F464835

General Info

Members Datasets Scaffolds Average Seq Length
570 314 1140 245

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10040250|Ga0207677_100402502
Length 277
Sequence VDAHLAQRAALGRLKRVEMQVRANPALARVQARRYEALDTLRGAAIVWMTAFHFCFDLNYFHWLHQNFYADPFWTWQRTAIVSLFLFCAGAGQAVAVEHGQSWSRFWKRWAQVAGCALLVTAGSYAMFPRSFIYFGVLHGIAVMLIVVRLTAGWGRWLWLAGALALAIKPLAAWAHLQWPELDFLDNAAWNWLGLIGRKPITEDYVPVFPWLGVMWWGMATGQWVMAHRMHWMDLRLAGAGRPLAWLGRWSLSWYMVHQPVLIGLMTVIAGLTRNPG

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
192 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
193 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
194 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
195 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
203 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
204 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
205 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
210 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
287 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
288 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
289 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
290 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
291 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
292 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
295 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
296 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
300 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
301 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
302 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
305 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
306 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
307 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
308 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
309 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
310 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
311 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
312 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
313 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
314 2932422444 Comamonas sp. 4034 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 0
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0
Rhizoplane 4.21
Rhizosphere 78.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10040250 3300026023 Bacteria 3080
2 JGI25152J39213_1001054 3300002773 Bacteria 13092
3 JGI25153J46596_10004105 3300003215 Bacteria 7916
4 JGI25153J46596_10010446 3300003215 Bacteria 4198
5 rootH2_10089590 3300003320 Bacteria 4462
6 Ga0055525_1000046 3300003759 Bacteria 261587
7 Ga0055526_1000301 3300003771 Bacteria 41220
8 Ga0055530_10008163 3300003791 Bacteria 4244
9 Ga0055540_1005451 3300003792 Bacteria 5341
10 Ga0055531_10000542 3300003794 Bacteria 33438
11 Ga0055543_1006566 3300004625 Bacteria 2793
12 Ga0055543_1013746 3300004625 Bacteria 1593
13 Ga0065165_1000246 3300005262 Bacteria 93310
14 Ga0065165_1002045 3300005262 Bacteria 18698
15 Ga0070658_10044222 3300005327 Bacteria 3599
16 Ga0070683_100034036 3300005329 Bacteria 4651
17 Ga0070683_100271384 3300005329 Bacteria 1613
18 Ga0070670_100007072 3300005331 Bacteria 9503
19 Ga0070670_100030011 3300005331 Bacteria 4682
20 Ga0070670_100101859 3300005331 Bacteria 2473
21 Ga0070670_100178623 3300005331 Bacteria 1842
22 Ga0070670_100280416 3300005331 Bacteria 1455
23 Ga0070677_10008402 3300005333 Bacteria 3472
24 Ga0070677_10096082 3300005333 Bacteria 1298
25 Ga0068869_100004359 3300005334 Bacteria 8784
26 Ga0068869_100025024 3300005334 Bacteria 4140
27 Ga0068869_100245750 3300005334 Bacteria 1427
28 Ga0070666_10008995 3300005335 Bacteria 6218
29 Ga0070666_10165938 3300005335 Bacteria 1545
30 Ga0070666_10401245 3300005335 Bacteria 986
31 Ga0070680_100113289 3300005336 Bacteria 2259
32 Ga0068868_100005325 3300005338 Bacteria 9035
33 Ga0068868_100094359 3300005338 Bacteria 2414
34 Ga0070660_100024756 3300005339 Bacteria 4456
35 Ga0070660_100069214 3300005339 Bacteria 2752
36 Ga0070660_100256637 3300005339 Bacteria 1427
37 Ga0070687_100007874 3300005343 Bacteria 4479
38 Ga0070661_100010464 3300005344 Bacteria 6452
39 Ga0070661_100077196 3300005344 Bacteria 2455
40 Ga0070661_100109493 3300005344 Bacteria 2061
41 Ga0070668_100008924 3300005347 Bacteria 7441
42 Ga0070669_100031381 3300005353 Bacteria 3838
43 Ga0070675_100001542 3300005354 Bacteria 17053
44 Ga0070675_100016997 3300005354 Bacteria 5780
45 Ga0070675_100028337 3300005354 Bacteria 4507
46 Ga0070675_100340253 3300005354 Bacteria 1329
47 Ga0070671_100000711 3300005355 Bacteria 23911
48 Ga0070674_100381150 3300005356 Bacteria 1147
49 Ga0070674_100416289 3300005356 Bacteria 1101
50 Ga0070674_100551482 3300005356 Bacteria 967
51 Ga0070673_100064097 3300005364 Bacteria 2926
52 Ga0070659_100001414 3300005366 Bacteria 17309
53 Ga0070659_100014381 3300005366 Bacteria 5914
54 Ga0070659_100112081 3300005366 Bacteria 2203
55 Ga0070667_100026363 3300005367 Bacteria 4834
56 Ga0070667_100117751 3300005367 Bacteria 2308
57 Ga0070708_100139307 3300005445 Bacteria 2249
58 Ga0070663_100009649 3300005455 Bacteria 5986
59 Ga0070663_100019128 3300005455 Bacteria 4507
60 Ga0070663_100642646 3300005455 Bacteria 896
61 Ga0070678_100046759 3300005456 Bacteria 3105
62 Ga0070678_100449496 3300005456 Bacteria 1128
63 Ga0070662_100014409 3300005457 Bacteria 5282
64 Ga0070662_100039027 3300005457 Bacteria 3376
65 Ga0070662_100047730 3300005457 Bacteria 3082
66 Ga0070662_100368164 3300005457 Bacteria 1181
67 Ga0070662_100668185 3300005457 Bacteria 877
68 Ga0068867_100000047 3300005459 Bacteria 74014
69 Ga0068867_100035077 3300005459 Bacteria 3637
70 Ga0070679_100058592 3300005530 Bacteria 3838
71 Ga0070679_100514724 3300005530 Bacteria 1140
72 Ga0070684_100040077 3300005535 Bacteria 4031
73 Ga0070684_100518666 3300005535 Bacteria 1104
74 Ga0068853_100243316 3300005539 Bacteria 1649
75 Ga0068853_100434359 3300005539 Bacteria 1233
76 Ga0070672_100006038 3300005543 Bacteria 8090
77 Ga0070672_100021431 3300005543 Bacteria 4728
78 Ga0070672_100030558 3300005543 Bacteria 4048
79 Ga0070672_100121808 3300005543 Bacteria 2136
80 Ga0070672_100142700 3300005543 Bacteria 1977
81 Ga0070672_100169443 3300005543 Bacteria 1815
82 Ga0070672_100180218 3300005543 Bacteria 1760
83 Ga0070672_100240946 3300005543 Bacteria 1521
84 Ga0070686_100214789 3300005544 Bacteria 1387
85 Ga0070693_100013588 3300005547 Bacteria 4152
86 Ga0070665_100413102 3300005548 Bacteria 1358
87 Ga0068855_100018671 3300005563 Bacteria 8340
88 Ga0068855_100041816 3300005563 Bacteria 5431
89 Ga0070664_100001442 3300005564 Bacteria 18959
90 Ga0070664_100043182 3300005564 Bacteria 3803
91 Ga0070664_100121577 3300005564 Bacteria 2287
92 Ga0070664_100134823 3300005564 Bacteria 2171
93 Ga0070664_100338860 3300005564 Bacteria 1365
94 Ga0068857_100116790 3300005577 Bacteria 2401
95 Ga0068854_100037702 3300005578 Bacteria 3394
96 Ga0068856_100030895 3300005614 Bacteria 5238
97 Ga0068856_100538527 3300005614 Bacteria 1189
98 Ga0070702_100046506 3300005615 Bacteria 2460
99 Ga0068852_100016460 3300005616 Bacteria 5768
100 Ga0068852_100018061 3300005616 Bacteria 5549
101 Ga0068852_100028109 3300005616 Bacteria 4597
102 Ga0068852_100038923 3300005616 Bacteria 4000
103 Ga0068852_100057870 3300005616 Bacteria 3355
104 Ga0068852_100092235 3300005616 Bacteria 2712
105 Ga0068852_100521588 3300005616 Bacteria 1185
106 Ga0068859_100284690 3300005617 Bacteria 1746
107 Ga0068864_100006907 3300005618 Bacteria 9307
108 Ga0068864_100055861 3300005618 Bacteria 3410
109 Ga0068864_100191193 3300005618 Bacteria 1877
110 Ga0068864_100364294 3300005618 Bacteria 1367
111 Ga0068866_10011958 3300005718 Bacteria 3773
112 Ga0068861_100003160 3300005719 Bacteria 10893
113 Ga0068861_100017921 3300005719 Bacteria 5034
114 Ga0068851_10002126 3300005834 Bacteria 8701
115 Ga0068851_10006575 3300005834 Bacteria 5314
116 Ga0068851_10047252 3300005834 Bacteria 2179
117 Ga0068851_10136874 3300005834 Bacteria 1329
118 Ga0068851_10164487 3300005834 Bacteria 1221
119 Ga0068870_10097877 3300005840 Bacteria 1652
120 Ga0068870_10364654 3300005840 Bacteria 931
121 Ga0068863_100084744 3300005841 Bacteria 3003
122 Ga0068863_100129443 3300005841 Bacteria 2409
123 Ga0068858_100013629 3300005842 Bacteria 7672
124 Ga0068860_100075911 3300005843 Bacteria 3196
125 Ga0068860_100110511 3300005843 Bacteria 2627
126 Ga0068860_100169194 3300005843 Bacteria 2110
127 Ga0068860_100343906 3300005843 Bacteria 1467
128 Ga0068862_100623092 3300005844 Bacteria 1038
129 Ga0075365_10000234 3300006038 Bacteria 18998
130 Ga0075365_10124957 3300006038 Bacteria 1777
131 Ga0075432_10007801 3300006058 Bacteria 3648
132 Ga0075362_10094405 3300006177 Bacteria 1392
133 Ga0075367_10049363 3300006178 Bacteria 2480
134 Ga0097621_100006086 3300006237 Bacteria 8539
135 Ga0097621_100047932 3300006237 Bacteria 3464
136 Ga0097621_100484870 3300006237 Bacteria 1118
137 Ga0075370_10049036 3300006353 Bacteria 2393
138 Ga0068871_100029809 3300006358 Bacteria 4290
139 Ga0068871_100417383 3300006358 Bacteria 1198
140 Ga0075429_100193096 3300006880 Bacteria 1783
141 Ga0068865_100050091 3300006881 Bacteria 2883
142 Ga0097620_100284683 3300006931 Bacteria 1746
143 Ga0105240_10001089 3300009093 Bacteria 47935
144 Ga0105240_10004758 3300009093 Bacteria 20498
145 Ga0105240_10958376 3300009093 Bacteria 917
146 Ga0111539_11260492 3300009094 Bacteria 858
147 Ga0105245_10032837 3300009098 Bacteria 4597
148 Ga0105245_10146893 3300009098 Bacteria 2225
149 Ga0105243_10023687 3300009148 Bacteria 4678
150 Ga0105242_10024144 3300009176 Bacteria 4799
151 Ga0105248_10013789 3300009177 Bacteria 8896
152 Ga0105248_10015329 3300009177 Bacteria 8452
153 Ga0105248_10114431 3300009177 Bacteria 3043
154 Ga0105248_10491063 3300009177 Bacteria 1384
155 Ga0105248_10546380 3300009177 Bacteria 1307
156 Ga0105248_10571825 3300009177 Bacteria 1275
157 Ga0105237_10005015 3300009545 Bacteria 15071
158 Ga0105238_10030011 3300009551 Bacteria 5534
159 Ga0105238_10824843 3300009551 Bacteria 944
160 Ga0105249_10011327 3300009553 Bacteria 7829
161 Ga0105249_10601322 3300009553 Bacteria 1154
162 Ga0105239_10001549 3300010375 Bacteria 30378
163 Ga0105239_10612013 3300010375 Bacteria 1243
164 Ga0157373_10118519 3300013100 Bacteria 1860
165 Ga0157369_10557567 3300013105 Bacteria 1184
166 Ga0157374_10007940 3300013296 Bacteria 9063
167 Ga0157374_10290235 3300013296 Bacteria 1616
168 Ga0157378_10013596 3300013297 Bacteria 7119
169 Ga0157378_10051653 3300013297 Bacteria 3658
170 Ga0163162_10003553 3300013306 Bacteria 14913
171 Ga0163162_10029666 3300013306 Bacteria 5415
172 Ga0163162_10302749 3300013306 Bacteria 1731
173 Ga0157372_10024342 3300013307 Bacteria 6575
174 Ga0157372_10045936 3300013307 Bacteria 4846
175 Ga0157375_10008084 3300013308 Bacteria 9202
176 Ga0157375_10013906 3300013308 Bacteria 7176
177 Ga0157375_10149234 3300013308 Bacteria 2472
178 Ga0157375_10154134 3300013308 Bacteria 2435
179 Ga0157380_10010096 3300014326 Bacteria 6780
180 Ga0157380_10186850 3300014326 Bacteria 1826
181 Ga0157380_10199809 3300014326 Bacteria 1773
182 Ga0157377_10000781 3300014745 Bacteria 13158
183 Ga0157377_10117904 3300014745 Bacteria 1605
184 Ga0157379_10008582 3300014968 Bacteria 8891
185 Ga0157379_10027252 3300014968 Bacteria 5087
186 Ga0157379_10316303 3300014968 Bacteria 1425
187 Ga0157376_10026546 3300014969 Bacteria 4579
188 Ga0157376_10533017 3300014969 Bacteria 1159
189 Ga0163161_10013695 3300017792 Bacteria 5647
190 Ga0213872_10000060 3300021361 Bacteria 100249
191 Ga0213874_10035999 3300021377 Bacteria 1457
192 Ga0213876_10031386 3300021384 Bacteria 2804
193 Ga0209563_100005 3300025230 Bacteria 1774893
194 Ga0207425_1001962 3300025245 Bacteria 7711
195 Ga0209129_1000200 3300025258 Bacteria 77042
196 Ga0209673_1011901 3300025273 Bacteria 3546
197 Ga0209673_1018139 3300025273 Bacteria 2571
198 Ga0209564_1000046 3300025295 Bacteria 373787
199 Ga0209758_1000096 3300025297 Bacteria 231496
200 Ga0209758_1000285 3300025297 Bacteria 99959
201 Ga0209050_1003565 3300025298 Bacteria 11327
202 Ga0209256_1032751 3300025299 Bacteria 1406
203 Ga0209256_1043330 3300025299 Bacteria 1130
204 Ga0209257_1000012 3300025304 Bacteria 1111138
205 Ga0207656_10006086 3300025321 Bacteria 4319
206 Ga0207682_10030133 3300025893 Bacteria 2172
207 Ga0207642_10028663 3300025899 Bacteria 2295
208 Ga0207688_10109302 3300025901 Bacteria 1603
209 Ga0207680_10015289 3300025903 Bacteria 4003
210 Ga0207680_10171821 3300025903 Bacteria 1460
211 Ga0207680_10239915 3300025903 Bacteria 1249
212 Ga0207645_10004454 3300025907 Bacteria 10371
213 Ga0207645_10021396 3300025907 Bacteria 4218
214 Ga0207645_10174966 3300025907 Bacteria 1407
215 Ga0207643_10307736 3300025908 Bacteria 987
216 Ga0207705_10320716 3300025909 Bacteria 1191
217 Ga0207707_10560512 3300025912 Bacteria 970
218 Ga0207695_10010055 3300025913 Bacteria 11617
219 Ga0207695_10038395 3300025913 Bacteria 5156
220 Ga0207671_10006611 3300025914 Bacteria 10285
221 Ga0207660_10102786 3300025917 Bacteria 2137
222 Ga0207662_10026885 3300025918 Bacteria 3321
223 Ga0207662_10059607 3300025918 Bacteria 2288
224 Ga0207657_10080953 3300025919 Bacteria 2729
225 Ga0207649_10000814 3300025920 Bacteria 20063
226 Ga0207652_10016517 3300025921 Bacteria 6028
227 Ga0207652_10531658 3300025921 Bacteria 1057
228 Ga0207681_10007688 3300025923 Bacteria 6602
229 Ga0207681_10009273 3300025923 Bacteria 6012
230 Ga0207694_10045621 3300025924 Bacteria 3385
231 Ga0207694_10356608 3300025924 Bacteria 1211
232 Ga0207650_10006177 3300025925 Bacteria 8165
233 Ga0207650_10070656 3300025925 Bacteria 2625
234 Ga0207650_10242403 3300025925 Bacteria 1457
235 Ga0207659_10011264 3300025926 Bacteria 5646
236 Ga0207659_10023952 3300025926 Bacteria 4084
237 Ga0207659_10031946 3300025926 Bacteria 3609
238 Ga0207687_10352630 3300025927 Bacteria 1199
239 Ga0207644_10000432 3300025931 Bacteria 27181
240 Ga0207644_10026661 3300025931 Bacteria 3985
241 Ga0207644_10264699 3300025931 Bacteria 1376
242 Ga0207644_10303085 3300025931 Bacteria 1288
243 Ga0207690_10000712 3300025932 Bacteria 21429
244 Ga0207690_10284770 3300025932 Bacteria 1288
245 Ga0207706_10001019 3300025933 Bacteria 28600
246 Ga0207706_10007584 3300025933 Bacteria 10036
247 Ga0207706_10369160 3300025933 Bacteria 1246
248 Ga0207706_10591312 3300025933 Bacteria 954
249 Ga0207686_10131368 3300025934 Bacteria 1718
250 Ga0207686_10269752 3300025934 Bacteria 1251
251 Ga0207709_10021791 3300025935 Bacteria 3630
252 Ga0207704_10626334 3300025938 Bacteria 883
253 Ga0207691_10002231 3300025940 Bacteria 18963
254 Ga0207691_10021524 3300025940 Bacteria 6088
255 Ga0207691_10044152 3300025940 Bacteria 4104
256 Ga0207691_10064959 3300025940 Bacteria 3305
257 Ga0207691_10071466 3300025940 Bacteria 3131
258 Ga0207691_10157731 3300025940 Bacteria 1992
259 Ga0207691_10193799 3300025940 Bacteria 1771
260 Ga0207691_10306416 3300025940 Bacteria 1364
261 Ga0207711_10023180 3300025941 Bacteria 5196
262 Ga0207711_10069964 3300025941 Bacteria 3043
263 Ga0207711_10322142 3300025941 Bacteria 1428
264 Ga0207711_10377421 3300025941 Bacteria 1315
265 Ga0207711_10398643 3300025941 Bacteria 1278
266 Ga0207689_10000267 3300025942 Bacteria 47185
267 Ga0207689_10006479 3300025942 Bacteria 10344
268 Ga0207689_10241195 3300025942 Bacteria 1494
269 Ga0207679_10000430 3300025945 Bacteria 29840
270 Ga0207679_10031699 3300025945 Bacteria 3702
271 Ga0207679_10090462 3300025945 Bacteria 2366
272 Ga0207679_10222876 3300025945 Bacteria 1587
273 Ga0207667_10061680 3300025949 Bacteria 3923
274 Ga0207667_10184597 3300025949 Bacteria 2141
275 Ga0207651_10003948 3300025960 Bacteria 7364
276 Ga0207651_10072726 3300025960 Bacteria 2442
277 Ga0207712_10010730 3300025961 Bacteria 5822
278 Ga0207712_10024137 3300025961 Bacteria 4023
279 Ga0207668_10034367 3300025972 Bacteria 3367
280 Ga0207668_10784019 3300025972 Bacteria 843
281 Ga0207640_10022217 3300025981 Bacteria 3793
282 Ga0207640_10076237 3300025981 Bacteria 2275
283 Ga0207658_10053620 3300025986 Bacteria 2980
284 Ga0207658_10376658 3300025986 Bacteria 1242
285 Ga0207677_10151999 3300026023 Bacteria 1787
286 Ga0207703_10013770 3300026035 Bacteria 6303
287 Ga0207703_10202869 3300026035 Bacteria 1763
288 Ga0207639_10043507 3300026041 Bacteria 3372
289 Ga0207639_10044254 3300026041 Bacteria 3347
290 Ga0207678_10028382 3300026067 Bacteria 4885
291 Ga0207678_10044222 3300026067 Bacteria 3853
292 Ga0207702_10025659 3300026078 Bacteria 4891
293 Ga0207702_10141918 3300026078 Bacteria 2175
294 Ga0207641_10038272 3300026088 Bacteria 4009
295 Ga0207641_10040525 3300026088 Bacteria 3900
296 Ga0207641_10060598 3300026088 Bacteria 3225
297 Ga0207648_10031756 3300026089 Bacteria 4667
298 Ga0207676_10007811 3300026095 Bacteria 7609
299 Ga0207676_10037248 3300026095 Bacteria 3705
300 Ga0207676_10279787 3300026095 Bacteria 1514
301 Ga0207676_10718449 3300026095 Bacteria 969
302 Ga0207674_10076281 3300026116 Bacteria 3360
303 Ga0207675_100000232 3300026118 Bacteria 52682
304 Ga0207683_10051580 3300026121 Bacteria 3604
305 Ga0207683_10054213 3300026121 Bacteria 3516
306 Ga0207683_10060023 3300026121 Bacteria 3342
307 Ga0207683_10066820 3300026121 Bacteria 3171
308 Ga0207683_10375053 3300026121 Bacteria 1307
309 Ga0207683_10581607 3300026121 Bacteria 1036
310 Ga0207698_10004144 3300026142 Bacteria 8807
311 Ga0207698_10013930 3300026142 Bacteria 5326
312 Ga0207698_10021779 3300026142 Bacteria 4440
313 Ga0207698_10041898 3300026142 Bacteria 3416
314 Ga0207698_10189499 3300026142 Bacteria 1830
315 Ga0207698_10193562 3300026142 Bacteria 1814
316 Ga0207698_10465143 3300026142 Bacteria 1224
317 Ga0209970_1005945 3300027614 Bacteria 2003
318 Ga0268264_10130837 3300028381 Bacteria 2224
319 Ga0268264_10149123 3300028381 Bacteria 2095
320 Ga0268264_10328115 3300028381 Bacteria 1449
321 Ga0268264_10413754 3300028381 Bacteria 1299
322 Ga0307517_10000150 3300028786 Bacteria 110446
323 Ga0307517_10048188 3300028786 Bacteria 4394
324 Ga0307515_10000022 3300028794 Bacteria 404064
325 Ga0307515_10002977 3300028794 Bacteria 35954
326 Ga0307515_10080246 3300028794 Bacteria 4258
327 Ga0307515_10113856 3300028794 Bacteria 3132
328 Ga0307515_10132606 3300028794 Bacteria 2732
329 Ga0307512_10137831 3300030522 Bacteria 1504
330 Ga0265328_10004953 3300031239 Bacteria 5738
331 Ga0265329_10051837 3300031242 Bacteria 1306
332 Ga0265331_10001374 3300031250 Bacteria 17891
333 Ga0265327_10000078 3300031251 Bacteria 207398
334 Ga0265316_10000337 3300031344 Bacteria 52655
335 Ga0307513_10034435 3300031456 Bacteria 5684
336 Ga0307513_10082399 3300031456 Bacteria 3312
337 Ga0307513_10115794 3300031456 Bacteria 2662
338 Ga0307513_10136812 3300031456 Bacteria 2384
339 Ga0307513_10307746 3300031456 Bacteria 1348
340 Ga0307513_10467339 3300031456 Bacteria 983
341 Ga0307509_10005769 3300031507 Bacteria 17025
342 Ga0307509_10005994 3300031507 Bacteria 16597
343 Ga0307509_10059164 3300031507 Bacteria 4054
344 Ga0307408_100017685 3300031548 Bacteria 4775
345 Ga0307408_100303257 3300031548 Bacteria 1339
346 Ga0307508_10000594 3300031616 Bacteria 43299
347 Ga0307508_10001639 3300031616 Bacteria 24934
348 Ga0307508_10355867 3300031616 Bacteria 1055
349 Ga0307514_10000696 3300031649 Bacteria 58844
350 Ga0307514_10001237 3300031649 Bacteria 33622
351 Ga0265314_10017804 3300031711 Bacteria 5566
352 Ga0307516_10101733 3300031730 Bacteria 2689
353 Ga0307410_10098613 3300031852 Bacteria 2090
354 Ga0307407_10198755 3300031903 Bacteria 1342
355 Ga0307412_10251702 3300031911 Bacteria 1372
356 Ga0307412_10289884 3300031911 Bacteria 1289
357 Ga0307409_100003629 3300031995 Bacteria 8436
358 Ga0307409_100206292 3300031995 Bacteria 1763
359 Ga0307416_100000673 3300032002 Bacteria 17769
360 Ga0307416_100434226 3300032002 Bacteria 1361
361 Ga0307414_10424021 3300032004 Bacteria 1161
362 Ga0307415_100000936 3300032126 Bacteria 13400
363 Ga0373943_0017193 3300035170 Bacteria 3308
364 Ga0373946_0227848 3300035171 Bacteria 902
365 Ga0373955_0135956 3300035172 Bacteria 1438
366 Ga0373931_0005571 3300035691 Bacteria 5837
367 Ga0373931_0176005 3300035691 Bacteria 1264
368 Ga0373935_0011720 3300035692 Bacteria 5267
369 Ga0373935_0071536 3300035692 Bacteria 2238
370 Ga0373937_0062044 3300036401 Bacteria 3436
371 Ga0373937_0089830 3300036401 Bacteria 2845
372 Ga0373925_0073273 3300037068 Bacteria 2592
373 Ga0373925_0113272 3300037068 Bacteria 2097
374 Ga0373925_0132759 3300037068 Bacteria 1943
375 Ga0395899_0000992 3300037312 Bacteria 26097
376 Ga0395899_0002929 3300037312 Bacteria 13693
377 Ga0395899_0037125 3300037312 Bacteria 3653
378 Ga0395900_0000054 3300037418 Bacteria 220487
379 Ga0395900_0008351 3300037418 Bacteria 10657
380 Ga0395900_0013717 3300037418 Bacteria 8273
381 Ga0395900_0110380 3300037418 Bacteria 2825
382 Ga0395900_0153094 3300037418 Bacteria 2355
383 Ga0395900_0161984 3300037418 Bacteria 2281
384 Ga0395900_0467988 3300037418 Bacteria 1214
385 Ga0395898_0003936 3300037466 Bacteria 16390
386 Ga0395898_0039818 3300037466 Bacteria 4650
387 Ga0395898_0052086 3300037466 Bacteria 3999
388 Ga0395905_0000148 3300037471 Bacteria 116301
389 Ga0395905_0000382 3300037471 Bacteria 63066
390 Ga0395905_0002932 3300037471 Bacteria 18561
391 Ga0395905_0011410 3300037471 Bacteria 8585
392 Ga0395905_0024879 3300037471 Bacteria 5649
393 Ga0395905_0086949 3300037471 Bacteria 2930
394 Ga0395905_0224570 3300037471 Bacteria 1757
395 Ga0395905_0237487 3300037471 Bacteria 1703
396 Ga0395905_0264337 3300037471 Bacteria 1606
397 Ga0395905_0568589 3300037471 Bacteria 1035
398 Ga0395901_0004739 3300038443 Bacteria 13727
399 Ga0395901_0043604 3300038443 Bacteria 4652
400 Ga0395901_0165216 3300038443 Bacteria 2324
401 Ga0395901_0193361 3300038443 Bacteria 2133
402 Ga0395901_0314129 3300038443 Bacteria 1622
403 Ga0436365_0204726 3300039437 Bacteria 1000
404 Ga0436365_0816529 3300039437 Bacteria 4989
405 Ga0436361_0174260 3300039447 Bacteria 101834
406 Ga0436363_0171014 3300039450 Bacteria 4520
407 Ga0439453_0048237 3300041408 Bacteria 854
408 Ga0451787_410686 3300041441 Bacteria 1322
409 Ga0451787_692696 3300041441 Bacteria 1569
410 Ga0451789_0896868 3300041443 Bacteria 1004
411 Ga0451795_0379794 3300041456 Bacteria 1347
412 Ga0451798_0248621 3300041458 Bacteria 4326
413 Ga0451802_1632764 3300041460 Bacteria 1425
414 Ga0451804_0641295 3300041463 Bacteria 4244
415 Ga0451807_0935122 3300041486 Bacteria 873
416 Ga0451849_1012376 3300041505 Bacteria 1132
417 Ga0451853_0739663 3300041512 Bacteria 1927
418 Ga0439449_0015354 3300042007 Bacteria 2877
419 Ga0439450_043191 3300042008 Bacteria 1053
420 Ga0439462_0008092 3300042015 Bacteria 2645
421 Ga0439462_0091986 3300042015 Bacteria 833
422 Ga0450894_002705 3300042131 Bacteria 2353
423 Ga0450898_003492 3300042134 Bacteria 2264
424 Ga0439446_0017706 3300042156 Bacteria 1992
425 Ga0450909_018777 3300042185 Bacteria 1028
426 Ga0439464_0025273 3300042439 Bacteria 1644
427 Ga0450918_000001 3300042531 Bacteria 65425
428 Ga0450893_0013982 3300042532 Bacteria 1342
429 Ga0451577_0000114 3300042876 Bacteria 175957
430 Ga0451577_0000714 3300042876 Bacteria 51609
431 Ga0451577_0000804 3300042876 Bacteria 47207
432 Ga0451577_0026938 3300042876 Bacteria 5204
433 Ga0466969_0000029 3300044656 Bacteria 92006
434 Ga0466969_0003765 3300044656 Bacteria 8062
435 Ga0466972_0014541 3300044658 Bacteria 3941
436 Ga0466972_0040385 3300044658 Bacteria 2273
437 Ga0453683_0009300 3300044673 Bacteria 6569
438 Ga0466965_0038793 3300044683 Bacteria 2340
439 Ga0466965_0285878 3300044683 Bacteria 892
440 Ga0466966_0046974 3300044684 Bacteria 2754
441 Ga0466966_0047445 3300044684 Bacteria 2739
442 Ga0466966_0088751 3300044684 Bacteria 1921
443 Ga0466961_0008768 3300044693 Bacteria 6449
444 Ga0466961_0010327 3300044693 Bacteria 5952
445 Ga0466961_0030060 3300044693 Bacteria 3491
446 Ga0466964_0023801 3300044706 Bacteria 2383
447 Ga0453684_0000606 3300044712 Bacteria 132056
448 Ga0453684_0003805 3300044712 Bacteria 33295
449 Ga0453684_0381844 3300044712 Bacteria 1582
450 Ga0466971_0005365 3300044719 Bacteria 5557
451 Ga0466971_0007085 3300044719 Bacteria 4880
452 Ga0466968_0037886 3300044735 Bacteria 2025
453 Ga0466970_0082867 3300044765 Bacteria 1735
454 Ga0466957_0029770 3300044842 Bacteria 3257
455 Ga0466957_0051433 3300044842 Bacteria 2508
456 Ga0466957_0163836 3300044842 Bacteria 1445
457 Ga0466957_0210247 3300044842 Bacteria 1281
458 Ga0466960_0087531 3300044901 Bacteria 1581
459 Ga0466959_0000284 3300045049 Bacteria 30923
460 Ga0466959_0072157 3300045049 Bacteria 2499
461 Ga0466959_0260995 3300045049 Bacteria 1192
462 Ga0451576_0001159 3300045051 Bacteria 47493
463 Ga0451576_0011883 3300045051 Bacteria 9848
464 Ga0451576_0130645 3300045051 Bacteria 2618
465 Ga0466958_0080046 3300045836 Bacteria 2010
466 Ga0466967_0060377 3300045976 Bacteria 3359
467 Ga0495592_0470145 3300046454 Bacteria 785
468 Ga0495629_0246296 3300046459 Bacteria 1230
469 Ga0495638_0070962 3300046460 Bacteria 2131
470 Ga0495650_0003499 3300046471 Bacteria 11396
471 Ga0495610_0014852 3300046512 Bacteria 4555
472 Ga0495620_0185586 3300046515 Bacteria 803
473 Ga0495632_0018485 3300046519 Bacteria 3825
474 Ga0495632_0057510 3300046519 Bacteria 1898
475 Ga0495642_0029506 3300046528 Bacteria 2190
476 Ga0495598_0022158 3300046537 Bacteria 1697
477 Ga0495598_0146052 3300046537 Bacteria 822
478 Ga0495621_0091633 3300046539 Bacteria 1146
479 Ga0495621_0180909 3300046539 Bacteria 841
480 Ga0495633_0003149 3300046558 Bacteria 11172
481 Ga0495625_0004951 3300046660 Bacteria 12379
482 Ga0495625_0126239 3300046660 Bacteria 1737
483 Ga0495635_0119730 3300046663 Bacteria 1796
484 Ga0495635_0147457 3300046663 Bacteria 1602
485 Ga0495657_0287347 3300046675 Bacteria 983
486 Ga0495658_0027509 3300046683 Bacteria 3061
487 Ga0495658_0076102 3300046683 Bacteria 1961
488 Ga0495658_0155756 3300046683 Bacteria 1406
489 Ga0495636_0079329 3300047318 Bacteria 1412
490 Ga0495674_0322687 3300047319 Bacteria 1258
491 Ga0495680_0112200 3300047322 Bacteria 2020
492 Ga0495685_055332 3300047447 Bacteria 1342
493 Ga0495673_0108826 3300047469 Bacteria 1111
494 Ga0495684_0403047 3300047471 Bacteria 960
495 Ga0495615_0026327 3300048090 Bacteria 1357
496 Ga0496100_0167148 3300048903 Bacteria 1581
497 Ga0496102_0164382 3300048905 Bacteria 2088
498 Ga0496104_0517777 3300048907 Bacteria 1104
499 Ga0496104_0578059 3300048907 Bacteria 1034
500 Ga0496106_0025954 3300048909 Bacteria 4359
501 Ga0496108_0035893 3300048911 Bacteria 4123
502 Ga0496108_0172034 3300048911 Bacteria 1874
503 Ga0496108_0228688 3300048911 Bacteria 1617
504 Ga0496109_0358646 3300048912 Bacteria 1377
505 Ga0496110_0047066 3300048913 Bacteria 3775
506 Ga0496110_0569540 3300048913 Bacteria 1029
507 Ga0496112_0596377 3300048915 Bacteria 1037
508 Ga0496113_0162449 3300048916 Bacteria 1766
509 Ga0496114_0179110 3300048917 Bacteria 1850
510 Ga0496114_0303042 3300048917 Bacteria 1411
511 Ga0496115_0134305 3300048918 Bacteria 2040
512 Ga0496122_0064795 3300048925 Bacteria 2656
513 Ga0496124_0000079 3300048927 Bacteria 212057
514 Ga0496125_0005397 3300048928 Bacteria 14250
515 Ga0496125_0194616 3300048928 Bacteria 1335
516 Ga0496126_0136742 3300048929 Bacteria 2113
517 Ga0501034_0088769 3300049571 Bacteria 3089
518 Ga0501039_0268203 3300049575 Bacteria 1342
519 Ga0501039_0510443 3300049575 Bacteria 944
520 Ga0501046_0008741 3300049580 Bacteria 8798
521 Ga0501047_0210401 3300049581 Bacteria 1803
522 Ga0501047_0233343 3300049581 Bacteria 1693
523 Ga0501073_0096706 3300049589 Bacteria 2051
524 Ga0501083_0475785 3300049744 Bacteria 813
525 Ga0501262_003471 3300049759 Bacteria 1805
526 Ga0501044_0052355 3300049823 Bacteria 4207
527 nmdc:mga03683_138043_c1 3300050489 Bacteria 1094
528 nmdc:mga0yw44_297776_c1 3300050492 Bacteria 1080
529 nmdc:mga0k408_43554_c1 3300050493 Bacteria 2587
530 nmdc:mga0k408_60366_c1 3300050493 Bacteria 2203
531 nmdc:mga09592_195433_c1 3300050508 Bacteria 1751
532 Ga0495601_0094063 3300053077 Bacteria 1931
533 Ga0495612_0066526 3300053078 Bacteria 1498
534 Ga0495619_0136099 3300053085 Bacteria 1690
535 Ga0500578_0000115 3300053086 Bacteria 95966
536 Ga0500644_0035338 3300053088 Bacteria 1619
537 Ga0500583_0033658 3300053092 Bacteria 2270
538 Ga0500650_0094610 3300053098 Bacteria 1399
539 Ga0500562_014652 3300053108 Bacteria 2009
540 Ga0500562_031529 3300053108 Bacteria 1399
541 Ga0500593_000286 3300053117 Bacteria 20561
542 Ga0500623_026750 3300053127 Bacteria 2993
543 Ga0500628_005080 3300053129 Bacteria 2187
544 Ga0500642_0000668 3300053130 Bacteria 10147
545 Ga0500652_001893 3300053131 Bacteria 6299
546 Ga0500655_014934 3300053133 Bacteria 1422
547 Ga0500658_0133326 3300053134 Bacteria 1110
548 Ga0500568_0015768 3300053139 Bacteria 3375
549 Ga0500577_0030936 3300053142 Bacteria 1868
550 Ga0500586_038507 3300053145 Bacteria 1612
551 Ga0500604_0017991 3300053151 Bacteria 1964
552 Ga0500616_0076718 3300053153 Bacteria 1689
553 Ga0500622_0000205 3300053156 Bacteria 62937
554 Ga0500622_0130994 3300053156 Bacteria 1205
555 Ga0500634_0000911 3300053161 Bacteria 10587
556 Ga0500584_025272 3300053726 Bacteria 2761
557 Ga0500645_067311 3300053730 Bacteria 1031
558 Ga0500587_000285 3300053739 Bacteria 5610
559 Ga0466962_0023296 3300061719 Bacteria 2976
560 2587729162 2585428057 Bacteria 6737412
561 2587734765 2585428058 Bacteria 6853932
562 2587755964 2585428062 Bacteria 6842168
563 2588293554 2588253510 Bacteria 6901809
564 2643968915 2643221592 Bacteria 6608788
565 2644144047 2643221625 Bacteria 6512927
566 2644244426 2643221644 Bacteria 6865017
567 2644273166 2643221648 Bacteria 6521465
568 2881101908 2881101125 Bacteria 4590519
569 2919705463 2919704043 Bacteria 5560311
570 2932426017 2932422444 Bacteria 4678430
571 Ga0207677_10040250
572 JGI25152J39213_1001054
573 JGI25153J46596_10004105
574 JGI25153J46596_10010446
575 rootH2_10089590
576 Ga0055525_1000046
577 Ga0055526_1000301
578 Ga0055530_10008163
579 Ga0055540_1005451
580 Ga0055531_10000542
581 Ga0055543_1006566
582 Ga0055543_1013746
583 Ga0065165_1000246
584 Ga0065165_1002045
585 Ga0070658_10044222
586 Ga0070683_100034036
587 Ga0070683_100271384
588 Ga0070670_100007072
589 Ga0070670_100030011
590 Ga0070670_100101859
591 Ga0070670_100178623
592 Ga0070670_100280416
593 Ga0070677_10008402
594 Ga0070677_10096082
595 Ga0068869_100004359
596 Ga0068869_100025024
597 Ga0068869_100245750
598 Ga0070666_10008995
599 Ga0070666_10165938
600 Ga0070666_10401245
601 Ga0070680_100113289
602 Ga0068868_100005325
603 Ga0068868_100094359
604 Ga0070660_100024756
605 Ga0070660_100069214
606 Ga0070660_100256637
607 Ga0070687_100007874
608 Ga0070661_100010464
609 Ga0070661_100077196
610 Ga0070661_100109493
611 Ga0070668_100008924
612 Ga0070669_100031381
613 Ga0070675_100001542
614 Ga0070675_100016997
615 Ga0070675_100028337
616 Ga0070675_100340253
617 Ga0070671_100000711
618 Ga0070674_100381150
619 Ga0070674_100416289
620 Ga0070674_100551482
621 Ga0070673_100064097
622 Ga0070659_100001414
623 Ga0070659_100014381
624 Ga0070659_100112081
625 Ga0070667_100026363
626 Ga0070667_100117751
627 Ga0070708_100139307
628 Ga0070663_100009649
629 Ga0070663_100019128
630 Ga0070663_100642646
631 Ga0070678_100046759
632 Ga0070678_100449496
633 Ga0070662_100014409
634 Ga0070662_100039027
635 Ga0070662_100047730
636 Ga0070662_100368164
637 Ga0070662_100668185
638 Ga0068867_100000047
639 Ga0068867_100035077
640 Ga0070679_100058592
641 Ga0070679_100514724
642 Ga0070684_100040077
643 Ga0070684_100518666
644 Ga0068853_100243316
645 Ga0068853_100434359
646 Ga0070672_100006038
647 Ga0070672_100021431
648 Ga0070672_100030558
649 Ga0070672_100121808
650 Ga0070672_100142700
651 Ga0070672_100169443
652 Ga0070672_100180218
653 Ga0070672_100240946
654 Ga0070686_100214789
655 Ga0070693_100013588
656 Ga0070665_100413102
657 Ga0068855_100018671
658 Ga0068855_100041816
659 Ga0070664_100001442
660 Ga0070664_100043182
661 Ga0070664_100121577
662 Ga0070664_100134823
663 Ga0070664_100338860
664 Ga0068857_100116790
665 Ga0068854_100037702
666 Ga0068856_100030895
667 Ga0068856_100538527
668 Ga0070702_100046506
669 Ga0068852_100016460
670 Ga0068852_100018061
671 Ga0068852_100028109
672 Ga0068852_100038923
673 Ga0068852_100057870
674 Ga0068852_100092235
675 Ga0068852_100521588
676 Ga0068859_100284690
677 Ga0068864_100006907
678 Ga0068864_100055861
679 Ga0068864_100191193
680 Ga0068864_100364294
681 Ga0068866_10011958
682 Ga0068861_100003160
683 Ga0068861_100017921
684 Ga0068851_10002126
685 Ga0068851_10006575
686 Ga0068851_10047252
687 Ga0068851_10136874
688 Ga0068851_10164487
689 Ga0068870_10097877
690 Ga0068870_10364654
691 Ga0068863_100084744
692 Ga0068863_100129443
693 Ga0068858_100013629
694 Ga0068860_100075911
695 Ga0068860_100110511
696 Ga0068860_100169194
697 Ga0068860_100343906
698 Ga0068862_100623092
699 Ga0075365_10000234
700 Ga0075365_10124957
701 Ga0075432_10007801
702 Ga0075362_10094405
703 Ga0075367_10049363
704 Ga0097621_100006086
705 Ga0097621_100047932
706 Ga0097621_100484870
707 Ga0075370_10049036
708 Ga0068871_100029809
709 Ga0068871_100417383
710 Ga0075429_100193096
711 Ga0068865_100050091
712 Ga0097620_100284683
713 Ga0105240_10001089
714 Ga0105240_10004758
715 Ga0105240_10958376
716 Ga0111539_11260492
717 Ga0105245_10032837
718 Ga0105245_10146893
719 Ga0105243_10023687
720 Ga0105242_10024144
721 Ga0105248_10013789
722 Ga0105248_10015329
723 Ga0105248_10114431
724 Ga0105248_10491063
725 Ga0105248_10546380
726 Ga0105248_10571825
727 Ga0105237_10005015
728 Ga0105238_10030011
729 Ga0105238_10824843
730 Ga0105249_10011327
731 Ga0105249_10601322
732 Ga0105239_10001549
733 Ga0105239_10612013
734 Ga0157373_10118519
735 Ga0157369_10557567
736 Ga0157374_10007940
737 Ga0157374_10290235
738 Ga0157378_10013596
739 Ga0157378_10051653
740 Ga0163162_10003553
741 Ga0163162_10029666
742 Ga0163162_10302749
743 Ga0157372_10024342
744 Ga0157372_10045936
745 Ga0157375_10008084
746 Ga0157375_10013906
747 Ga0157375_10149234
748 Ga0157375_10154134
749 Ga0157380_10010096
750 Ga0157380_10186850
751 Ga0157380_10199809
752 Ga0157377_10000781
753 Ga0157377_10117904
754 Ga0157379_10008582
755 Ga0157379_10027252
756 Ga0157379_10316303
757 Ga0157376_10026546
758 Ga0157376_10533017
759 Ga0163161_10013695
760 Ga0213872_10000060
761 Ga0213874_10035999
762 Ga0213876_10031386
763 Ga0209563_100005
764 Ga0207425_1001962
765 Ga0209129_1000200
766 Ga0209673_1011901
767 Ga0209673_1018139
768 Ga0209564_1000046
769 Ga0209758_1000096
770 Ga0209758_1000285
771 Ga0209050_1003565
772 Ga0209256_1032751
773 Ga0209256_1043330
774 Ga0209257_1000012
775 Ga0207656_10006086
776 Ga0207682_10030133
777 Ga0207642_10028663
778 Ga0207688_10109302
779 Ga0207680_10015289
780 Ga0207680_10171821
781 Ga0207680_10239915
782 Ga0207645_10004454
783 Ga0207645_10021396
784 Ga0207645_10174966
785 Ga0207643_10307736
786 Ga0207705_10320716
787 Ga0207707_10560512
788 Ga0207695_10010055
789 Ga0207695_10038395
790 Ga0207671_10006611
791 Ga0207660_10102786
792 Ga0207662_10026885
793 Ga0207662_10059607
794 Ga0207657_10080953
795 Ga0207649_10000814
796 Ga0207652_10016517
797 Ga0207652_10531658
798 Ga0207681_10007688
799 Ga0207681_10009273
800 Ga0207694_10045621
801 Ga0207694_10356608
802 Ga0207650_10006177
803 Ga0207650_10070656
804 Ga0207650_10242403
805 Ga0207659_10011264
806 Ga0207659_10023952
807 Ga0207659_10031946
808 Ga0207687_10352630
809 Ga0207644_10000432
810 Ga0207644_10026661
811 Ga0207644_10264699
812 Ga0207644_10303085
813 Ga0207690_10000712
814 Ga0207690_10284770
815 Ga0207706_10001019
816 Ga0207706_10007584
817 Ga0207706_10369160
818 Ga0207706_10591312
819 Ga0207686_10131368
820 Ga0207686_10269752
821 Ga0207709_10021791
822 Ga0207704_10626334
823 Ga0207691_10002231
824 Ga0207691_10021524
825 Ga0207691_10044152
826 Ga0207691_10064959
827 Ga0207691_10071466
828 Ga0207691_10157731
829 Ga0207691_10193799
830 Ga0207691_10306416
831 Ga0207711_10023180
832 Ga0207711_10069964
833 Ga0207711_10322142
834 Ga0207711_10377421
835 Ga0207711_10398643
836 Ga0207689_10000267
837 Ga0207689_10006479
838 Ga0207689_10241195
839 Ga0207679_10000430
840 Ga0207679_10031699
841 Ga0207679_10090462
842 Ga0207679_10222876
843 Ga0207667_10061680
844 Ga0207667_10184597
845 Ga0207651_10003948
846 Ga0207651_10072726
847 Ga0207712_10010730
848 Ga0207712_10024137
849 Ga0207668_10034367
850 Ga0207668_10784019
851 Ga0207640_10022217
852 Ga0207640_10076237
853 Ga0207658_10053620
854 Ga0207658_10376658
855 Ga0207677_10151999
856 Ga0207703_10013770
857 Ga0207703_10202869
858 Ga0207639_10043507
859 Ga0207639_10044254
860 Ga0207678_10028382
861 Ga0207678_10044222
862 Ga0207702_10025659
863 Ga0207702_10141918
864 Ga0207641_10038272
865 Ga0207641_10040525
866 Ga0207641_10060598
867 Ga0207648_10031756
868 Ga0207676_10007811
869 Ga0207676_10037248
870 Ga0207676_10279787
871 Ga0207676_10718449
872 Ga0207674_10076281
873 Ga0207675_100000232
874 Ga0207683_10051580
875 Ga0207683_10054213
876 Ga0207683_10060023
877 Ga0207683_10066820
878 Ga0207683_10375053
879 Ga0207683_10581607
880 Ga0207698_10004144
881 Ga0207698_10013930
882 Ga0207698_10021779
883 Ga0207698_10041898
884 Ga0207698_10189499
885 Ga0207698_10193562
886 Ga0207698_10465143
887 Ga0209970_1005945
888 Ga0268264_10130837
889 Ga0268264_10149123
890 Ga0268264_10328115
891 Ga0268264_10413754
892 Ga0307517_10000150
893 Ga0307517_10048188
894 Ga0307515_10000022
895 Ga0307515_10002977
896 Ga0307515_10080246
897 Ga0307515_10113856
898 Ga0307515_10132606
899 Ga0307512_10137831
900 Ga0265328_10004953
901 Ga0265329_10051837
902 Ga0265331_10001374
903 Ga0265327_10000078
904 Ga0265316_10000337
905 Ga0307513_10034435
906 Ga0307513_10082399
907 Ga0307513_10115794
908 Ga0307513_10136812
909 Ga0307513_10307746
910 Ga0307513_10467339
911 Ga0307509_10005769
912 Ga0307509_10005994
913 Ga0307509_10059164
914 Ga0307408_100017685
915 Ga0307408_100303257
916 Ga0307508_10000594
917 Ga0307508_10001639
918 Ga0307508_10355867
919 Ga0307514_10000696
920 Ga0307514_10001237
921 Ga0265314_10017804
922 Ga0307516_10101733
923 Ga0307410_10098613
924 Ga0307407_10198755
925 Ga0307412_10251702
926 Ga0307412_10289884
927 Ga0307409_100003629
928 Ga0307409_100206292
929 Ga0307416_100000673
930 Ga0307416_100434226
931 Ga0307414_10424021
932 Ga0307415_100000936
933 Ga0373943_0017193
934 Ga0373946_0227848
935 Ga0373955_0135956
936 Ga0373931_0005571
937 Ga0373931_0176005
938 Ga0373935_0011720
939 Ga0373935_0071536
940 Ga0373937_0062044
941 Ga0373937_0089830
942 Ga0373925_0073273
943 Ga0373925_0113272
944 Ga0373925_0132759
945 Ga0395899_0000992
946 Ga0395899_0002929
947 Ga0395899_0037125
948 Ga0395900_0000054
949 Ga0395900_0008351
950 Ga0395900_0013717
951 Ga0395900_0110380
952 Ga0395900_0153094
953 Ga0395900_0161984
954 Ga0395900_0467988
955 Ga0395898_0003936
956 Ga0395898_0039818
957 Ga0395898_0052086
958 Ga0395905_0000148
959 Ga0395905_0000382
960 Ga0395905_0002932
961 Ga0395905_0011410
962 Ga0395905_0024879
963 Ga0395905_0086949
964 Ga0395905_0224570
965 Ga0395905_0237487
966 Ga0395905_0264337
967 Ga0395905_0568589
968 Ga0395901_0004739
969 Ga0395901_0043604
970 Ga0395901_0165216
971 Ga0395901_0193361
972 Ga0395901_0314129
973 Ga0436365_0204726
974 Ga0436365_0816529
975 Ga0436361_0174260
976 Ga0436363_0171014
977 Ga0439453_0048237
978 Ga0451787_410686
979 Ga0451787_692696
980 Ga0451789_0896868
981 Ga0451795_0379794
982 Ga0451798_0248621
983 Ga0451802_1632764
984 Ga0451804_0641295
985 Ga0451807_0935122
986 Ga0451849_1012376
987 Ga0451853_0739663
988 Ga0439449_0015354
989 Ga0439450_043191
990 Ga0439462_0008092
991 Ga0439462_0091986
992 Ga0450894_002705
993 Ga0450898_003492
994 Ga0439446_0017706
995 Ga0450909_018777
996 Ga0439464_0025273
997 Ga0450918_000001
998 Ga0450893_0013982
999 Ga0451577_0000114
1000 Ga0451577_0000714
1001 Ga0451577_0000804
1002 Ga0451577_0026938
1003 Ga0466969_0000029
1004 Ga0466969_0003765
1005 Ga0466972_0014541
1006 Ga0466972_0040385
1007 Ga0453683_0009300
1008 Ga0466965_0038793
1009 Ga0466965_0285878
1010 Ga0466966_0046974
1011 Ga0466966_0047445
1012 Ga0466966_0088751
1013 Ga0466961_0008768
1014 Ga0466961_0010327
1015 Ga0466961_0030060
1016 Ga0466964_0023801
1017 Ga0453684_0000606
1018 Ga0453684_0003805
1019 Ga0453684_0381844
1020 Ga0466971_0005365
1021 Ga0466971_0007085
1022 Ga0466968_0037886
1023 Ga0466970_0082867
1024 Ga0466957_0029770
1025 Ga0466957_0051433
1026 Ga0466957_0163836
1027 Ga0466957_0210247
1028 Ga0466960_0087531
1029 Ga0466959_0000284
1030 Ga0466959_0072157
1031 Ga0466959_0260995
1032 Ga0451576_0001159
1033 Ga0451576_0011883
1034 Ga0451576_0130645
1035 Ga0466958_0080046
1036 Ga0466967_0060377
1037 Ga0495592_0470145
1038 Ga0495629_0246296
1039 Ga0495638_0070962
1040 Ga0495650_0003499
1041 Ga0495610_0014852
1042 Ga0495620_0185586
1043 Ga0495632_0018485
1044 Ga0495632_0057510
1045 Ga0495642_0029506
1046 Ga0495598_0022158
1047 Ga0495598_0146052
1048 Ga0495621_0091633
1049 Ga0495621_0180909
1050 Ga0495633_0003149
1051 Ga0495625_0004951
1052 Ga0495625_0126239
1053 Ga0495635_0119730
1054 Ga0495635_0147457
1055 Ga0495657_0287347
1056 Ga0495658_0027509
1057 Ga0495658_0076102
1058 Ga0495658_0155756
1059 Ga0495636_0079329
1060 Ga0495674_0322687
1061 Ga0495680_0112200
1062 Ga0495685_055332
1063 Ga0495673_0108826
1064 Ga0495684_0403047
1065 Ga0495615_0026327
1066 Ga0496100_0167148
1067 Ga0496102_0164382
1068 Ga0496104_0517777
1069 Ga0496104_0578059
1070 Ga0496106_0025954
1071 Ga0496108_0035893
1072 Ga0496108_0172034
1073 Ga0496108_0228688
1074 Ga0496109_0358646
1075 Ga0496110_0047066
1076 Ga0496110_0569540
1077 Ga0496112_0596377
1078 Ga0496113_0162449
1079 Ga0496114_0179110
1080 Ga0496114_0303042
1081 Ga0496115_0134305
1082 Ga0496122_0064795
1083 Ga0496124_0000079
1084 Ga0496125_0005397
1085 Ga0496125_0194616
1086 Ga0496126_0136742
1087 Ga0501034_0088769
1088 Ga0501039_0268203
1089 Ga0501039_0510443
1090 Ga0501046_0008741
1091 Ga0501047_0210401
1092 Ga0501047_0233343
1093 Ga0501073_0096706
1094 Ga0501083_0475785
1095 Ga0501262_003471
1096 Ga0501044_0052355
1097 nmdc:mga03683_138043_c1
1098 nmdc:mga0yw44_297776_c1
1099 nmdc:mga0k408_43554_c1
1100 nmdc:mga0k408_60366_c1
1101 nmdc:mga09592_195433_c1
1102 Ga0495601_0094063
1103 Ga0495612_0066526
1104 Ga0495619_0136099
1105 Ga0500578_0000115
1106 Ga0500644_0035338
1107 Ga0500583_0033658
1108 Ga0500650_0094610
1109 Ga0500562_014652
1110 Ga0500562_031529
1111 Ga0500593_000286
1112 Ga0500623_026750
1113 Ga0500628_005080
1114 Ga0500642_0000668
1115 Ga0500652_001893
1116 Ga0500655_014934
1117 Ga0500658_0133326
1118 Ga0500568_0015768
1119 Ga0500577_0030936
1120 Ga0500586_038507
1121 Ga0500604_0017991
1122 Ga0500616_0076718
1123 Ga0500622_0000205
1124 Ga0500622_0130994
1125 Ga0500634_0000911
1126 Ga0500584_025272
1127 Ga0500645_067311
1128 Ga0500587_000285
1129 Ga0466962_0023296
1130 2587729162
1131 2587734765
1132 2587755964
1133 2588293554
1134 2643968915
1135 2644144047
1136 2644244426
1137 2644273166
1138 2881101908
1139 2919705463
1140 2932426017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07786

HGSNAT_cat

Heparan-alpha-glucosaminide N-acetyltransferase, catalytic

34

260

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ucd-assembly1.cif.gz_C cryo-em structure of human steap1 in complex with amg 509 fab 0.3026 22 236
3ux4-assembly1.cif.gz_A crystal structure of the urea channel from the human gastric pathogen helicobacter pylori 0.2961 68 230
4j72-assembly1.cif.gz_A crystal structure of polyprenyl-phosphate n-acetyl hexosamine 1-phosphate transferase 0.2849 69 250
3ux4-assembly1.cif.gz_A crystal structure of the urea channel from the human gastric pathogen helicobacter pylori 0.2729 68 230
6oyz-assembly3.cif.gz_B crystal structure of mray bound to capuramycin 0.2684 69 252
ID Description Score Start End Superfamily
af_Q57955_5_337_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.3473 181 228 3.40.800.20
af_Q57985_1_147_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3411 22 136 1.20.140.150
af_Q4PIV7_1_183_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3215 3 137 1.20.140.150
af_Q9D709_232_361_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3164 22 138 1.20.120.550
af_A0A1D6MR14_13_120_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3015 22 133 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A3N7CHP3-F1-model_v4 Heparan-alpha-glucosaminide N-acetyltransferase catalytic domain-containing protein 0.9886 37 252 GO:0016020
AF-A0A1I1T7J8-F1-model_v4 Heparan-alpha-glucosaminide N-acetyltransferase catalytic domain-containing protein 0.9873 34 252 GO:0016020
AF-A0A3S2WXL7-F1-model_v4 DUF1624 domain-containing protein 0.9817 13 253 GO:0016020
AF-A0A2M8X254-F1-model_v4 Putative membrane protein 0.9792 16 253 GO:0016020
AF-A0A349W5T2-F1-model_v4 Heparan-alpha-glucosaminide N-acetyltransferase catalytic domain-containing protein 0.9787 21 208 GO:0016020

Map