | Ga0373952_0003586 | 3300035092 | Bacteria | 2798 |
| 437 | Ga0373931_0360597 | 3300035691 | Bacteria | 912 |
| 438 | Ga0373937_0119804 | 3300036401 | Bacteria | 2452 |
| 439 | Ga0395899_0251062 | 3300037312 | Bacteria | 1214 |
| 440 | Ga0395900_0013053 | 3300037418 | Bacteria | 8492 |
| 441 | Ga0395900_0232578 | 3300037418 | Bacteria | 1853 |
| 442 | Ga0395898_0232948 | 3300037466 | Bacteria | 1756 |
| 443 | Ga0395905_0016092 | 3300037471 | Bacteria | 7109 |
| 444 | Ga0395905_0399893 | 3300037471 | Bacteria | 1268 |
| 445 | Ga0395905_0751644 | 3300037471 | Bacteria | 877 |
| 446 | Ga0439436_0014978 | 3300041404 | Bacteria | 2335 |
| 447 | Ga0439436_0023126 | 3300041404 | Bacteria | 1839 |
| 448 | Ga0439439_0015187 | 3300041406 | Bacteria | 1878 |
| 449 | Ga0439439_0131137 | 3300041406 | Bacteria | 704 |
| 450 | Ga0439461_0197049 | 3300041410 | Unclassified | 540 |
| 451 | Ga0439466_0159569 | 3300041411 | Bacteria | 690 |
| 452 | Ga0439465_0069720 | 3300041413 | Bacteria | 1177 |
| 453 | Ga0439465_0108013 | 3300041413 | Bacteria | 966 |
| 454 | Ga0451789_0759691 | 3300041443 | Bacteria | 1840 |
| 455 | Ga0451797_0453676 | 3300041453 | Bacteria | 1691 |
| 456 | Ga0451798_0004410 | 3300041458 | Bacteria | 1197 |
| 457 | Ga0451800_1406790 | 3300041459 | Unclassified | 1091 |
| 458 | Ga0451802_1220979 | 3300041460 | Unclassified | 757 |
| 459 | Ga0451804_0220208 | 3300041463 | Bacteria | 669 |
| 460 | Ga0451807_0117306 | 3300041486 | Bacteria | 2075 |
| 461 | Ga0451807_1499135 | 3300041486 | Bacteria | 541 |
| 462 | Ga0451807_1642670 | 3300041486 | Bacteria | 536 |
| 463 | Ga0451807_2711958 | 3300041486 | Bacteria | 997 |
| 464 | Ga0451833_0435847 | 3300041491 | Bacteria | 1580 |
| 465 | Ga0451837_0007243 | 3300041494 | Bacteria | 1387 |
| 466 | Ga0451847_0545089 | 3300041503 | Bacteria | 944 |
| 467 | Ga0451849_0388620 | 3300041505 | Unclassified | 512 |
| 468 | Ga0451843_1345615 | 3300041509 | Bacteria | 2163 |
| 469 | Ga0451853_0124748 | 3300041512 | Bacteria | 3630 |
| 470 | Ga0451853_1130242 | 3300041512 | Unclassified | 718 |
| 471 | Ga0451853_1502880 | 3300041512 | Bacteria | 1148 |
| 472 | Ga0451853_1632765 | 3300041512 | Bacteria | 705 |
| 473 | Ga0451853_3234389 | 3300041512 | Unclassified | 1211 |
| 474 | Ga0439448_0015792 | 3300042005 | Bacteria | 2290 |
| 475 | Ga0439432_003736 | 3300042006 | Bacteria | 5625 |
| 476 | Ga0439432_029794 | 3300042006 | Bacteria | 1772 |
| 477 | Ga0439432_052984 | 3300042006 | Bacteria | 1262 |
| 478 | Ga0439449_0001228 | 3300042007 | Bacteria | 10048 |
| 479 | Ga0439449_0009371 | 3300042007 | Bacteria | 3713 |
| 480 | Ga0439462_0039526 | 3300042015 | Bacteria | 1258 |
| 481 | Ga0439462_0116654 | 3300042015 | Bacteria | 741 |
| 482 | Ga0439444_0080963 | 3300042437 | Bacteria | 711 |
| 483 | Ga0439464_0065605 | 3300042439 | Bacteria | 1068 |
| 484 | Ga0466972_0508028 | 3300044658 | Unclassified | 567 |
| 485 | Ga0495590_0022139 | 3300046457 | Bacteria | 2249 |
| 486 | Ga0495638_0005046 | 3300046460 | Bacteria | 9904 |
| 487 | Ga0495638_0165390 | 3300046460 | Bacteria | 1273 |
| 488 | Ga0495582_0239374 | 3300046473 | Unclassified | 1040 |
| 489 | Ga0495616_0013196 | 3300046513 | Bacteria | 4668 |
| 490 | Ga0495616_0136501 | 3300046513 | Bacteria | 1120 |
| 491 | Ga0495616_0234468 | 3300046513 | Unclassified | 794 |
| 492 | Ga0495616_0376646 | 3300046513 | Unclassified | 587 |
| 493 | Ga0495630_1033934 | 3300046517 | Unclassified | 624 |
| 494 | Ga0495663_0001950 | 3300046525 | Bacteria | 6353 |
| 495 | Ga0495656_0028858 | 3300046615 | Bacteria | 2228 |
| 496 | Ga0495656_0052134 | 3300046615 | Bacteria | 1753 |
| 497 | Ga0495668_0153750 | 3300046616 | Archaea | 1260 |
| 498 | Ga0495625_0007729 | 3300046660 | Bacteria | 9299 |
| 499 | Ga0495625_0009779 | 3300046660 | Bacteria | 7979 |
| 500 | Ga0495625_0025334 | 3300046660 | Bacteria | 4500 |
| 501 | Ga0495670_0086285 | 3300046691 | Unclassified | 1603 |
| 502 | Ga0495636_0003323 | 3300047318 | Bacteria | 6237 |
| 503 | Ga0495636_0049266 | 3300047318 | Bacteria | 1761 |
| 504 | Ga0495636_0077446 | 3300047318 | Bacteria | 1427 |
| 505 | Ga0495636_0150413 | 3300047318 | Bacteria | 1044 |
| 506 | Ga0495636_0156002 | 3300047318 | Unclassified | 1026 |
| 507 | Ga0495686_0424512 | 3300047472 | Unclassified | 710 |
| 508 | Ga0495593_0204992 | 3300047673 | Bacteria | 991 |
| 509 | Ga0496100_0070433 | 3300048903 | Bacteria | 2332 |
| 510 | Ga0496100_0605036 | 3300048903 | Bacteria | 851 |
| 511 | Ga0496101_0015491 | 3300048904 | Bacteria | 5141 |
| 512 | Ga0496101_0603256 | 3300048904 | Unclassified | 868 |
| 513 | Ga0496102_0972197 | 3300048905 | Unclassified | 770 |
| 514 | Ga0496106_0485043 | 3300048909 | Unclassified | 993 |
| 515 | Ga0496108_0074258 | 3300048911 | Bacteria | 2871 |
| 516 | Ga0496109_0074857 | 3300048912 | Bacteria | 3113 |
| 517 | Ga0496112_0175883 | 3300048915 | Bacteria | 2105 |
| 518 | Ga0496112_0379277 | 3300048915 | Unclassified | 1355 |
| 519 | Ga0496113_0012879 | 3300048916 | Bacteria | 5640 |
| 520 | Ga0496117_0180168 | 3300048920 | Bacteria | 1215 |
| 521 | Ga0496126_1091847 | 3300048929 | Unclassified | 593 |
| 522 | Ga0501031_0788257 | 3300049568 | Unclassified | 609 |
| 523 | Ga0501036_0548169 | 3300049572 | Bacteria | 961 |
| 524 | Ga0501038_0517740 | 3300049574 | Bacteria | 911 |
| 525 | Ga0501038_0537674 | 3300049574 | Unclassified | 890 |
| 526 | Ga0501039_1182711 | 3300049575 | Unclassified | 592 |
| 527 | Ga0501040_0436791 | 3300049576 | Bacteria | 942 |
| 528 | Ga0501042_0299856 | 3300049578 | Bacteria | 1161 |
| 529 | Ga0501047_0855499 | 3300049581 | Bacteria | 723 |
| 530 | Ga0501067_0313185 | 3300049583 | Bacteria | 874 |
| 531 | Ga0501067_0585989 | 3300049583 | Unclassified | 625 |
| 532 | Ga0501068_0009993 | 3300049584 | Bacteria | 5321 |
| 533 | Ga0501069_0078209 | 3300049585 | Bacteria | 1860 |
| 534 | Ga0501069_0276175 | 3300049585 | Bacteria | 983 |
| 535 | Ga0501070_0284812 | 3300049586 | Bacteria | 1348 |
| 536 | Ga0501071_0004836 | 3300049587 | Bacteria | 8585 |
| 537 | Ga0501071_0455160 | 3300049587 | Bacteria | 980 |
| 538 | Ga0501073_0001347 | 3300049589 | Bacteria | 18090 |
| 539 | Ga0501073_0060157 | 3300049589 | Bacteria | 2651 |
| 540 | Ga0501074_0006171 | 3300049590 | Bacteria | 8650 |
| 541 | Ga0501075_0512371 | 3300049591 | Unclassified | 915 |
| 542 | Ga0501076_0008820 | 3300049592 | Bacteria | 7412 |
| 543 | Ga0501077_0166321 | 3300049593 | Bacteria | 1401 |
| 544 | Ga0501198_083276 | 3300049649 | Bacteria | 623 |
| 545 | Ga0501198_111106 | 3300049649 | Bacteria | 567 |
| 546 | Ga0501216_188177 | 3300049660 | Unclassified | 506 |
| 547 | Ga0501217_182355 | 3300049661 | Unclassified | 645 |
| 548 | Ga0501217_229488 | 3300049661 | Bacteria | 590 |
| 549 | Ga0501223_085807 | 3300049663 | Bacteria | 635 |
| 550 | Ga0501250_020090 | 3300049680 | Bacteria | 859 |
| 551 | Ga0501079_0007324 | 3300049741 | Bacteria | 8338 |
| 552 | Ga0501080_0137030 | 3300049742 | Bacteria | 2265 |
| 553 | Ga0501080_0143824 | 3300049742 | Bacteria | 2204 |
| 554 | Ga0501080_0363330 | 3300049742 | Bacteria | 1306 |
| 555 | Ga0501083_0140547 | 3300049744 | Bacteria | 1581 |
| 556 | Ga0501273_045895 | 3300049770 | Bacteria | 657 |
| 557 | Ga0501274_027585 | 3300049771 | Bacteria | 625 |
| 558 | nmdc:mga03n38_267998_c1 | 3300050490 | Archaea | 907 |
| 559 | nmdc:mga05p37_28502_c1 | 3300050507 | Bacteria | 6808 |
| 560 | nmdc:mga09592_914094_c1 | 3300050508 | Bacteria | 737 |
| 561 | nmdc:mga0qj67_212377_c1 | 3300050509 | Bacteria | 1571 |
| 562 | nmdc:mga06r32_259808_c1 | 3300050510 | Bacteria | 1724 |
| 563 | nmdc:mga08y16_523_c1 | 3300050511 | Bacteria | 35463 |
| 564 | Ga0500644_0099021 | 3300053088 | Unclassified | 1105 |
| 565 | Ga0500651_0000774 | 3300053093 | Bacteria | 15630 |
| 566 | Ga0500556_0103685 | 3300053104 | Bacteria | 1098 |
| 567 | Ga0500616_0000029 | 3300053153 | Bacteria | 428959 |
| 568 | Ga0501084_0022557 | 3300054114 | Bacteria | 5254 |
| 569 | Ga0530510_0571507 | 3300061734 | Bacteria | 859 |
| 570 | Ga0530510_0707563 | 3300061734 | Unclassified | 768 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041505 | Ga0451849_0388620 | Ga0451849_0388620_148_489 | 109 |
| 2 | 3300009094 | Ga0111539_10000667 | Ga0111539_1000066717 | 110 |
| 3 | 3300009147 | Ga0114129_10026312 | Ga0114129_100263125 | 110 |
| 4 | 3300013308 | Ga0157375_11267446 | Ga0157375_112674461 | 110 |
| 5 | 3300014326 | Ga0157380_10029420 | Ga0157380_100294208 | 110 |
| 6 | 3300050507 | nmdc:mga05p37_28502_c1 | nmdc:mga05p37_28502_c1_4578_4910 | 110 |
| 7 | 3300050511 | nmdc:mga08y16_523_c1 | nmdc:mga08y16_523_c1_33755_34087 | 110 |
| 8 | 3300005327 | Ga0070658_11282799 | Ga0070658_112827991 | 112 |
| 9 | 3300031911 | Ga0307412_10558397 | Ga0307412_105583972 | 112 |
| 10 | 3300041463 | Ga0451804_0220208 | Ga0451804_0220208_69_497 | 112 |
| 11 | 3300041486 | Ga0451807_1499135 | Ga0451807_1499135_142_528 | 112 |
| 12 | 3300046616 | Ga0495668_0153750 | Ga0495668_0153750_658_1023 | 112 |
| 13 | 3300049649 | Ga0501198_083276 | Ga0501198_083276_114_500 | 112 |
| 14 | 3300053093 | Ga0500651_0000774 | Ga0500651_0000774_8982_9359 | 112 |
| 15 | 3300031995 | Ga0307409_102237402 | Ga0307409_1022374021 | 113 |
| 16 | 3300009545 | Ga0105237_10098005 | Ga0105237_100980054 | 115 |
| 17 | 3300009553 | Ga0105249_10508376 | Ga0105249_105083763 | 115 |
| 18 | 3300010375 | Ga0105239_10037362 | Ga0105239_100373627 | 115 |
| 19 | 3300013100 | Ga0157373_10239485 | Ga0157373_102394851 | 115 |
| 20 | 3300032126 | Ga0307415_100037630 | Ga0307415_1000376304 | 115 |
| 21 | 3300041503 | Ga0451847_0545089 | Ga0451847_0545089_354_713 | 115 |
| 22 | 3300006173 | Ga0070716_100803890 | Ga0070716_1008038902 | 117 |
| 23 | 3300031731 | Ga0307405_10390645 | Ga0307405_103906453 | 118 |
| 24 | 3300031911 | Ga0307412_10669455 | Ga0307412_106694552 | 118 |
| 25 | 3300032002 | Ga0307416_100167915 | Ga0307416_1001679154 | 118 |
| 26 | 3300032126 | Ga0307415_100849974 | Ga0307415_1008499742 | 118 |
| 27 | 3300046473 | Ga0495582_0239374 | Ga0495582_0239374_429_851 | 120 |
| 28 | 3300005334 | Ga0068869_100294738 | Ga0068869_1002947382 | 121 |
| 29 | 3300005337 | Ga0070682_100059937 | Ga0070682_1000599374 | 121 |
| 30 | 3300005354 | Ga0070675_100053681 | Ga0070675_1000536813 | 121 |
| 31 | 3300005459 | Ga0068867_100062316 | Ga0068867_1000623162 | 121 |
| 32 | 3300005548 | Ga0070665_101178448 | Ga0070665_1011784482 | 121 |
| 33 | 3300005719 | Ga0068861_100030797 | Ga0068861_1000307973 | 121 |
| 34 | 3300005840 | Ga0068870_10086831 | Ga0068870_100868311 | 121 |
| 35 | 3300009094 | Ga0111539_10727130 | Ga0111539_107271301 | 121 |
| 36 | 3300013306 | Ga0163162_11857861 | Ga0163162_118578612 | 121 |
| 37 | 3300014326 | Ga0157380_10064249 | Ga0157380_100642492 | 121 |
| 38 | 3300014745 | Ga0157377_10697759 | Ga0157377_106977592 | 121 |
| 39 | 3300025908 | Ga0207643_10055809 | Ga0207643_100558094 | 121 |
| 40 | 3300025923 | Ga0207681_10028332 | Ga0207681_100283323 | 121 |
| 41 | 3300025937 | Ga0207669_10145970 | Ga0207669_101459702 | 121 |
| 42 | 3300025942 | Ga0207689_10253127 | Ga0207689_102531272 | 121 |
| 43 | 3300026075 | Ga0207708_10019479 | Ga0207708_100194794 | 121 |
| 44 | 3300026089 | Ga0207648_10073668 | Ga0207648_100736683 | 121 |
| 45 | 3300026118 | Ga0207675_100229688 | Ga0207675_1002296882 | 121 |
| 46 | 3300028379 | Ga0268266_11048834 | Ga0268266_110488341 | 121 |
| 47 | 3300028380 | Ga0268265_11509440 | Ga0268265_115094401 | 121 |
| 48 | 3300028381 | Ga0268264_11515570 | Ga0268264_115155701 | 121 |
| 49 | 3300042439 | Ga0439464_0065605 | Ga0439464_0065605_671_1036 | 121 |
| 50 | 3300005337 | Ga0070682_100081638 | Ga0070682_1000816384 | 122 |
| 51 | 3300005337 | Ga0070682_100132093 | Ga0070682_1001320932 | 122 |
| 52 | 3300005341 | Ga0070691_10168509 | Ga0070691_101685093 | 122 |
| 53 | 3300005347 | Ga0070668_100256050 | Ga0070668_1002560502 | 122 |
| 54 | 3300005353 | Ga0070669_100107756 | Ga0070669_1001077562 | 122 |
| 55 | 3300005444 | Ga0070694_100214408 | Ga0070694_1002144083 | 122 |
| 56 | 3300005456 | Ga0070678_100010553 | Ga0070678_1000105534 | 122 |
| 57 | 3300005457 | Ga0070662_100612164 | Ga0070662_1006121642 | 122 |
| 58 | 3300005577 | Ga0068857_100622069 | Ga0068857_1006220692 | 122 |
| 59 | 3300006844 | Ga0075428_100003523 | Ga0075428_10000352315 | 122 |
| 60 | 3300006852 | Ga0075433_10000660 | Ga0075433_100006607 | 122 |
| 61 | 3300006871 | Ga0075434_100030048 | Ga0075434_1000300486 | 122 |
| 62 | 3300006880 | Ga0075429_100195011 | Ga0075429_1001950112 | 122 |
| 63 | 3300009094 | Ga0111539_10077063 | Ga0111539_100770632 | 122 |
| 64 | 3300014326 | Ga0157380_10115115 | Ga0157380_101151153 | 122 |
| 65 | 3300025944 | Ga0207661_10440795 | Ga0207661_104407952 | 122 |
| 66 | 3300026116 | Ga0207674_10441417 | Ga0207674_104414171 | 122 |
| 67 | 3300026121 | Ga0207683_10020977 | Ga0207683_100209775 | 122 |
| 68 | 3300027907 | Ga0207428_10002094 | Ga0207428_1000209419 | 122 |
| 69 | 3300031903 | Ga0307407_11185810 | Ga0307407_111858101 | 122 |
| 70 | 3300031995 | Ga0307409_100103763 | Ga0307409_1001037634 | 122 |
| 71 | 3300046460 | Ga0495638_0005046 | Ga0495638_0005046_3195_3563 | 122 |
| 72 | 3300046513 | Ga0495616_0136501 | Ga0495616_0136501_91_459 | 122 |
| 73 | 3300046660 | Ga0495625_0007729 | Ga0495625_0007729_139_507 | 122 |
| 74 | 3300046660 | Ga0495625_0009779 | Ga0495625_0009779_1062_1430 | 122 |
| 75 | 3300047472 | Ga0495686_0424512 | Ga0495686_0424512_322_690 | 122 |
| 76 | 3300053088 | Ga0500644_0099021 | Ga0500644_0099021_63_431 | 122 |
| 77 | 3300005334 | Ga0068869_100555031 | Ga0068869_1005550313 | 123 |
| 78 | 3300005367 | Ga0070667_100000148 | Ga0070667_10000014851 | 123 |
| 79 | 3300005842 | Ga0068858_100340271 | Ga0068858_1003402712 | 123 |
| 80 | 3300009092 | Ga0105250_10025038 | Ga0105250_100250383 | 123 |
| 81 | 3300009545 | Ga0105237_10123329 | Ga0105237_101233293 | 123 |
| 82 | 3300009553 | Ga0105249_11572603 | Ga0105249_115726032 | 123 |
| 83 | 3300014325 | Ga0163163_10017838 | Ga0163163_100178385 | 123 |
| 84 | 3300025900 | Ga0207710_10032970 | Ga0207710_100329703 | 123 |
| 85 | 3300025903 | Ga0207680_10886281 | Ga0207680_108862812 | 123 |
| 86 | 3300025941 | Ga0207711_10412588 | Ga0207711_104125882 | 123 |
| 87 | 3300025945 | Ga0207679_11317188 | Ga0207679_113171881 | 123 |
| 88 | 3300025986 | Ga0207658_10000139 | Ga0207658_1000013928 | 123 |
| 89 | 3300031731 | Ga0307405_10696986 | Ga0307405_106969861 | 123 |
| 90 | 3300049568 | Ga0501031_0788257 | Ga0501031_0788257_132_503 | 123 |
| 91 | 3300049572 | Ga0501036_0548169 | Ga0501036_0548169_484_855 | 123 |
| 92 | 3300049574 | Ga0501038_0537674 | Ga0501038_0537674_501_872 | 123 |
| 93 | 3300049578 | Ga0501042_0299856 | Ga0501042_0299856_592_963 | 123 |
| 94 | 3300049583 | Ga0501067_0313185 | Ga0501067_0313185_319_690 | 123 |
| 95 | 3300049584 | Ga0501068_0009993 | Ga0501068_0009993_4692_5063 | 123 |
| 96 | 3300049585 | Ga0501069_0078209 | Ga0501069_0078209_1476_1847 | 123 |
| 97 | 3300049586 | Ga0501070_0284812 | Ga0501070_0284812_280_651 | 123 |
| 98 | 3300049587 | Ga0501071_0004836 | Ga0501071_0004836_715_1086 | 123 |
| 99 | 3300049589 | Ga0501073_0001347 | Ga0501073_0001347_9095_9466 | 123 |
| 100 | 3300049590 | Ga0501074_0006171 | Ga0501074_0006171_972_1343 | 123 |
| 101 | 3300049591 | Ga0501075_0512371 | Ga0501075_0512371_118_489 | 123 |
| 102 | 3300049592 | Ga0501076_0008820 | Ga0501076_0008820_3113_3484 | 123 |
| 103 | 3300049593 | Ga0501077_0166321 | Ga0501077_0166321_819_1190 | 123 |
| 104 | 3300049741 | Ga0501079_0007324 | Ga0501079_0007324_7033_7404 | 123 |
| 105 | 3300049742 | Ga0501080_0143824 | Ga0501080_0143824_588_959 | 123 |
| 106 | 3300049744 | Ga0501083_0140547 | Ga0501083_0140547_583_954 | 123 |
| 107 | 3300054114 | Ga0501084_0022557 | Ga0501084_0022557_203_574 | 123 |
| 108 | 3300061734 | Ga0530510_0571507 | Ga0530510_0571507_421_792 | 123 |
| 109 | 3300003323 | rootH1_10201361 | rootH1_102013612 | 124 |
| 110 | 3300005333 | Ga0070677_10007898 | Ga0070677_100078984 | 124 |
| 111 | 3300005334 | Ga0068869_100701310 | Ga0068869_1007013102 | 124 |
| 112 | 3300005338 | Ga0068868_100280599 | Ga0068868_1002805993 | 124 |
| 113 | 3300005340 | Ga0070689_100517908 | Ga0070689_1005179082 | 124 |
| 114 | 3300005344 | Ga0070661_101839435 | Ga0070661_1018394351 | 124 |
| 115 | 3300005354 | Ga0070675_100035409 | Ga0070675_1000354092 | 124 |
| 116 | 3300005356 | Ga0070674_100380243 | Ga0070674_1003802431 | 124 |
| 117 | 3300005364 | Ga0070673_100247104 | Ga0070673_1002471043 | 124 |
| 118 | 3300005367 | Ga0070667_101888003 | Ga0070667_1018880031 | 124 |
| 119 | 3300005434 | Ga0070709_10296770 | Ga0070709_102967702 | 124 |
| 120 | 3300005435 | Ga0070714_100016852 | Ga0070714_1000168525 | 124 |
| 121 | 3300005436 | Ga0070713_100176963 | Ga0070713_1001769632 | 124 |
| 122 | 3300005441 | Ga0070700_100657870 | Ga0070700_1006578702 | 124 |
| 123 | 3300005455 | Ga0070663_100806992 | Ga0070663_1008069922 | 124 |
| 124 | 3300005530 | Ga0070679_100321909 | Ga0070679_1003219092 | 124 |
| 125 | 3300005544 | Ga0070686_100065396 | Ga0070686_1000653964 | 124 |
| 126 | 3300005564 | Ga0070664_100658944 | Ga0070664_1006589442 | 124 |
| 127 | 3300005617 | Ga0068859_100115155 | Ga0068859_1001151553 | 124 |
| 128 | 3300006028 | Ga0070717_10542072 | Ga0070717_105420721 | 124 |
| 129 | 3300006237 | Ga0097621_100421704 | Ga0097621_1004217042 | 124 |
| 130 | 3300006358 | Ga0068871_100681449 | Ga0068871_1006814492 | 124 |
| 131 | 3300006844 | Ga0075428_101054669 | Ga0075428_1010546692 | 124 |
| 132 | 3300006931 | Ga0097620_100115157 | Ga0097620_1001151573 | 124 |
| 133 | 3300009093 | Ga0105240_10046238 | Ga0105240_100462383 | 124 |
| 134 | 3300009094 | Ga0111539_10450049 | Ga0111539_104500491 | 124 |
| 135 | 3300009094 | Ga0111539_10937064 | Ga0111539_109370642 | 124 |
| 136 | 3300009176 | Ga0105242_13293284 | Ga0105242_132932841 | 124 |
| 137 | 3300013296 | Ga0157374_10029150 | Ga0157374_100291508 | 124 |
| 138 | 3300014326 | Ga0157380_10038743 | Ga0157380_100387432 | 124 |
| 139 | 3300014326 | Ga0157380_10504403 | Ga0157380_105044032 | 124 |
| 140 | 3300014969 | Ga0157376_10576507 | Ga0157376_105765072 | 124 |
| 141 | 3300025906 | Ga0207699_10106140 | Ga0207699_101061401 | 124 |
| 142 | 3300025913 | Ga0207695_10148678 | Ga0207695_101486784 | 124 |
| 143 | 3300025928 | Ga0207700_10327802 | Ga0207700_103278022 | 124 |
| 144 | 3300025929 | Ga0207664_10012771 | Ga0207664_100127715 | 124 |
| 145 | 3300026035 | Ga0207703_11823309 | Ga0207703_118233092 | 124 |
| 146 | 3300026067 | Ga0207678_10328761 | Ga0207678_103287612 | 124 |
| 147 | 3300027866 | Ga0209813_10403846 | Ga0209813_104038461 | 124 |
| 148 | 3300031548 | Ga0307408_100557506 | Ga0307408_1005575062 | 124 |
| 149 | 3300031731 | Ga0307405_10084853 | Ga0307405_100848532 | 124 |
| 150 | 3300031824 | Ga0307413_10003284 | Ga0307413_100032843 | 124 |
| 151 | 3300031852 | Ga0307410_10026205 | Ga0307410_100262053 | 124 |
| 152 | 3300031903 | Ga0307407_10012436 | Ga0307407_100124365 | 124 |
| 153 | 3300031995 | Ga0307409_100034210 | Ga0307409_1000342104 | 124 |
| 154 | 3300032002 | Ga0307416_100547279 | Ga0307416_1005472792 | 124 |
| 155 | 3300032005 | Ga0307411_10238306 | Ga0307411_102383063 | 124 |
| 156 | 3300032126 | Ga0307415_100462998 | Ga0307415_1004629982 | 124 |
| 157 | 3300041443 | Ga0451789_0759691 | Ga0451789_0759691_283_663 | 124 |
| 158 | 3300041453 | Ga0451797_0453676 | Ga0451797_0453676_189_569 | 124 |
| 159 | 3300041458 | Ga0451798_0004410 | Ga0451798_0004410_226_606 | 124 |
| 160 | 3300041459 | Ga0451800_1406790 | Ga0451800_1406790_353_733 | 124 |
| 161 | 3300041460 | Ga0451802_1220979 | Ga0451802_1220979_350_730 | 124 |
| 162 | 3300041486 | Ga0451807_0117306 | Ga0451807_0117306_277_657 | 124 |
| 163 | 3300041512 | Ga0451853_0124748 | Ga0451853_0124748_710_1087 | 124 |
| 164 | 3300041512 | Ga0451853_1632765 | Ga0451853_1632765_301_687 | 124 |
| 165 | 3300046457 | Ga0495590_0022139 | Ga0495590_0022139_121_501 | 124 |
| 166 | 3300046460 | Ga0495638_0165390 | Ga0495638_0165390_15_395 | 124 |
| 167 | 3300046513 | Ga0495616_0013196 | Ga0495616_0013196_2040_2423 | 124 |
| 168 | 3300046513 | Ga0495616_0376646 | Ga0495616_0376646_149_529 | 124 |
| 169 | 3300046660 | Ga0495625_0025334 | Ga0495625_0025334_3995_4378 | 124 |
| 170 | 3300048904 | Ga0496101_0603256 | Ga0496101_0603256_302_679 | 124 |
| 171 | 3300048905 | Ga0496102_0972197 | Ga0496102_0972197_263_640 | 124 |
| 172 | 3300048909 | Ga0496106_0485043 | Ga0496106_0485043_49_426 | 124 |
| 173 | 3300048915 | Ga0496112_0379277 | Ga0496112_0379277_895_1272 | 124 |
| 174 | 3300048929 | Ga0496126_1091847 | Ga0496126_1091847_42_416 | 124 |
| 175 | 3300049574 | Ga0501038_0517740 | Ga0501038_0517740_257_631 | 124 |
| 176 | 3300049575 | Ga0501039_1182711 | Ga0501039_1182711_80_454 | 124 |
| 177 | 3300049576 | Ga0501040_0436791 | Ga0501040_0436791_519_893 | 124 |
| 178 | 3300049587 | Ga0501071_0455160 | Ga0501071_0455160_490_864 | 124 |
| 179 | 3300049742 | Ga0501080_0363330 | Ga0501080_0363330_618_995 | 124 |
| 180 | 3300061734 | Ga0530510_0707563 | Ga0530510_0707563_167_541 | 124 |
| 181 | 3300003320 | rootH2_10066473 | rootH2_100664733 | 125 |
| 182 | 3300003322 | rootL2_10321089 | rootL2_103210893 | 125 |
| 183 | 3300003323 | rootH1_10321975 | rootH1_103219752 | 125 |
| 184 | 3300005290 | Ga0065712_10305834 | Ga0065712_103058342 | 125 |
| 185 | 3300005293 | Ga0065715_10009804 | Ga0065715_100098042 | 125 |
| 186 | 3300005293 | Ga0065715_10040101 | Ga0065715_100401013 | 125 |
| 187 | 3300005293 | Ga0065715_10056605 | Ga0065715_100566052 | 125 |
| 188 | 3300005295 | Ga0065707_10082412 | Ga0065707_100824123 | 125 |
| 189 | 3300005327 | Ga0070658_10493648 | Ga0070658_104936482 | 125 |
| 190 | 3300005328 | Ga0070676_10477852 | Ga0070676_104778521 | 125 |
| 191 | 3300005328 | Ga0070676_10646191 | Ga0070676_106461911 | 125 |
| 192 | 3300005328 | Ga0070676_11120941 | Ga0070676_111209411 | 125 |
| 193 | 3300005329 | Ga0070683_100364897 | Ga0070683_1003648972 | 125 |
| 194 | 3300005330 | Ga0070690_100632418 | Ga0070690_1006324181 | 125 |
| 195 | 3300005331 | Ga0070670_100259762 | Ga0070670_1002597623 | 125 |
| 196 | 3300005331 | Ga0070670_102190301 | Ga0070670_1021903011 | 125 |
| 197 | 3300005333 | Ga0070677_10017588 | Ga0070677_100175882 | 125 |
| 198 | 3300005334 | Ga0068869_100021885 | Ga0068869_1000218852 | 125 |
| 199 | 3300005335 | Ga0070666_10091530 | Ga0070666_100915302 | 125 |
| 200 | 3300005335 | Ga0070666_10132730 | Ga0070666_101327303 | 125 |
| 201 | 3300005335 | Ga0070666_10231794 | Ga0070666_102317943 | 125 |
| 202 | 3300005339 | Ga0070660_100881106 | Ga0070660_1008811062 | 125 |
| 203 | 3300005340 | Ga0070689_100223629 | Ga0070689_1002236292 | 125 |
| 204 | 3300005344 | Ga0070661_100004159 | Ga0070661_1000041596 | 125 |
| 205 | 3300005344 | Ga0070661_100357145 | Ga0070661_1003571452 | 125 |
| 206 | 3300005345 | Ga0070692_10115577 | Ga0070692_101155772 | 125 |
| 207 | 3300005345 | Ga0070692_11068417 | Ga0070692_110684171 | 125 |
| 208 | 3300005347 | Ga0070668_100230299 | Ga0070668_1002302992 | 125 |
| 209 | 3300005353 | Ga0070669_100020764 | Ga0070669_1000207646 | 125 |
| 210 | 3300005354 | Ga0070675_100054937 | Ga0070675_1000549375 | 125 |
| 211 | 3300005354 | Ga0070675_100431225 | Ga0070675_1004312253 | 125 |
| 212 | 3300005355 | Ga0070671_100280943 | Ga0070671_1002809432 | 125 |
| 213 | 3300005355 | Ga0070671_100684135 | Ga0070671_1006841352 | 125 |
| 214 | 3300005355 | Ga0070671_100773588 | Ga0070671_1007735882 | 125 |
| 215 | 3300005355 | Ga0070671_101662693 | Ga0070671_1016626931 | 125 |
| 216 | 3300005356 | Ga0070674_100008337 | Ga0070674_1000083376 | 125 |
| 217 | 3300005356 | Ga0070674_100697341 | Ga0070674_1006973412 | 125 |
| 218 | 3300005364 | Ga0070673_100091877 | Ga0070673_1000918774 | 125 |
| 219 | 3300005364 | Ga0070673_100545249 | Ga0070673_1005452492 | 125 |
| 220 | 3300005364 | Ga0070673_102101481 | Ga0070673_1021014811 | 125 |
| 221 | 3300005365 | Ga0070688_100055638 | Ga0070688_1000556384 | 125 |
| 222 | 3300005365 | Ga0070688_100242569 | Ga0070688_1002425691 | 125 |
| 223 | 3300005365 | Ga0070688_100716808 | Ga0070688_1007168082 | 125 |
| 224 | 3300005366 | Ga0070659_100628684 | Ga0070659_1006286842 | 125 |
| 225 | 3300005367 | Ga0070667_100142885 | Ga0070667_1001428855 | 125 |
| 226 | 3300005367 | Ga0070667_100144445 | Ga0070667_1001444453 | 125 |
| 227 | 3300005367 | Ga0070667_100307611 | Ga0070667_1003076112 | 125 |
| 228 | 3300005367 | Ga0070667_100426897 | Ga0070667_1004268972 | 125 |
| 229 | 3300005367 | Ga0070667_100459687 | Ga0070667_1004596872 | 125 |
| 230 | 3300005441 | Ga0070700_100055666 | Ga0070700_1000556663 | 125 |
| 231 | 3300005441 | Ga0070700_100277862 | Ga0070700_1002778622 | 125 |
| 232 | 3300005441 | Ga0070700_100407766 | Ga0070700_1004077662 | 125 |
| 233 | 3300005444 | Ga0070694_100799568 | Ga0070694_1007995681 | 125 |
| 234 | 3300005455 | Ga0070663_100151042 | Ga0070663_1001510422 | 125 |
| 235 | 3300005456 | Ga0070678_100113421 | Ga0070678_1001134213 | 125 |
| 236 | 3300005456 | Ga0070678_100225205 | Ga0070678_1002252051 | 125 |
| 237 | 3300005457 | Ga0070662_100346272 | Ga0070662_1003462723 | 125 |
| 238 | 3300005458 | Ga0070681_10104554 | Ga0070681_101045543 | 125 |
| 239 | 3300005459 | Ga0068867_100958029 | Ga0068867_1009580292 | 125 |
| 240 | 3300005466 | Ga0070685_10292252 | Ga0070685_102922523 | 125 |
| 241 | 3300005466 | Ga0070685_10310147 | Ga0070685_103101471 | 125 |
| 242 | 3300005466 | Ga0070685_11115478 | Ga0070685_111154782 | 125 |
| 243 | 3300005530 | Ga0070679_100166754 | Ga0070679_1001667545 | 125 |
| 244 | 3300005535 | Ga0070684_100096206 | Ga0070684_1000962063 | 125 |
| 245 | 3300005539 | Ga0068853_100122912 | Ga0068853_1001229123 | 125 |
| 246 | 3300005539 | Ga0068853_100234260 | Ga0068853_1002342602 | 125 |
| 247 | 3300005539 | Ga0068853_101075088 | Ga0068853_1010750882 | 125 |
| 248 | 3300005543 | Ga0070672_100232676 | Ga0070672_1002326763 | 125 |
| 249 | 3300005543 | Ga0070672_100349612 | Ga0070672_1003496122 | 125 |
| 250 | 3300005543 | Ga0070672_100537078 | Ga0070672_1005370782 | 125 |
| 251 | 3300005544 | Ga0070686_100103789 | Ga0070686_1001037894 | 125 |
| 252 | 3300005546 | Ga0070696_100147176 | Ga0070696_1001471763 | 125 |
| 253 | 3300005546 | Ga0070696_100564845 | Ga0070696_1005648452 | 125 |
| 254 | 3300005548 | Ga0070665_100021723 | Ga0070665_10002172311 | 125 |
| 255 | 3300005548 | Ga0070665_100089718 | Ga0070665_1000897182 | 125 |
| 256 | 3300005564 | Ga0070664_100011825 | Ga0070664_1000118256 | 125 |
| 257 | 3300005577 | Ga0068857_100085257 | Ga0068857_1000852574 | 125 |
| 258 | 3300005614 | Ga0068856_100053838 | Ga0068856_1000538382 | 125 |
| 259 | 3300005614 | Ga0068856_100314532 | Ga0068856_1003145323 | 125 |
| 260 | 3300005616 | Ga0068852_100332885 | Ga0068852_1003328852 | 125 |
| 261 | 3300005616 | Ga0068852_101333958 | Ga0068852_1013339582 | 125 |
| 262 | 3300005617 | Ga0068859_100066758 | Ga0068859_1000667583 | 125 |
| 263 | 3300005617 | Ga0068859_100607461 | Ga0068859_1006074612 | 125 |
| 264 | 3300005618 | Ga0068864_100289956 | Ga0068864_1002899563 | 125 |
| 265 | 3300005618 | Ga0068864_100763401 | Ga0068864_1007634011 | 125 |
| 266 | 3300005718 | Ga0068866_10086952 | Ga0068866_100869523 | 125 |
| 267 | 3300005718 | Ga0068866_10628399 | Ga0068866_106283992 | 125 |
| 268 | 3300005719 | Ga0068861_100021313 | Ga0068861_1000213137 | 125 |
| 269 | 3300005719 | Ga0068861_100173889 | Ga0068861_1001738892 | 125 |
| 270 | 3300005719 | Ga0068861_100312017 | Ga0068861_1003120172 | 125 |
| 271 | 3300005719 | Ga0068861_100841344 | Ga0068861_1008413442 | 125 |
| 272 | 3300005834 | Ga0068851_10030134 | Ga0068851_100301342 | 125 |
| 273 | 3300005834 | Ga0068851_11033828 | Ga0068851_110338281 | 125 |
| 274 | 3300005840 | Ga0068870_10008453 | Ga0068870_100084535 | 125 |
| 275 | 3300005840 | Ga0068870_10015184 | Ga0068870_100151845 | 125 |
| 276 | 3300005840 | Ga0068870_10167927 | Ga0068870_101679271 | 125 |
| 277 | 3300005840 | Ga0068870_10704731 | Ga0068870_107047312 | 125 |
| 278 | 3300005841 | Ga0068863_100108994 | Ga0068863_1001089944 | 125 |
| 279 | 3300005841 | Ga0068863_100175844 | Ga0068863_1001758442 | 125 |
| 280 | 3300005841 | Ga0068863_100487787 | Ga0068863_1004877873 | 125 |
| 281 | 3300005842 | Ga0068858_100206462 | Ga0068858_1002064622 | 125 |
| 282 | 3300005842 | Ga0068858_100480449 | Ga0068858_1004804493 | 125 |
| 283 | 3300005843 | Ga0068860_100383974 | Ga0068860_1003839742 | 125 |
| 284 | 3300005843 | Ga0068860_101640900 | Ga0068860_1016409002 | 125 |
| 285 | 3300005844 | Ga0068862_100135414 | Ga0068862_1001354143 | 125 |
| 286 | 3300005844 | Ga0068862_100207068 | Ga0068862_1002070682 | 125 |
| 287 | 3300005844 | Ga0068862_101449075 | Ga0068862_1014490752 | 125 |
| 288 | 3300005844 | Ga0068862_102596944 | Ga0068862_1025969441 | 125 |
| 289 | 3300006237 | Ga0097621_100008803 | Ga0097621_10000880312 | 125 |
| 290 | 3300006237 | Ga0097621_100025028 | Ga0097621_1000250285 | 125 |
| 291 | 3300006237 | Ga0097621_100401233 | Ga0097621_1004012332 | 125 |
| 292 | 3300006237 | Ga0097621_100631178 | Ga0097621_1006311781 | 125 |
| 293 | 3300006237 | Ga0097621_101491935 | Ga0097621_1014919351 | 125 |
| 294 | 3300006237 | Ga0097621_102374149 | Ga0097621_1023741491 | 125 |
| 295 | 3300006358 | Ga0068871_100011256 | Ga0068871_1000112564 | 125 |
| 296 | 3300006358 | Ga0068871_100192365 | Ga0068871_1001923652 | 125 |
| 297 | 3300006358 | Ga0068871_100726279 | Ga0068871_1007262792 | 125 |
| 298 | 3300006844 | Ga0075428_100231061 | Ga0075428_1002310612 | 125 |
| 299 | 3300006847 | Ga0075431_100856489 | Ga0075431_1008564892 | 125 |
| 300 | 3300006880 | Ga0075429_101097059 | Ga0075429_1010970592 | 125 |
| 301 | 3300006881 | Ga0068865_100838378 | Ga0068865_1008383782 | 125 |
| 302 | 3300006931 | Ga0097620_100066757 | Ga0097620_1000667573 | 125 |
| 303 | 3300006931 | Ga0097620_100607456 | Ga0097620_1006074562 | 125 |
| 304 | 3300009093 | Ga0105240_10039201 | Ga0105240_100392013 | 125 |
| 305 | 3300009098 | Ga0105245_10198616 | Ga0105245_101986163 | 125 |
| 306 | 3300009098 | Ga0105245_10587128 | Ga0105245_105871282 | 125 |
| 307 | 3300009147 | Ga0114129_12348965 | Ga0114129_123489652 | 125 |
| 308 | 3300009174 | Ga0105241_10048168 | Ga0105241_100481683 | 125 |
| 309 | 3300009174 | Ga0105241_10235304 | Ga0105241_102353043 | 125 |
| 310 | 3300009174 | Ga0105241_10407893 | Ga0105241_104078931 | 125 |
| 311 | 3300009176 | Ga0105242_11094952 | Ga0105242_110949521 | 125 |
| 312 | 3300009176 | Ga0105242_11397824 | Ga0105242_113978242 | 125 |
| 313 | 3300009177 | Ga0105248_10858760 | Ga0105248_108587601 | 125 |
| 314 | 3300009545 | Ga0105237_10034062 | Ga0105237_100340625 | 125 |
| 315 | 3300009545 | Ga0105237_10110149 | Ga0105237_101101492 | 125 |
| 316 | 3300009545 | Ga0105237_10151186 | Ga0105237_101511863 | 125 |
| 317 | 3300009551 | Ga0105238_10004452 | Ga0105238_100044527 | 125 |
| 318 | 3300009551 | Ga0105238_10027145 | Ga0105238_100271456 | 125 |
| 319 | 3300009551 | Ga0105238_10074668 | Ga0105238_100746685 | 125 |
| 320 | 3300009551 | Ga0105238_11870870 | Ga0105238_118708702 | 125 |
| 321 | 3300009553 | Ga0105249_10050531 | Ga0105249_100505311 | 125 |
| 322 | 3300010375 | Ga0105239_10036898 | Ga0105239_100368983 | 125 |
| 323 | 3300010375 | Ga0105239_10703332 | Ga0105239_107033322 | 125 |
| 324 | 3300011119 | Ga0105246_10013662 | Ga0105246_100136624 | 125 |
| 325 | 3300013100 | Ga0157373_10422576 | Ga0157373_104225762 | 125 |
| 326 | 3300013102 | Ga0157371_10080322 | Ga0157371_100803222 | 125 |
| 327 | 3300013104 | Ga0157370_10132869 | Ga0157370_101328692 | 125 |
| 328 | 3300013104 | Ga0157370_10224099 | Ga0157370_102240992 | 125 |
| 329 | 3300013105 | Ga0157369_10006603 | Ga0157369_100066036 | 125 |
| 330 | 3300013105 | Ga0157369_10892780 | Ga0157369_108927802 | 125 |
| 331 | 3300013105 | Ga0157369_11286084 | Ga0157369_112860841 | 125 |
| 332 | 3300013296 | Ga0157374_10534876 | Ga0157374_105348763 | 125 |
| 333 | 3300013297 | Ga0157378_10114574 | Ga0157378_101145742 | 125 |
| 334 | 3300013306 | Ga0163162_10040442 | Ga0163162_100404427 | 125 |
| 335 | 3300013306 | Ga0163162_10071229 | Ga0163162_100712296 | 125 |
| 336 | 3300013306 | Ga0163162_10177117 | Ga0163162_101771173 | 125 |
| 337 | 3300013306 | Ga0163162_13108211 | Ga0163162_131082111 | 125 |
| 338 | 3300013307 | Ga0157372_10000510 | Ga0157372_1000051017 | 125 |
| 339 | 3300013307 | Ga0157372_10562133 | Ga0157372_105621332 | 125 |
| 340 | 3300013307 | Ga0157372_11263989 | Ga0157372_112639892 | 125 |
| 341 | 3300013308 | Ga0157375_10039071 | Ga0157375_100390717 | 125 |
| 342 | 3300013308 | Ga0157375_10091171 | Ga0157375_100911715 | 125 |
| 343 | 3300013308 | Ga0157375_11524185 | Ga0157375_115241851 | 125 |
| 344 | 3300014325 | Ga0163163_10000818 | Ga0163163_1000081822 | 125 |
| 345 | 3300014325 | Ga0163163_11501170 | Ga0163163_115011701 | 125 |
| 346 | 3300014326 | Ga0157380_10571763 | Ga0157380_105717632 | 125 |
| 347 | 3300014326 | Ga0157380_10688128 | Ga0157380_106881282 | 125 |
| 348 | 3300014326 | Ga0157380_11541529 | Ga0157380_115415292 | 125 |
| 349 | 3300014968 | Ga0157379_10608850 | Ga0157379_106088503 | 125 |
| 350 | 3300014968 | Ga0157379_12484156 | Ga0157379_124841561 | 125 |
| 351 | 3300014969 | Ga0157376_10257815 | Ga0157376_102578153 | 125 |
| 352 | 3300014969 | Ga0157376_10265834 | Ga0157376_102658343 | 125 |
| 353 | 3300014969 | Ga0157376_10285548 | Ga0157376_102855482 | 125 |
| 354 | 3300017792 | Ga0163161_10092270 | Ga0163161_100922704 | 125 |
| 355 | 3300024227 | Ga0228598_1100643 | Ga0228598_11006431 | 125 |
| 356 | 3300025261 | Ga0209233_1001223 | Ga0209233_10012239 | 125 |
| 357 | 3300025321 | Ga0207656_10297000 | Ga0207656_102970002 | 125 |
| 358 | 3300025893 | Ga0207682_10004381 | Ga0207682_100043813 | 125 |
| 359 | 3300025893 | Ga0207682_10006736 | Ga0207682_100067365 | 125 |
| 360 | 3300025899 | Ga0207642_10066951 | Ga0207642_100669514 | 125 |
| 361 | 3300025901 | Ga0207688_10861606 | Ga0207688_108616061 | 125 |
| 362 | 3300025901 | Ga0207688_10977955 | Ga0207688_109779551 | 125 |
| 363 | 3300025903 | Ga0207680_10183265 | Ga0207680_101832652 | 125 |
| 364 | 3300025903 | Ga0207680_10395996 | Ga0207680_103959961 | 125 |
| 365 | 3300025904 | Ga0207647_10039602 | Ga0207647_100396025 | 125 |
| 366 | 3300025908 | Ga0207643_10003323 | Ga0207643_100033234 | 125 |
| 367 | 3300025908 | Ga0207643_10014679 | Ga0207643_100146794 | 125 |
| 368 | 3300025908 | Ga0207643_10220516 | Ga0207643_102205162 | 125 |
| 369 | 3300025909 | Ga0207705_10765099 | Ga0207705_107650992 | 125 |
| 370 | 3300025911 | Ga0207654_10105515 | Ga0207654_101055153 | 125 |
| 371 | 3300025912 | Ga0207707_10154935 | Ga0207707_101549353 | 125 |
| 372 | 3300025913 | Ga0207695_10000182 | Ga0207695_1000018237 | 125 |
| 373 | 3300025913 | Ga0207695_10082579 | Ga0207695_100825792 | 125 |
| 374 | 3300025913 | Ga0207695_10345388 | Ga0207695_103453882 | 125 |
| 375 | 3300025913 | Ga0207695_10396907 | Ga0207695_103969072 | 125 |
| 376 | 3300025914 | Ga0207671_10001037 | Ga0207671_100010372 | 125 |
| 377 | 3300025914 | Ga0207671_10003499 | Ga0207671_1000349913 | 125 |
| 378 | 3300025914 | Ga0207671_10252461 | Ga0207671_102524612 | 125 |
| 379 | 3300025914 | Ga0207671_10538847 | Ga0207671_105388472 | 125 |
| 380 | 3300025916 | Ga0207663_10445414 | Ga0207663_104454142 | 125 |
| 381 | 3300025917 | Ga0207660_10390560 | Ga0207660_103905602 | 125 |
| 382 | 3300025919 | Ga0207657_10003480 | Ga0207657_100034808 | 125 |
| 383 | 3300025920 | Ga0207649_10003639 | Ga0207649_100036396 | 125 |
| 384 | 3300025920 | Ga0207649_10531616 | Ga0207649_105316162 | 125 |
| 385 | 3300025921 | Ga0207652_10340049 | Ga0207652_103400492 | 125 |
| 386 | 3300025923 | Ga0207681_10029865 | Ga0207681_100298652 | 125 |
| 387 | 3300025923 | Ga0207681_10069423 | Ga0207681_100694233 | 125 |
| 388 | 3300025924 | Ga0207694_10035408 | Ga0207694_100354085 | 125 |
| 389 | 3300025924 | Ga0207694_10041978 | Ga0207694_100419786 | 125 |
| 390 | 3300025924 | Ga0207694_10433285 | Ga0207694_104332853 | 125 |
| 391 | 3300025924 | Ga0207694_10650374 | Ga0207694_106503742 | 125 |
| 392 | 3300025925 | Ga0207650_10130520 | Ga0207650_101305203 | 125 |
| 393 | 3300025925 | Ga0207650_11795718 | Ga0207650_117957181 | 125 |
| 394 | 3300025926 | Ga0207659_10070606 | Ga0207659_100706064 | 125 |
| 395 | 3300025926 | Ga0207659_10418312 | Ga0207659_104183122 | 125 |
| 396 | 3300025927 | Ga0207687_10222958 | Ga0207687_102229583 | 125 |
| 397 | 3300025927 | Ga0207687_11420292 | Ga0207687_114202921 | 125 |
| 398 | 3300025928 | Ga0207700_10396684 | Ga0207700_103966842 | 125 |
| 399 | 3300025931 | Ga0207644_10008989 | Ga0207644_100089897 | 125 |
| 400 | 3300025932 | Ga0207690_10943520 | Ga0207690_109435202 | 125 |
| 401 | 3300025932 | Ga0207690_10949262 | Ga0207690_109492622 | 125 |
| 402 | 3300025933 | Ga0207706_10104420 | Ga0207706_101044202 | 125 |
| 403 | 3300025933 | Ga0207706_10366370 | Ga0207706_103663701 | 125 |
| 404 | 3300025933 | Ga0207706_10541893 | Ga0207706_105418931 | 125 |
| 405 | 3300025934 | Ga0207686_11008538 | Ga0207686_110085381 | 125 |
| 406 | 3300025936 | Ga0207670_11022701 | Ga0207670_110227011 | 125 |
| 407 | 3300025937 | Ga0207669_10007973 | Ga0207669_100079733 | 125 |
| 408 | 3300025937 | Ga0207669_10020112 | Ga0207669_100201124 | 125 |
| 409 | 3300025937 | Ga0207669_10145593 | Ga0207669_101455932 | 125 |
| 410 | 3300025938 | Ga0207704_10111590 | Ga0207704_101115903 | 125 |
| 411 | 3300025938 | Ga0207704_10882658 | Ga0207704_108826582 | 125 |
| 412 | 3300025938 | Ga0207704_10945226 | Ga0207704_109452262 | 125 |
| 413 | 3300025940 | Ga0207691_10001662 | Ga0207691_100016629 | 125 |
| 414 | 3300025940 | Ga0207691_10004392 | Ga0207691_1000439215 | 125 |
| 415 | 3300025940 | Ga0207691_10104044 | Ga0207691_101040442 | 125 |
| 416 | 3300025940 | Ga0207691_10617338 | Ga0207691_106173382 | 125 |
| 417 | 3300025940 | Ga0207691_10673506 | Ga0207691_106735062 | 125 |
| 418 | 3300025941 | Ga0207711_10304743 | Ga0207711_103047432 | 125 |
| 419 | 3300025942 | Ga0207689_10023342 | Ga0207689_100233424 | 125 |
| 420 | 3300025945 | Ga0207679_10269638 | Ga0207679_102696382 | 125 |
| 421 | 3300025949 | Ga0207667_10011722 | Ga0207667_100117222 | 125 |
| 422 | 3300025949 | Ga0207667_10095139 | Ga0207667_100951395 | 125 |
| 423 | 3300025960 | Ga0207651_10019262 | Ga0207651_100192624 | 125 |
| 424 | 3300025960 | Ga0207651_10174176 | Ga0207651_101741763 | 125 |
| 425 | 3300025972 | Ga0207668_10875556 | Ga0207668_108755562 | 125 |
| 426 | 3300025981 | Ga0207640_10030616 | Ga0207640_100306166 | 125 |
| 427 | 3300025981 | Ga0207640_10736052 | Ga0207640_107360522 | 125 |
| 428 | 3300025986 | Ga0207658_10052905 | Ga0207658_100529052 | 125 |
| 429 | 3300025986 | Ga0207658_10180062 | Ga0207658_101800622 | 125 |
| 430 | 3300025986 | Ga0207658_10243182 | Ga0207658_102431822 | 125 |
| 431 | 3300025986 | Ga0207658_11543010 | Ga0207658_115430101 | 125 |
| 432 | 3300026023 | Ga0207677_10159673 | Ga0207677_101596733 | 125 |
| 433 | 3300026035 | Ga0207703_10063287 | Ga0207703_100632873 | 125 |
| 434 | 3300026041 | Ga0207639_10058591 | Ga0207639_100585913 | 125 |
| 435 | 3300026067 | Ga0207678_10271817 | Ga0207678_102718172 | 125 |
| 436 | 3300026075 | Ga0207708_10129317 | Ga0207708_101293173 | 125 |
| 437 | 3300026075 | Ga0207708_10146472 | Ga0207708_101464723 | 125 |
| 438 | 3300026078 | Ga0207702_10201943 | Ga0207702_102019434 | 125 |
| 439 | 3300026078 | Ga0207702_10718202 | Ga0207702_107182023 | 125 |
| 440 | 3300026088 | Ga0207641_10305721 | Ga0207641_103057211 | 125 |
| 441 | 3300026088 | Ga0207641_10486928 | Ga0207641_104869282 | 125 |
| 442 | 3300026088 | Ga0207641_11147195 | Ga0207641_111471952 | 125 |
| 443 | 3300026089 | Ga0207648_10064094 | Ga0207648_100640945 | 125 |
| 444 | 3300026089 | Ga0207648_10066669 | Ga0207648_100666693 | 125 |
| 445 | 3300026095 | Ga0207676_10202860 | Ga0207676_102028603 | 125 |
| 446 | 3300026095 | Ga0207676_10442076 | Ga0207676_104420763 | 125 |
| 447 | 3300026116 | Ga0207674_10032686 | Ga0207674_100326864 | 125 |
| 448 | 3300026118 | Ga0207675_100040111 | Ga0207675_1000401112 | 125 |
| 449 | 3300026118 | Ga0207675_100075111 | Ga0207675_1000751113 | 125 |
| 450 | 3300026121 | Ga0207683_10043715 | Ga0207683_100437154 | 125 |
| 451 | 3300026121 | Ga0207683_10066293 | Ga0207683_100662933 | 125 |
| 452 | 3300026142 | Ga0207698_11656745 | Ga0207698_116567451 | 125 |
| 453 | 3300027424 | Ga0209984_1029436 | Ga0209984_10294362 | 125 |
| 454 | 3300027876 | Ga0209974_10003840 | Ga0209974_100038408 | 125 |
| 455 | 3300027876 | Ga0209974_10005440 | Ga0209974_100054405 | 125 |
| 456 | 3300028379 | Ga0268266_10108479 | Ga0268266_101084793 | 125 |
| 457 | 3300028379 | Ga0268266_10621012 | Ga0268266_106210122 | 125 |
| 458 | 3300028380 | Ga0268265_10114674 | Ga0268265_101146743 | 125 |
| 459 | 3300028380 | Ga0268265_10119565 | Ga0268265_101195653 | 125 |
| 460 | 3300028380 | Ga0268265_11647191 | Ga0268265_116471912 | 125 |
| 461 | 3300028381 | Ga0268264_11473043 | Ga0268264_114730432 | 125 |
| 462 | 3300031456 | Ga0307513_10001404 | Ga0307513_1000140423 | 125 |
| 463 | 3300031456 | Ga0307513_10433151 | Ga0307513_104331512 | 125 |
| 464 | 3300031548 | Ga0307408_101599220 | Ga0307408_1015992202 | 125 |
| 465 | 3300031730 | Ga0307516_10017063 | Ga0307516_100170635 | 125 |
| 466 | 3300031731 | Ga0307405_10495137 | Ga0307405_104951373 | 125 |
| 467 | 3300031731 | Ga0307405_10942671 | Ga0307405_109426712 | 125 |
| 468 | 3300031731 | Ga0307405_11803692 | Ga0307405_118036922 | 125 |
| 469 | 3300031824 | Ga0307413_10771436 | Ga0307413_107714362 | 125 |
| 470 | 3300031824 | Ga0307413_10965568 | Ga0307413_109655682 | 125 |
| 471 | 3300031824 | Ga0307413_11026041 | Ga0307413_110260412 | 125 |
| 472 | 3300031824 | Ga0307413_11685152 | Ga0307413_116851522 | 125 |
| 473 | 3300031852 | Ga0307410_10691355 | Ga0307410_106913552 | 125 |
| 474 | 3300031901 | Ga0307406_10147335 | Ga0307406_101473353 | 125 |
| 475 | 3300031901 | Ga0307406_10988594 | Ga0307406_109885942 | 125 |
| 476 | 3300031901 | Ga0307406_11550485 | Ga0307406_115504851 | 125 |
| 477 | 3300031903 | Ga0307407_10454785 | Ga0307407_104547852 | 125 |
| 478 | 3300031903 | Ga0307407_10878542 | Ga0307407_108785422 | 125 |
| 479 | 3300031911 | Ga0307412_10122841 | Ga0307412_101228413 | 125 |
| 480 | 3300031911 | Ga0307412_10457218 | Ga0307412_104572182 | 125 |
| 481 | 3300031911 | Ga0307412_10708161 | Ga0307412_107081612 | 125 |
| 482 | 3300031911 | Ga0307412_10835858 | Ga0307412_108358581 | 125 |
| 483 | 3300031995 | Ga0307409_101336894 | Ga0307409_1013368942 | 125 |
| 484 | 3300031995 | Ga0307409_101557797 | Ga0307409_1015577972 | 125 |
| 485 | 3300032002 | Ga0307416_100295807 | Ga0307416_1002958074 | 125 |
| 486 | 3300032002 | Ga0307416_100630181 | Ga0307416_1006301813 | 125 |
| 487 | 3300032002 | Ga0307416_101155217 | Ga0307416_1011552172 | 125 |
| 488 | 3300032002 | Ga0307416_102619217 | Ga0307416_1026192172 | 125 |
| 489 | 3300032004 | Ga0307414_10195381 | Ga0307414_101953813 | 125 |
| 490 | 3300032004 | Ga0307414_11016962 | Ga0307414_110169622 | 125 |
| 491 | 3300032005 | Ga0307411_10054325 | Ga0307411_100543253 | 125 |
| 492 | 3300032005 | Ga0307411_10812183 | Ga0307411_108121831 | 125 |
| 493 | 3300032005 | Ga0307411_10957360 | Ga0307411_109573602 | 125 |
| 494 | 3300032126 | Ga0307415_102116989 | Ga0307415_1021169891 | 125 |
| 495 | 3300033179 | Ga0307507_10165731 | Ga0307507_101657312 | 125 |
| 496 | 3300035092 | Ga0373952_0003586 | Ga0373952_0003586_699_1097 | 125 |
| 497 | 3300035691 | Ga0373931_0360597 | Ga0373931_0360597_296_694 | 125 |
| 498 | 3300036401 | Ga0373937_0119804 | Ga0373937_0119804_1705_2082 | 125 |
| 499 | 3300037312 | Ga0395899_0251062 | Ga0395899_0251062_341_742 | 125 |
| 500 | 3300037418 | Ga0395900_0013053 | Ga0395900_0013053_5250_5651 | 125 |
| 501 | 3300037418 | Ga0395900_0232578 | Ga0395900_0232578_1353_1754 | 125 |
| 502 | 3300037466 | Ga0395898_0232948 | Ga0395898_0232948_184_585 | 125 |
| 503 | 3300037471 | Ga0395905_0016092 | Ga0395905_0016092_1095_1496 | 125 |
| 504 | 3300037471 | Ga0395905_0399893 | Ga0395905_0399893_836_1240 | 125 |
| 505 | 3300037471 | Ga0395905_0751644 | Ga0395905_0751644_458_859 | 125 |
| 506 | 3300041404 | Ga0439436_0014978 | Ga0439436_0014978_1694_2092 | 125 |
| 507 | 3300041404 | Ga0439436_0023126 | Ga0439436_0023126_421_819 | 125 |
| 508 | 3300041406 | Ga0439439_0015187 | Ga0439439_0015187_40_438 | 125 |
| 509 | 3300041406 | Ga0439439_0131137 | Ga0439439_0131137_110_508 | 125 |
| 510 | 3300041410 | Ga0439461_0197049 | Ga0439461_0197049_44_442 | 125 |
| 511 | 3300041411 | Ga0439466_0159569 | Ga0439466_0159569_151_549 | 125 |
| 512 | 3300041413 | Ga0439465_0069720 | Ga0439465_0069720_293_691 | 125 |
| 513 | 3300041413 | Ga0439465_0108013 | Ga0439465_0108013_133_531 | 125 |
| 514 | 3300041486 | Ga0451807_1642670 | Ga0451807_1642670_48_428 | 125 |
| 515 | 3300041486 | Ga0451807_2711958 | Ga0451807_2711958_362_739 | 125 |
| 516 | 3300041491 | Ga0451833_0435847 | Ga0451833_0435847_610_999 | 125 |
| 517 | 3300041494 | Ga0451837_0007243 | Ga0451837_0007243_526_915 | 125 |
| 518 | 3300041509 | Ga0451843_1345615 | Ga0451843_1345615_1360_1749 | 125 |
| 519 | 3300041512 | Ga0451853_1130242 | Ga0451853_1130242_293_682 | 125 |
| 520 | 3300041512 | Ga0451853_1502880 | Ga0451853_1502880_719_1123 | 125 |
| 521 | 3300041512 | Ga0451853_3234389 | Ga0451853_3234389_603_992 | 125 |
| 522 | 3300042005 | Ga0439448_0015792 | Ga0439448_0015792_34_411 | 125 |
| 523 | 3300042006 | Ga0439432_003736 | Ga0439432_003736_2288_2686 | 125 |
| 524 | 3300042006 | Ga0439432_029794 | Ga0439432_029794_181_579 | 125 |
| 525 | 3300042006 | Ga0439432_052984 | Ga0439432_052984_98_496 | 125 |
| 526 | 3300042007 | Ga0439449_0001228 | Ga0439449_0001228_569_994 | 125 |
| 527 | 3300042007 | Ga0439449_0009371 | Ga0439449_0009371_2813_3211 | 125 |
| 528 | 3300042015 | Ga0439462_0039526 | Ga0439462_0039526_533_931 | 125 |
| 529 | 3300042015 | Ga0439462_0116654 | Ga0439462_0116654_237_635 | 125 |
| 530 | 3300042437 | Ga0439444_0080963 | Ga0439444_0080963_42_422 | 125 |
| 531 | 3300044658 | Ga0466972_0508028 | Ga0466972_0508028_124_507 | 125 |
| 532 | 3300046513 | Ga0495616_0234468 | Ga0495616_0234468_376_774 | 125 |
| 533 | 3300046517 | Ga0495630_1033934 | Ga0495630_1033934_14_412 | 125 |
| 534 | 3300046525 | Ga0495663_0001950 | Ga0495663_0001950_3984_4382 | 125 |
| 535 | 3300046615 | Ga0495656_0028858 | Ga0495656_0028858_1605_2003 | 125 |
| 536 | 3300046615 | Ga0495656_0052134 | Ga0495656_0052134_1030_1428 | 125 |
| 537 | 3300046691 | Ga0495670_0086285 | Ga0495670_0086285_215_613 | 125 |
| 538 | 3300047318 | Ga0495636_0003323 | Ga0495636_0003323_3925_4323 | 125 |
| 539 | 3300047318 | Ga0495636_0049266 | Ga0495636_0049266_899_1297 | 125 |
| 540 | 3300047318 | Ga0495636_0077446 | Ga0495636_0077446_211_609 | 125 |
| 541 | 3300047318 | Ga0495636_0150413 | Ga0495636_0150413_98_496 | 125 |
| 542 | 3300047318 | Ga0495636_0156002 | Ga0495636_0156002_58_456 | 125 |
| 543 | 3300047673 | Ga0495593_0204992 | Ga0495593_0204992_574_972 | 125 |
| 544 | 3300048903 | Ga0496100_0070433 | Ga0496100_0070433_1234_1635 | 125 |
| 545 | 3300048903 | Ga0496100_0605036 | Ga0496100_0605036_160_570 | 125 |
| 546 | 3300048904 | Ga0496101_0015491 | Ga0496101_0015491_667_1068 | 125 |
| 547 | 3300048911 | Ga0496108_0074258 | Ga0496108_0074258_836_1237 | 125 |
| 548 | 3300048912 | Ga0496109_0074857 | Ga0496109_0074857_1768_2169 | 125 |
| 549 | 3300048915 | Ga0496112_0175883 | Ga0496112_0175883_644_1045 | 125 |
| 550 | 3300048916 | Ga0496113_0012879 | Ga0496113_0012879_658_1059 | 125 |
| 551 | 3300048920 | Ga0496117_0180168 | Ga0496117_0180168_410_805 | 125 |
| 552 | 3300049581 | Ga0501047_0855499 | Ga0501047_0855499_163_543 | 125 |
| 553 | 3300049583 | Ga0501067_0585989 | Ga0501067_0585989_231_611 | 125 |
| 554 | 3300049585 | Ga0501069_0276175 | Ga0501069_0276175_280_660 | 125 |
| 555 | 3300049589 | Ga0501073_0060157 | Ga0501073_0060157_156_536 | 125 |
| 556 | 3300049649 | Ga0501198_111106 | Ga0501198_111106_104_502 | 125 |
| 557 | 3300049660 | Ga0501216_188177 | Ga0501216_188177_22_447 | 125 |
| 558 | 3300049661 | Ga0501217_182355 | Ga0501217_182355_220_618 | 125 |
| 559 | 3300049661 | Ga0501217_229488 | Ga0501217_229488_60_458 | 125 |
| 560 | 3300049663 | Ga0501223_085807 | Ga0501223_085807_19_399 | 125 |
| 561 | 3300049680 | Ga0501250_020090 | Ga0501250_020090_376_774 | 125 |
| 562 | 3300049742 | Ga0501080_0137030 | Ga0501080_0137030_1783_2163 | 125 |
| 563 | 3300049770 | Ga0501273_045895 | Ga0501273_045895_45_470 | 125 |
| 564 | 3300049771 | Ga0501274_027585 | Ga0501274_027585_47_427 | 125 |
| 565 | 3300050490 | nmdc:mga03n38_267998_c1 | nmdc:mga03n38_267998_c1_118_513 | 125 |
| 566 | 3300050508 | nmdc:mga09592_914094_c1 | nmdc:mga09592_914094_c1_142_528 | 125 |
| 567 | 3300050509 | nmdc:mga0qj67_212377_c1 | nmdc:mga0qj67_212377_c1_471_857 | 125 |
| 568 | 3300050510 | nmdc:mga06r32_259808_c1 | nmdc:mga06r32_259808_c1_167_553 | 125 |
| 569 | 3300053104 | Ga0500556_0103685 | Ga0500556_0103685_279_662 | 125 |
| 570 | 3300053153 | Ga0500616_0000029 | Ga0500616_0000029_350593_350973 | 125 |
| 571 | iso_pu_bacteria | 2643221695 | 2644530152 | 125 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar