F464829

General Info

Members Datasets Scaffolds Average Seq Length
570 283 555 130

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10068957|Ga0157379_100689574
Length 153
Sequence MANCDLEQARVQRFQQWRYRRHMNIGQASDASGVSQRMIRHYEKIGLIPPASRRGSGYRDYALPDVHRLKFIANARDLGFPIEEIRVLLDLWRDRGRSSAEVKALAMARAEELERKAAALEAMRRTLLELAERCQGDDRPDCPILANLAGEAD

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
9 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
10 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
11 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
12 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
13 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
14 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
15 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
168 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
179 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
247 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
248 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
249 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
250 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
251 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
252 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
262 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
263 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
276 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
277 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
283 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 0
Isolates 2.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.74
Nodule 0
Rhizoplane 5.09
Rhizosphere 71.23
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1222108 2162886006 Bacteria 2328
2 SwRhRL2b_contig_2859919 2162886007 Bacteria 2224
3 JGI24740J21852_10000027 3300001979 Bacteria 48883
4 JGI24740J21852_10004226 3300001979 Bacteria 6202
5 JGI24739J22299_10005808 3300001989 Bacteria 4674
6 JGI24739J22299_10080870 3300001989 Bacteria 998
7 JGI24739J22299_10114684 3300001989 Bacteria 807
8 JGI24737J22298_10004860 3300001990 Bacteria 4659
9 JGI24737J22298_10099372 3300001990 Bacteria 862
10 JGI24735J21928_10006398 3300002067 Bacteria 3877
11 JGI24738J21930_10001851 3300002075 Bacteria 5727
12 JGI24751J29686_10000440 3300002459 Bacteria 12756
13 JGI24751J29686_10000497 3300002459 Bacteria 11547
14 JGI24751J29686_10026212 3300002459 Bacteria 1209
15 JGI25150J39212_1000080 3300002774 Bacteria 58442
16 JGI25151J46595_10094567 3300003187 Bacteria 822
17 JGI25153J46596_10000025 3300003215 Bacteria 237813
18 JGI25153J46596_10027565 3300003215 Bacteria 1987
19 rootL2_10249575 3300003322 Bacteria 1259
20 rootH1_10044141 3300003323 Bacteria 2223
21 Ga0055532_1002166 3300003758 Bacteria 4366
22 Ga0055537_1002285 3300003773 Bacteria 6579
23 Ga0055524_1000165 3300003775 Bacteria 75996
24 Ga0055531_10016648 3300003794 Bacteria 3157
25 Ga0055543_1022956 3300004625 Bacteria 1129
26 Ga0065165_1008357 3300005262 Bacteria 4862
27 Ga0065704_10082602 3300005289 Bacteria 3577
28 Ga0065707_10081738 3300005295 Bacteria 54410
29 Ga0070658_10000732 3300005327 Bacteria 28217
30 Ga0070658_10168660 3300005327 Bacteria 1839
31 Ga0070670_100000919 3300005331 Bacteria 23130
32 Ga0070670_100007788 3300005331 Bacteria 9116
33 Ga0070670_100020112 3300005331 Bacteria 5734
34 Ga0070670_100034334 3300005331 Bacteria 4364
35 Ga0070670_100536236 3300005331 Bacteria 1043
36 Ga0070666_10001752 3300005335 Bacteria 13244
37 Ga0070666_10005173 3300005335 Bacteria 7988
38 Ga0070666_10016835 3300005335 Bacteria 4681
39 Ga0070666_10159037 3300005335 Bacteria 1578
40 Ga0070682_101863428 3300005337 Bacteria 526
41 Ga0070660_100010454 3300005339 Bacteria 6560
42 Ga0070660_100032776 3300005339 Bacteria 3912
43 Ga0070660_100112435 3300005339 Bacteria 2168
44 Ga0070661_100008597 3300005344 Bacteria 7060
45 Ga0070668_100000005 3300005347 Bacteria 187511
46 Ga0070668_100000842 3300005347 Bacteria 21233
47 Ga0070668_100024742 3300005347 Bacteria 4551
48 Ga0070668_100224755 3300005347 Bacteria 1550
49 Ga0070668_100456974 3300005347 Bacteria 1099
50 Ga0070669_100000023 3300005353 Bacteria 174496
51 Ga0070669_100058704 3300005353 Bacteria 2824
52 Ga0070669_100123275 3300005353 Bacteria 1980
53 Ga0070675_101019311 3300005354 Bacteria 760
54 Ga0070671_100000017 3300005355 Bacteria 154265
55 Ga0070671_100000027 3300005355 Bacteria 114189
56 Ga0070671_100005382 3300005355 Bacteria 10205
57 Ga0070671_100016967 3300005355 Bacteria 5888
58 Ga0070671_100457148 3300005355 Bacteria 1096
59 Ga0070667_100000004 3300005367 Bacteria 444091
60 Ga0070667_100000926 3300005367 Bacteria 27083
61 Ga0070667_100001278 3300005367 Bacteria 22765
62 Ga0070667_100001638 3300005367 Bacteria 20032
63 Ga0070667_100002555 3300005367 Bacteria 15820
64 Ga0070667_100242226 3300005367 Bacteria 1610
65 Ga0070667_100601053 3300005367 Bacteria 1013
66 Ga0070663_100163758 3300005455 Bacteria 1714
67 Ga0070663_100189159 3300005455 Bacteria 1601
68 Ga0070662_100406366 3300005457 Bacteria 1124
69 Ga0070662_100783497 3300005457 Bacteria 810
70 Ga0070684_100735986 3300005535 Bacteria 920
71 Ga0068853_100014246 3300005539 Bacteria 6508
72 Ga0068853_100075906 3300005539 Bacteria 2934
73 Ga0068853_100732192 3300005539 Bacteria 944
74 Ga0068853_101115036 3300005539 Bacteria 761
75 Ga0070672_100106769 3300005543 Bacteria 2278
76 Ga0070686_100086503 3300005544 Bacteria 2087
77 Ga0070665_100007103 3300005548 Bacteria 11380
78 Ga0070665_100015137 3300005548 Bacteria 7743
79 Ga0070665_100220945 3300005548 Bacteria 1895
80 Ga0070665_100820977 3300005548 Bacteria 943
81 Ga0070665_101280644 3300005548 Bacteria 743
82 Ga0070664_100635822 3300005564 Bacteria 991
83 Ga0070664_100663763 3300005564 Bacteria 969
84 Ga0068857_100023653 3300005577 Bacteria 5409
85 Ga0068857_100683751 3300005577 Bacteria 974
86 Ga0068857_101419221 3300005577 Bacteria 676
87 Ga0068857_101837345 3300005577 Bacteria 593
88 Ga0068854_100214323 3300005578 Bacteria 1520
89 Ga0068854_100572012 3300005578 Bacteria 961
90 Ga0068854_100672334 3300005578 Bacteria 891
91 Ga0068856_100037453 3300005614 Bacteria 4759
92 Ga0068856_100060150 3300005614 Bacteria 3753
93 Ga0068852_100002290 3300005616 Bacteria 13168
94 Ga0068852_100025970 3300005616 Bacteria 4753
95 Ga0068852_100116816 3300005616 Bacteria 2435
96 Ga0068852_100222309 3300005616 Bacteria 1796
97 Ga0068852_101634295 3300005616 Bacteria 667
98 Ga0068859_100000222 3300005617 Bacteria 56119
99 Ga0068859_100005182 3300005617 Bacteria 13238
100 Ga0068859_100039462 3300005617 Bacteria 4736
101 Ga0068859_100051134 3300005617 Bacteria 4152
102 Ga0068859_100111996 3300005617 Bacteria 2792
103 Ga0068859_100112139 3300005617 Bacteria 2790
104 Ga0068864_100004787 3300005618 Bacteria 11091
105 Ga0068864_100013251 3300005618 Bacteria 6829
106 Ga0068861_100012534 3300005719 Bacteria 5915
107 Ga0068851_10016266 3300005834 Bacteria 3557
108 Ga0068851_10031427 3300005834 Bacteria 2637
109 Ga0068863_100000169 3300005841 Bacteria 70831
110 Ga0068863_100000180 3300005841 Bacteria 67219
111 Ga0068863_100003732 3300005841 Bacteria 15062
112 Ga0068863_100020948 3300005841 Bacteria 6244
113 Ga0068863_100074852 3300005841 Bacteria 3204
114 Ga0068863_100105718 3300005841 Bacteria 2678
115 Ga0068863_100326954 3300005841 Bacteria 1490
116 Ga0068858_100005317 3300005842 Bacteria 12622
117 Ga0068858_100007319 3300005842 Bacteria 10688
118 Ga0068858_100021538 3300005842 Bacteria 6024
119 Ga0068860_100000002 3300005843 Bacteria 627849
120 Ga0068860_100000076 3300005843 Bacteria 171786
121 Ga0068860_100002340 3300005843 Bacteria 19901
122 Ga0068860_100003659 3300005843 Bacteria 15822
123 Ga0068860_100010828 3300005843 Bacteria 9001
124 Ga0068860_100013735 3300005843 Bacteria 7941
125 Ga0068860_100289225 3300005843 Bacteria 1603
126 Ga0068860_100509856 3300005843 Bacteria 1202
127 Ga0068862_100003522 3300005844 Bacteria 13428
128 Ga0068862_100004848 3300005844 Bacteria 11333
129 Ga0075368_10000004 3300006042 Bacteria 56092
130 Ga0075363_100000007 3300006048 Bacteria 46308
131 Ga0075364_10000003 3300006051 Bacteria 111353
132 Ga0075362_10000675 3300006177 Bacteria 10079
133 Ga0075367_10000036 3300006178 Bacteria 29484
134 Ga0075367_10344496 3300006178 Bacteria 940
135 Ga0075369_10001160 3300006186 Bacteria 8905
136 Ga0075366_10002940 3300006195 Bacteria 8862
137 Ga0075366_10126594 3300006195 Bacteria 1541
138 Ga0075366_10377669 3300006195 Bacteria 871
139 Ga0075370_10000001 3300006353 Bacteria 239876
140 Ga0075370_10000092 3300006353 Bacteria 27792
141 Ga0097620_100000222 3300006931 Bacteria 56119
142 Ga0097620_100005182 3300006931 Bacteria 13238
143 Ga0097620_100039463 3300006931 Bacteria 4736
144 Ga0097620_100051139 3300006931 Bacteria 4152
145 Ga0097620_100111997 3300006931 Bacteria 2792
146 Ga0097620_100112137 3300006931 Bacteria 2790
147 Ga0105251_10000071 3300009011 Bacteria 97636
148 Ga0105240_11223108 3300009093 Bacteria 795
149 Ga0105245_10009117 3300009098 Bacteria 8651
150 Ga0105247_10002563 3300009101 Bacteria 12321
151 Ga0105247_10221912 3300009101 Bacteria 1280
152 Ga0105243_10118450 3300009148 Bacteria 2228
153 Ga0105243_10353511 3300009148 Bacteria 1350
154 Ga0105241_10087920 3300009174 Bacteria 2446
155 Ga0105241_11340310 3300009174 Bacteria 683
156 Ga0105242_10391373 3300009176 Bacteria 1295
157 Ga0105248_10000215 3300009177 Bacteria 66694
158 Ga0105248_10001699 3300009177 Bacteria 24508
159 Ga0105248_10042744 3300009177 Bacteria 5082
160 Ga0105248_10518421 3300009177 Bacteria 1344
161 Ga0105248_10619197 3300009177 Bacteria 1221
162 Ga0105248_11337382 3300009177 Bacteria 810
163 Ga0105237_10013174 3300009545 Bacteria 8676
164 Ga0105237_10740706 3300009545 Bacteria 989
165 Ga0105238_10011466 3300009551 Bacteria 8926
166 Ga0105238_10073130 3300009551 Bacteria 3423
167 Ga0105249_10000037 3300009553 Bacteria 197428
168 Ga0105249_10003751 3300009553 Bacteria 13116
169 Ga0105249_10043616 3300009553 Bacteria 4078
170 Ga0105249_10096738 3300009553 Bacteria 2771
171 Ga0105249_10265716 3300009553 Bacteria 1707
172 Ga0105249_10691019 3300009553 Bacteria 1080
173 Ga0105239_10091863 3300010375 Bacteria 3350
174 Ga0105246_10549576 3300011119 Bacteria 989
175 Ga0157326_1003355 3300012513 Bacteria 1685
176 Ga0157326_1054590 3300012513 Bacteria 596
177 Ga0157373_10163390 3300013100 Bacteria 1567
178 Ga0157373_10330442 3300013100 Bacteria 1085
179 Ga0157371_10125316 3300013102 Bacteria 1827
180 Ga0157370_10028542 3300013104 Bacteria 5487
181 Ga0157370_10255508 3300013104 Bacteria 1620
182 Ga0157374_10208625 3300013296 Bacteria 1915
183 Ga0157378_10010139 3300013297 Bacteria 8217
184 Ga0157372_10360404 3300013307 Bacteria 1694
185 Ga0157375_10392127 3300013308 Bacteria 1555
186 Ga0163163_10058436 3300014325 Bacteria 3813
187 Ga0157380_10000338 3300014326 Bacteria 27963
188 Ga0157380_10396282 3300014326 Bacteria 1308
189 Ga0157380_10408303 3300014326 Bacteria 1291
190 Ga0157380_12049952 3300014326 Bacteria 634
191 Ga0157379_10068957 3300014968 Bacteria 3162
192 Ga0157379_10163282 3300014968 Bacteria 2010
193 Ga0163161_10046923 3300017792 Bacteria 3118
194 Ga0163161_10164283 3300017792 Bacteria 1694
195 Ga0163161_10405967 3300017792 Bacteria 1093
196 Ga0209147_100193 3300025229 Bacteria 69946
197 Ga0207425_1000027 3300025245 Bacteria 299995
198 Ga0209129_1001145 3300025258 Bacteria 15345
199 Ga0209565_1000007 3300025263 Bacteria 784361
200 Ga0209565_1002221 3300025263 Bacteria 7252
201 Ga0209455_1011052 3300025272 Bacteria 2247
202 Ga0209673_1001760 3300025273 Bacteria 18033
203 Ga0209675_1055659 3300025291 Bacteria 799
204 Ga0209676_1004998 3300025292 Bacteria 7103
205 Ga0209676_1020009 3300025292 Bacteria 2287
206 Ga0209025_1002001 3300025294 Bacteria 23331
207 Ga0209564_1075041 3300025295 Bacteria 685
208 Ga0209758_1000009 3300025297 Bacteria 1123483
209 Ga0209758_1014811 3300025297 Bacteria 4107
210 Ga0209758_1019936 3300025297 Bacteria 3203
211 Ga0209050_1000005 3300025298 Bacteria 1557793
212 Ga0209050_1000306 3300025298 Bacteria 100510
213 Ga0209050_1006913 3300025298 Bacteria 6559
214 Ga0209050_1013810 3300025298 Bacteria 3548
215 Ga0209050_1036282 3300025298 Bacteria 1442
216 Ga0209050_1058224 3300025298 Bacteria 929
217 Ga0209050_1086656 3300025298 Bacteria 652
218 Ga0209256_1000008 3300025299 Bacteria 975723
219 Ga0209051_1000525 3300025303 Bacteria 47573
220 Ga0209257_1004962 3300025304 Bacteria 9753
221 Ga0209257_1004986 3300025304 Bacteria 9703
222 Ga0209257_1006030 3300025304 Bacteria 8096
223 Ga0207697_10001759 3300025315 Bacteria 11632
224 Ga0207656_10028345 3300025321 Bacteria 2298
225 Ga0207656_10075570 3300025321 Bacteria 1505
226 Ga0207713_1001241 3300025735 Bacteria 21135
227 Ga0207710_10001753 3300025900 Bacteria 10468
228 Ga0207710_10027488 3300025900 Bacteria 2464
229 Ga0207680_10000030 3300025903 Bacteria 78257
230 Ga0207680_10006852 3300025903 Bacteria 5530
231 Ga0207680_10011474 3300025903 Bacteria 4479
232 Ga0207680_10291364 3300025903 Bacteria 1136
233 Ga0207647_10000037 3300025904 Bacteria 97521
234 Ga0207647_10000283 3300025904 Bacteria 41512
235 Ga0207647_10007862 3300025904 Bacteria 7671
236 Ga0207705_10000318 3300025909 Bacteria 43984
237 Ga0207705_10083002 3300025909 Bacteria 2337
238 Ga0207705_10866818 3300025909 Bacteria 700
239 Ga0207654_10011219 3300025911 Bacteria 4567
240 Ga0207654_10718201 3300025911 Bacteria 718
241 Ga0207671_10003187 3300025914 Bacteria 16539
242 Ga0207671_11441810 3300025914 Bacteria 533
243 Ga0207657_10006137 3300025919 Bacteria 12490
244 Ga0207657_10018007 3300025919 Bacteria 6759
245 Ga0207657_10043386 3300025919 Bacteria 3962
246 Ga0207649_10032910 3300025920 Bacteria 3093
247 Ga0207681_10000004 3300025923 Bacteria 559005
248 Ga0207681_10050306 3300025923 Bacteria 2819
249 Ga0207681_10178284 3300025923 Bacteria 1616
250 Ga0207694_10074360 3300025924 Bacteria 2660
251 Ga0207650_10004287 3300025925 Bacteria 9735
252 Ga0207650_10044802 3300025925 Bacteria 3252
253 Ga0207650_10048381 3300025925 Bacteria 3136
254 Ga0207650_10114020 3300025925 Bacteria 2096
255 Ga0207687_10022221 3300025927 Bacteria 4219
256 Ga0207644_10000024 3300025931 Bacteria 154283
257 Ga0207644_10005374 3300025931 Bacteria 8351
258 Ga0207644_10143367 3300025931 Bacteria 1842
259 Ga0207690_10038914 3300025932 Bacteria 3099
260 Ga0207706_10003179 3300025933 Bacteria 15784
261 Ga0207706_10458062 3300025933 Bacteria 1103
262 Ga0207706_10541448 3300025933 Bacteria 1003
263 Ga0207686_10764736 3300025934 Bacteria 772
264 Ga0207670_10866149 3300025936 Bacteria 755
265 Ga0207704_11319133 3300025938 Bacteria 617
266 Ga0207711_10005829 3300025941 Bacteria 10407
267 Ga0207711_10029671 3300025941 Bacteria 4614
268 Ga0207711_10080001 3300025941 Bacteria 2854
269 Ga0207711_10537824 3300025941 Bacteria 1090
270 Ga0207711_11333390 3300025941 Bacteria 660
271 Ga0207679_10933838 3300025945 Bacteria 794
272 Ga0207667_10005214 3300025949 Bacteria 15859
273 Ga0207667_10758276 3300025949 Bacteria 969
274 Ga0207712_10000035 3300025961 Bacteria 201152
275 Ga0207712_10002076 3300025961 Bacteria 13145
276 Ga0207712_10089181 3300025961 Bacteria 2267
277 Ga0207712_10344285 3300025961 Bacteria 1237
278 Ga0207712_10741785 3300025961 Bacteria 860
279 Ga0207668_10000024 3300025972 Bacteria 131871
280 Ga0207668_10000265 3300025972 Bacteria 34885
281 Ga0207668_10006763 3300025972 Bacteria 6786
282 Ga0207668_10487586 3300025972 Bacteria 1058
283 Ga0207668_10644976 3300025972 Bacteria 926
284 Ga0207640_10124675 3300025981 Bacteria 1852
285 Ga0207640_10326145 3300025981 Bacteria 1224
286 Ga0207640_10465590 3300025981 Bacteria 1045
287 Ga0207658_10000002 3300025986 Bacteria 1364188
288 Ga0207658_10000805 3300025986 Bacteria 26389
289 Ga0207658_10001260 3300025986 Bacteria 20047
290 Ga0207658_10001681 3300025986 Bacteria 16813
291 Ga0207658_10002307 3300025986 Bacteria 14075
292 Ga0207658_10005226 3300025986 Bacteria 8929
293 Ga0207658_10104779 3300025986 Bacteria 2223
294 Ga0207703_10001071 3300026035 Bacteria 26081
295 Ga0207703_10005709 3300026035 Bacteria 9983
296 Ga0207703_10030236 3300026035 Bacteria 4279
297 Ga0207639_10020538 3300026041 Bacteria 4728
298 Ga0207639_10030857 3300026041 Bacteria 3934
299 Ga0207639_12019499 3300026041 Bacteria 538
300 Ga0207678_10428357 3300026067 Bacteria 1148
301 Ga0207678_10680341 3300026067 Bacteria 905
302 Ga0207702_10056612 3300026078 Bacteria 3329
303 Ga0207702_10152972 3300026078 Bacteria 2100
304 Ga0207702_10220120 3300026078 Bacteria 1769
305 Ga0207641_10000181 3300026088 Bacteria 87655
306 Ga0207641_10000993 3300026088 Bacteria 29007
307 Ga0207641_10001724 3300026088 Bacteria 21127
308 Ga0207641_10010233 3300026088 Bacteria 7713
309 Ga0207641_10028187 3300026088 Bacteria 4639
310 Ga0207641_10144018 3300026088 Bacteria 2153
311 Ga0207641_10391737 3300026088 Bacteria 1332
312 Ga0207641_10593907 3300026088 Bacteria 1083
313 Ga0207641_11293094 3300026088 Bacteria 730
314 Ga0207676_10000041 3300026095 Bacteria 166172
315 Ga0207676_10001253 3300026095 Bacteria 18906
316 Ga0207676_11451931 3300026095 Bacteria 682
317 Ga0207674_10005947 3300026116 Bacteria 14434
318 Ga0207674_10066940 3300026116 Bacteria 3617
319 Ga0207674_10263918 3300026116 Bacteria 1669
320 Ga0207674_10313693 3300026116 Bacteria 1517
321 Ga0207674_10588448 3300026116 Bacteria 1075
322 Ga0207675_100046282 3300026118 Bacteria 4064
323 Ga0207698_10000638 3300026142 Bacteria 20256
324 Ga0207698_10001101 3300026142 Bacteria 15747
325 Ga0207698_10172845 3300026142 Bacteria 1904
326 Ga0207698_10189980 3300026142 Bacteria 1828
327 Ga0209813_10000022 3300027866 Bacteria 72813
328 Ga0268266_10012843 3300028379 Bacteria 7231
329 Ga0268266_10046959 3300028379 Bacteria 3697
330 Ga0268266_10567665 3300028379 Bacteria 1088
331 Ga0268266_11020659 3300028379 Bacteria 800
332 Ga0268266_12180433 3300028379 Bacteria 526
333 Ga0268265_10000046 3300028380 Bacteria 179361
334 Ga0268265_10000204 3300028380 Bacteria 68890
335 Ga0268264_10000001 3300028381 Bacteria 1221000
336 Ga0268264_10000069 3300028381 Bacteria 270492
337 Ga0268264_10000139 3300028381 Bacteria 171848
338 Ga0268264_10000229 3300028381 Bacteria 108305
339 Ga0268264_10013044 3300028381 Bacteria 6830
340 Ga0268264_10013240 3300028381 Bacteria 6789
341 Ga0268264_10013491 3300028381 Bacteria 6728
342 Ga0268264_10503592 3300028381 Bacteria 1181
343 Ga0314311_1012828 3300030733 Bacteria 1425
344 Ga0307508_10001675 3300031616 Bacteria 24607
345 Ga0307405_10210133 3300031731 Bacteria 1420
346 Ga0307405_11407951 3300031731 Bacteria 610
347 Ga0307406_10323422 3300031901 Bacteria 1194
348 Ga0307412_10003252 3300031911 Bacteria 9027
349 Ga0307412_10008319 3300031911 Bacteria 5914
350 Ga0307412_10225497 3300031911 Bacteria 1439
351 Ga0395905_0125855 3300037471 Bacteria 2410
352 Ga0395905_1361185 3300037471 Bacteria 614
353 Ga0395901_0056767 3300038443 Bacteria 4073
354 Ga0439447_140857 3300041407 Bacteria 554
355 Ga0439461_0002112 3300041410 Bacteria 3144
356 Ga0439466_0269951 3300041411 Bacteria 515
357 Ga0439465_0002362 3300041413 Bacteria 6189
358 Ga0451793_0723615 3300041452 Bacteria 652
359 Ga0451795_1280467 3300041456 Bacteria 659
360 Ga0439431_0063772 3300041997 Bacteria 973
361 Ga0439448_0006413 3300042005 Bacteria 3383
362 Ga0439432_199668 3300042006 Bacteria 580
363 Ga0439455_0014055 3300042012 Bacteria 1823
364 Ga0439462_0000203 3300042015 Bacteria 10309
365 Ga0450894_004385 3300042131 Bacteria 1833
366 Ga0439446_0013589 3300042156 Bacteria 2236
367 Ga0439458_0007872 3300042157 Bacteria 2370
368 Ga0439434_0001327 3300042435 Bacteria 7133
369 Ga0439434_0103531 3300042435 Bacteria 918
370 Ga0450918_024190 3300042531 Bacteria 1063
371 Ga0466973_0061162 3300044659 Bacteria 3410
372 Ga0453684_0954163 3300044712 Bacteria 915
373 Ga0495617_066636 3300046452 Bacteria 1186
374 Ga0495627_014898 3300046453 Bacteria 2698
375 Ga0495638_0000073 3300046460 Bacteria 164378
376 Ga0495638_0028804 3300046460 Bacteria 3584
377 Ga0495585_0007258 3300046492 Bacteria 6804
378 Ga0495585_0345527 3300046492 Bacteria 724
379 Ga0495583_0000087 3300046506 Bacteria 164974
380 Ga0495583_0004679 3300046506 Bacteria 9646
381 Ga0495583_0255552 3300046506 Bacteria 702
382 Ga0495606_0122798 3300046507 Bacteria 1552
383 Ga0495631_0011282 3300046518 Bacteria 4399
384 Ga0495631_0065744 3300046518 Bacteria 1569
385 Ga0495632_0000270 3300046519 Bacteria 51498
386 Ga0495643_0000073 3300046522 Bacteria 168344
387 Ga0495643_0000821 3300046522 Bacteria 33905
388 Ga0495643_0142485 3300046522 Bacteria 1194
389 Ga0495648_0000049 3300046524 Bacteria 164366
390 Ga0495648_0001291 3300046524 Bacteria 24914
391 Ga0495648_0042003 3300046524 Bacteria 2881
392 Ga0495663_0000384 3300046525 Bacteria 16337
393 Ga0495654_0018975 3300046530 Bacteria 3599
394 Ga0495597_0012950 3300046542 Bacteria 4005
395 Ga0495633_0000835 3300046558 Bacteria 27176
396 Ga0495633_0014074 3300046558 Bacteria 4195
397 Ga0495668_0173952 3300046616 Bacteria 1180
398 Ga0495668_0193130 3300046616 Bacteria 1115
399 Ga0495611_0016099 3300046648 Bacteria 3197
400 Ga0495625_0000083 3300046660 Bacteria 152144
401 Ga0495625_0000504 3300046660 Bacteria 57982
402 Ga0495625_0144756 3300046660 Bacteria 1601
403 Ga0495625_0815224 3300046660 Bacteria 541
404 Ga0495661_0218290 3300046665 Bacteria 989
405 Ga0495669_0022887 3300046684 Bacteria 2716
406 Ga0495669_0144968 3300046684 Bacteria 1122
407 Ga0495670_0028995 3300046691 Bacteria 2745
408 Ga0495671_0000042 3300046692 Bacteria 165201
409 Ga0495671_0040060 3300046692 Bacteria 2364
410 Ga0495649_0023890 3300046694 Bacteria 3413
411 Ga0495649_0680018 3300046694 Bacteria 505
412 Ga0495660_0015030 3300046810 Bacteria 4474
413 Ga0495636_0175656 3300047318 Bacteria 970
414 Ga0495636_0199572 3300047318 Bacteria 913
415 Ga0495683_0002424 3300047323 Bacteria 11275
416 Ga0495677_0030320 3300047445 Bacteria 1968
417 Ga0495673_0000111 3300047469 Bacteria 164974
418 Ga0495673_0284347 3300047469 Bacteria 596
419 Ga0495681_0004964 3300047470 Bacteria 8977
420 Ga0495681_0005683 3300047470 Bacteria 8304
421 Ga0495686_0007128 3300047472 Bacteria 8419
422 Ga0496100_0000293 3300048903 Bacteria 25054
423 Ga0496100_0002267 3300048903 Bacteria 9714
424 Ga0496101_0004670 3300048904 Bacteria 8671
425 Ga0496101_0062347 3300048904 Bacteria 2711
426 Ga0496102_0000481 3300048905 Bacteria 44268
427 Ga0496102_0000493 3300048905 Bacteria 43618
428 Ga0496103_0000045 3300048906 Bacteria 165828
429 Ga0496103_0000347 3300048906 Bacteria 42198
430 Ga0496103_0014007 3300048906 Bacteria 4760
431 Ga0496103_0242814 3300048906 Bacteria 1159
432 Ga0496104_0246076 3300048907 Bacteria 1701
433 Ga0496104_0350720 3300048907 Bacteria 1389
434 Ga0496105_0000310 3300048908 Bacteria 31950
435 Ga0496105_0115639 3300048908 Bacteria 2212
436 Ga0496106_0000047 3300048909 Bacteria 100449
437 Ga0496106_0371698 3300048909 Bacteria 1149
438 Ga0496107_0000035 3300048910 Bacteria 86628
439 Ga0496107_0000232 3300048910 Bacteria 29452
440 Ga0496109_0686862 3300048912 Bacteria 961
441 Ga0496109_1453136 3300048912 Bacteria 621
442 Ga0496110_0173460 3300048913 Bacteria 1957
443 Ga0496111_0023748 3300048914 Bacteria 4307
444 Ga0496112_0579223 3300048915 Bacteria 1055
445 Ga0496113_0066049 3300048916 Bacteria 2739
446 Ga0496114_0003057 3300048917 Bacteria 12816
447 Ga0496115_0000136 3300048918 Bacteria 67646
448 Ga0496116_0000193 3300048919 Bacteria 122203
449 Ga0496116_0014335 3300048919 Bacteria 6335
450 Ga0496116_0021771 3300048919 Bacteria 4824
451 Ga0496116_0132219 3300048919 Bacteria 1420
452 Ga0496117_0000046 3300048920 Bacteria 300879
453 Ga0496117_0001149 3300048920 Bacteria 39861
454 Ga0496117_0001656 3300048920 Bacteria 31249
455 Ga0496117_0025898 3300048920 Bacteria 4599
456 Ga0496117_0055953 3300048920 Bacteria 2752
457 Ga0496117_0072272 3300048920 Bacteria 2307
458 Ga0496117_0140715 3300048920 Bacteria 1445
459 Ga0496118_0000036 3300048921 Bacteria 318213
460 Ga0496118_0000156 3300048921 Bacteria 121630
461 Ga0496118_0001071 3300048921 Bacteria 42731
462 Ga0496118_0008681 3300048921 Bacteria 10445
463 Ga0496118_0023716 3300048921 Bacteria 5318
464 Ga0496118_0057954 3300048921 Bacteria 2899
465 Ga0496118_0226697 3300048921 Bacteria 1082
466 Ga0496119_0012384 3300048922 Bacteria 6934
467 Ga0496119_0035790 3300048922 Bacteria 3248
468 Ga0496119_0077142 3300048922 Bacteria 1931
469 Ga0496119_0215251 3300048922 Bacteria 986
470 Ga0496120_0011251 3300048923 Bacteria 6168
471 Ga0496121_0000267 3300048924 Bacteria 109129
472 Ga0496121_0008703 3300048924 Bacteria 11852
473 Ga0496121_0022946 3300048924 Bacteria 6030
474 Ga0496121_0082072 3300048924 Bacteria 2550
475 Ga0496122_0010908 3300048925 Bacteria 9293
476 Ga0496122_0011160 3300048925 Bacteria 9150
477 Ga0496123_0003433 3300048926 Bacteria 17794
478 Ga0496123_0089722 3300048926 Bacteria 1830
479 Ga0496124_0000011 3300048927 Bacteria 524145
480 Ga0496124_0000996 3300048927 Bacteria 44925
481 Ga0496124_0014240 3300048927 Bacteria 7704
482 Ga0496124_0901682 3300048927 Bacteria 536
483 Ga0496125_0000309 3300048928 Bacteria 96047
484 Ga0496125_0004416 3300048928 Bacteria 16247
485 Ga0496125_0299955 3300048928 Bacteria 985
486 Ga0496126_0000771 3300048929 Bacteria 57837
487 Ga0496126_1124125 3300048929 Bacteria 582
488 Ga0495678_025215 3300049459 Bacteria 2557
489 Ga0501298_100371 3300049521 Bacteria 659
490 Ga0501033_0838774 3300049570 Bacteria 620
491 Ga0501034_0163439 3300049571 Bacteria 2196
492 Ga0501034_0193038 3300049571 Bacteria 1998
493 Ga0501034_0305992 3300049571 Bacteria 1525
494 Ga0501036_1014176 3300049572 Bacteria 679
495 Ga0501037_0089386 3300049573 Bacteria 2229
496 Ga0501037_0165509 3300049573 Bacteria 1575
497 Ga0501039_0501514 3300049575 Bacteria 953
498 Ga0501039_0892037 3300049575 Bacteria 692
499 Ga0501043_0009351 3300049579 Bacteria 7697
500 Ga0501043_0481267 3300049579 Bacteria 929
501 Ga0501046_0099070 3300049580 Bacteria 2238
502 Ga0501047_0037604 3300049581 Bacteria 4680
503 Ga0501047_0137025 3300049581 Bacteria 2328
504 Ga0501047_0489583 3300049581 Bacteria 1057
505 Ga0501222_058846 3300049662 Bacteria 578
506 Ga0501257_000070 3300049686 Bacteria 26460
507 Ga0501259_000063 3300049688 Bacteria 14845
508 Ga0501261_000005 3300049690 Bacteria 80000
509 Ga0501245_001714 3300049708 Bacteria 2868
510 Ga0501269_037144 3300049766 Bacteria 640
511 Ga0501282_015249 3300049778 Bacteria 835
512 Ga0501035_0028723 3300049822 Bacteria 5074
513 Ga0501035_0181180 3300049822 Bacteria 1815
514 Ga0501044_0000453 3300049823 Bacteria 49990
515 Ga0501044_0025060 3300049823 Bacteria 6326
516 Ga0501044_0193118 3300049823 Bacteria 1997
517 Ga0501044_0475386 3300049823 Bacteria 1153
518 Ga0501044_0759502 3300049823 Bacteria 851
519 nmdc:mga0k408_126908_c1 3300050493 Bacteria 1513
520 nmdc:mga0k408_304895_c1 3300050493 Bacteria 950
521 nmdc:mga07m45_2_c1 3300050496 Bacteria 451154
522 nmdc:mga09592_163515_c1 3300050508 Bacteria 1923
523 nmdc:mga0sz30_69514_c1 3300050516 Bacteria 1514
524 Ga0495601_0004795 3300053077 Bacteria 7843
525 Ga0495601_0702328 3300053077 Bacteria 645
526 Ga0495619_0061614 3300053085 Bacteria 2496
527 Ga0500643_001365 3300053087 Bacteria 14159
528 Ga0500643_011896 3300053087 Bacteria 3145
529 Ga0500644_0033469 3300053088 Bacteria 1650
530 Ga0500647_0134914 3300053091 Bacteria 1162
531 Ga0500651_0049563 3300053093 Bacteria 2637
532 Ga0500566_0060749 3300053094 Bacteria 2140
533 Ga0500641_0013706 3300053096 Bacteria 2982
534 Ga0500592_000011 3300053116 Bacteria 73738
535 Ga0500595_068728 3300053119 Bacteria 1054
536 Ga0500614_007358 3300053123 Bacteria 2320
537 Ga0500642_0020139 3300053130 Bacteria 2616
538 Ga0500655_000088 3300053133 Bacteria 24231
539 Ga0500658_0001649 3300053134 Bacteria 8876
540 Ga0500658_0016625 3300053134 Bacteria 2742
541 Ga0500559_0115552 3300053136 Bacteria 1245
542 Ga0500568_0020652 3300053139 Bacteria 2846
543 Ga0500577_0111183 3300053142 Bacteria 1131
544 Ga0500590_007719 3300053148 Bacteria 5338
545 Ga0500604_0007243 3300053151 Bacteria 2940
546 Ga0500604_0019219 3300053151 Bacteria 1911
547 Ga0500604_0188270 3300053151 Bacteria 708
548 Ga0500622_0008732 3300053156 Bacteria 5651
549 Ga0500627_0000032 3300053158 Bacteria 84395
550 Ga0500627_0000590 3300053158 Bacteria 9731
551 Ga0500639_214460 3300053163 Bacteria 811
552 Ga0500636_0032948 3300053177 Bacteria 3068
553 Ga0500570_014959 3300053724 Bacteria 4355
554 Ga0500645_073673 3300053730 Bacteria 978
555 Ga0500645_077800 3300053730 Bacteria 948

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10408303 Ga0157380_104083033 120
2 3300049521 Ga0501298_100371 Ga0501298_100371_51_443 124
3 3300049662 Ga0501222_058846 Ga0501222_058846_27_419 124
4 3300049686 Ga0501257_000070 Ga0501257_000070_25074_25466 124
5 3300049688 Ga0501259_000063 Ga0501259_000063_882_1274 124
6 3300049690 Ga0501261_000005 Ga0501261_000005_38151_38543 124
7 3300049708 Ga0501245_001714 Ga0501245_001714_2302_2694 124
8 3300049778 Ga0501282_015249 Ga0501282_015249_56_448 124
9 iso_pu_bacteria 2582581305 2585264017 124
10 iso_pu_bacteria 2643221541 2643728654 124
11 iso_pu_bacteria 2643221606 2644042529 124
12 iso_pu_bacteria 2643221622 2644125424 124
13 iso_pu_bacteria 2643221671 2644392108 124
14 iso_pu_bacteria 2739367664 2739652383 124
15 iso_pu_bacteria 2739367865 2740030857 124
16 iso_pu_bacteria 2751185897 2753763209 124
17 iso_pu_bacteria 2775507255 2778126312 124
18 iso_pu_bacteria 2808606401 2809064557 124
19 iso_pu_bacteria 2808606404 2809080532 124
20 iso_pu_bacteria 2808606405 2809084896 124
21 iso_pu_bacteria 2880518877 2880523639 124
22 3300005335 Ga0070666_10005173 Ga0070666_100051733 127
23 3300005347 Ga0070668_100000842 Ga0070668_10000084213 127
24 3300005353 Ga0070669_100058704 Ga0070669_1000587042 127
25 3300005367 Ga0070667_100001638 Ga0070667_10000163811 127
26 3300005367 Ga0070667_100002555 Ga0070667_10000255512 127
27 3300005548 Ga0070665_101280644 Ga0070665_1012806441 127
28 3300005841 Ga0068863_100000169 Ga0068863_1000001694 127
29 3300005841 Ga0068863_100003732 Ga0068863_1000037322 127
30 3300005841 Ga0068863_100074852 Ga0068863_1000748525 127
31 3300005843 Ga0068860_100002340 Ga0068860_10000234012 127
32 3300005843 Ga0068860_100003659 Ga0068860_1000036595 127
33 3300006195 Ga0075366_10126594 Ga0075366_101265942 127
34 3300013102 Ga0157371_10125316 Ga0157371_101253163 127
35 3300025903 Ga0207680_10006852 Ga0207680_100068524 127
36 3300025923 Ga0207681_10050306 Ga0207681_100503063 127
37 3300025972 Ga0207668_10000265 Ga0207668_100002652 127
38 3300025986 Ga0207658_10000805 Ga0207658_1000080522 127
39 3300025986 Ga0207658_10001260 Ga0207658_100012603 127
40 3300026088 Ga0207641_10000181 Ga0207641_100001814 127
41 3300026088 Ga0207641_10010233 Ga0207641_100102332 127
42 3300026088 Ga0207641_10391737 Ga0207641_103917372 127
43 3300028379 Ga0268266_12180433 Ga0268266_121804331 127
44 3300028381 Ga0268264_10000229 Ga0268264_100002295 127
45 3300028381 Ga0268264_10013240 Ga0268264_100132402 127
46 3300031911 Ga0307412_10003252 Ga0307412_100032529 127
47 3300041452 Ga0451793_0723615 Ga0451793_0723615_212_595 127
48 3300046522 Ga0495643_0000073 Ga0495643_0000073_49353_49736 127
49 3300048929 Ga0496126_1124125 Ga0496126_1124125_127_510 127
50 3300050493 nmdc:mga0k408_126908_c1 nmdc:mga0k408_126908_c1_546_929 127
51 3300053077 Ga0495601_0004795 Ga0495601_0004795_4014_4397 127
52 3300053085 Ga0495619_0061614 Ga0495619_0061614_966_1349 127
53 3300053136 Ga0500559_0115552 Ga0500559_0115552_40_423 127
54 2162886006 SwRhRL3b_contig_1222108 SwRhRL3b_0784.00001220 128
55 2162886007 SwRhRL2b_contig_2859919 SwRhRL2b_0034.00006530 128
56 3300001979 JGI24740J21852_10000027 JGI24740J21852_1000002730 128
57 3300001979 JGI24740J21852_10004226 JGI24740J21852_100042266 128
58 3300001989 JGI24739J22299_10005808 JGI24739J22299_100058082 128
59 3300001989 JGI24739J22299_10080870 JGI24739J22299_100808702 128
60 3300001989 JGI24739J22299_10114684 JGI24739J22299_101146842 128
61 3300001990 JGI24737J22298_10004860 JGI24737J22298_100048605 128
62 3300001990 JGI24737J22298_10099372 JGI24737J22298_100993721 128
63 3300002067 JGI24735J21928_10006398 JGI24735J21928_100063982 128
64 3300002075 JGI24738J21930_10001851 JGI24738J21930_100018512 128
65 3300002459 JGI24751J29686_10000440 JGI24751J29686_1000044014 128
66 3300002459 JGI24751J29686_10000497 JGI24751J29686_100004976 128
67 3300002459 JGI24751J29686_10026212 JGI24751J29686_100262122 128
68 3300002774 JGI25150J39212_1000080 JGI25150J39212_10000802 128
69 3300003187 JGI25151J46595_10094567 JGI25151J46595_100945671 128
70 3300003215 JGI25153J46596_10000025 JGI25153J46596_1000002531 128
71 3300003215 JGI25153J46596_10027565 JGI25153J46596_100275652 128
72 3300003322 rootL2_10249575 rootL2_102495751 128
73 3300003323 rootH1_10044141 rootH1_100441412 128
74 3300003758 Ga0055532_1002166 Ga0055532_10021662 128
75 3300003773 Ga0055537_1002285 Ga0055537_10022852 128
76 3300003775 Ga0055524_1000165 Ga0055524_100016561 128
77 3300003794 Ga0055531_10016648 Ga0055531_100166482 128
78 3300004625 Ga0055543_1022956 Ga0055543_10229561 128
79 3300005262 Ga0065165_1008357 Ga0065165_10083576 128
80 3300005289 Ga0065704_10082602 Ga0065704_100826022 128
81 3300005295 Ga0065707_10081738 Ga0065707_1008173848 128
82 3300005327 Ga0070658_10000732 Ga0070658_1000073225 128
83 3300005327 Ga0070658_10168660 Ga0070658_101686602 128
84 3300005331 Ga0070670_100000919 Ga0070670_1000009197 128
85 3300005331 Ga0070670_100007788 Ga0070670_1000077885 128
86 3300005331 Ga0070670_100020112 Ga0070670_1000201123 128
87 3300005331 Ga0070670_100034334 Ga0070670_1000343344 128
88 3300005331 Ga0070670_100536236 Ga0070670_1005362362 128
89 3300005335 Ga0070666_10001752 Ga0070666_100017528 128
90 3300005335 Ga0070666_10016835 Ga0070666_100168356 128
91 3300005335 Ga0070666_10159037 Ga0070666_101590372 128
92 3300005337 Ga0070682_101863428 Ga0070682_1018634281 128
93 3300005339 Ga0070660_100010454 Ga0070660_1000104542 128
94 3300005339 Ga0070660_100032776 Ga0070660_1000327762 128
95 3300005339 Ga0070660_100112435 Ga0070660_1001124352 128
96 3300005344 Ga0070661_100008597 Ga0070661_1000085972 128
97 3300005347 Ga0070668_100000005 Ga0070668_10000000530 128
98 3300005347 Ga0070668_100024742 Ga0070668_1000247422 128
99 3300005347 Ga0070668_100224755 Ga0070668_1002247552 128
100 3300005347 Ga0070668_100456974 Ga0070668_1004569741 128
101 3300005353 Ga0070669_100000023 Ga0070669_1000000237 128
102 3300005353 Ga0070669_100123275 Ga0070669_1001232754 128
103 3300005354 Ga0070675_101019311 Ga0070675_1010193111 128
104 3300005355 Ga0070671_100000017 Ga0070671_100000017138 128
105 3300005355 Ga0070671_100000027 Ga0070671_10000002785 128
106 3300005355 Ga0070671_100005382 Ga0070671_1000053828 128
107 3300005355 Ga0070671_100016967 Ga0070671_1000169675 128
108 3300005355 Ga0070671_100457148 Ga0070671_1004571482 128
109 3300005367 Ga0070667_100000004 Ga0070667_10000000473 128
110 3300005367 Ga0070667_100000926 Ga0070667_1000009262 128
111 3300005367 Ga0070667_100001278 Ga0070667_10000127820 128
112 3300005367 Ga0070667_100242226 Ga0070667_1002422262 128
113 3300005367 Ga0070667_100601053 Ga0070667_1006010532 128
114 3300005455 Ga0070663_100163758 Ga0070663_1001637581 128
115 3300005455 Ga0070663_100189159 Ga0070663_1001891592 128
116 3300005457 Ga0070662_100406366 Ga0070662_1004063662 128
117 3300005457 Ga0070662_100783497 Ga0070662_1007834972 128
118 3300005535 Ga0070684_100735986 Ga0070684_1007359862 128
119 3300005539 Ga0068853_100014246 Ga0068853_1000142464 128
120 3300005539 Ga0068853_100075906 Ga0068853_1000759066 128
121 3300005539 Ga0068853_100732192 Ga0068853_1007321921 128
122 3300005539 Ga0068853_101115036 Ga0068853_1011150361 128
123 3300005543 Ga0070672_100106769 Ga0070672_1001067692 128
124 3300005544 Ga0070686_100086503 Ga0070686_1000865031 128
125 3300005548 Ga0070665_100007103 Ga0070665_1000071037 128
126 3300005548 Ga0070665_100015137 Ga0070665_1000151372 128
127 3300005548 Ga0070665_100220945 Ga0070665_1002209452 128
128 3300005548 Ga0070665_100820977 Ga0070665_1008209772 128
129 3300005564 Ga0070664_100635822 Ga0070664_1006358222 128
130 3300005564 Ga0070664_100663763 Ga0070664_1006637632 128
131 3300005577 Ga0068857_100023653 Ga0068857_1000236532 128
132 3300005577 Ga0068857_100683751 Ga0068857_1006837512 128
133 3300005577 Ga0068857_101419221 Ga0068857_1014192211 128
134 3300005577 Ga0068857_101837345 Ga0068857_1018373452 128
135 3300005578 Ga0068854_100214323 Ga0068854_1002143232 128
136 3300005578 Ga0068854_100572012 Ga0068854_1005720122 128
137 3300005578 Ga0068854_100672334 Ga0068854_1006723341 128
138 3300005614 Ga0068856_100037453 Ga0068856_1000374534 128
139 3300005614 Ga0068856_100060150 Ga0068856_1000601502 128
140 3300005616 Ga0068852_100002290 Ga0068852_1000022906 128
141 3300005616 Ga0068852_100025970 Ga0068852_1000259703 128
142 3300005616 Ga0068852_100116816 Ga0068852_1001168162 128
143 3300005616 Ga0068852_100222309 Ga0068852_1002223091 128
144 3300005616 Ga0068852_101634295 Ga0068852_1016342952 128
145 3300005617 Ga0068859_100000222 Ga0068859_10000022243 128
146 3300005617 Ga0068859_100005182 Ga0068859_10000518211 128
147 3300005617 Ga0068859_100039462 Ga0068859_1000394622 128
148 3300005617 Ga0068859_100051134 Ga0068859_1000511342 128
149 3300005617 Ga0068859_100111996 Ga0068859_1001119964 128
150 3300005617 Ga0068859_100112139 Ga0068859_1001121392 128
151 3300005618 Ga0068864_100004787 Ga0068864_1000047879 128
152 3300005618 Ga0068864_100013251 Ga0068864_1000132515 128
153 3300005719 Ga0068861_100012534 Ga0068861_1000125342 128
154 3300005834 Ga0068851_10016266 Ga0068851_100162664 128
155 3300005834 Ga0068851_10031427 Ga0068851_100314272 128
156 3300005841 Ga0068863_100000180 Ga0068863_10000018060 128
157 3300005841 Ga0068863_100020948 Ga0068863_1000209483 128
158 3300005841 Ga0068863_100105718 Ga0068863_1001057181 128
159 3300005841 Ga0068863_100326954 Ga0068863_1003269542 128
160 3300005842 Ga0068858_100005317 Ga0068858_10000531712 128
161 3300005842 Ga0068858_100007319 Ga0068858_1000073199 128
162 3300005842 Ga0068858_100021538 Ga0068858_1000215383 128
163 3300005843 Ga0068860_100000002 Ga0068860_10000000259 128
164 3300005843 Ga0068860_100000076 Ga0068860_10000007618 128
165 3300005843 Ga0068860_100010828 Ga0068860_10001082813 128
166 3300005843 Ga0068860_100013735 Ga0068860_1000137355 128
167 3300005843 Ga0068860_100289225 Ga0068860_1002892252 128
168 3300005843 Ga0068860_100509856 Ga0068860_1005098562 128
169 3300005844 Ga0068862_100003522 Ga0068862_1000035224 128
170 3300005844 Ga0068862_100004848 Ga0068862_10000484811 128
171 3300006042 Ga0075368_10000004 Ga0075368_1000000452 128
172 3300006048 Ga0075363_100000007 Ga0075363_10000000742 128
173 3300006051 Ga0075364_10000003 Ga0075364_1000000391 128
174 3300006177 Ga0075362_10000675 Ga0075362_100006753 128
175 3300006178 Ga0075367_10000036 Ga0075367_100000366 128
176 3300006178 Ga0075367_10344496 Ga0075367_103444962 128
177 3300006186 Ga0075369_10001160 Ga0075369_100011609 128
178 3300006195 Ga0075366_10002940 Ga0075366_100029403 128
179 3300006195 Ga0075366_10377669 Ga0075366_103776692 128
180 3300006353 Ga0075370_10000001 Ga0075370_10000001107 128
181 3300006353 Ga0075370_10000092 Ga0075370_1000009223 128
182 3300006931 Ga0097620_100000222 Ga0097620_10000022213 128
183 3300006931 Ga0097620_100005182 Ga0097620_10000518211 128
184 3300006931 Ga0097620_100039463 Ga0097620_1000394632 128
185 3300006931 Ga0097620_100051139 Ga0097620_1000511394 128
186 3300006931 Ga0097620_100111997 Ga0097620_1001119974 128
187 3300006931 Ga0097620_100112137 Ga0097620_1001121372 128
188 3300009011 Ga0105251_10000071 Ga0105251_1000007115 128
189 3300009093 Ga0105240_11223108 Ga0105240_112231081 128
190 3300009098 Ga0105245_10009117 Ga0105245_100091172 128
191 3300009101 Ga0105247_10002563 Ga0105247_1000256310 128
192 3300009101 Ga0105247_10221912 Ga0105247_102219122 128
193 3300009148 Ga0105243_10118450 Ga0105243_101184502 128
194 3300009148 Ga0105243_10353511 Ga0105243_103535112 128
195 3300009174 Ga0105241_10087920 Ga0105241_100879202 128
196 3300009174 Ga0105241_11340310 Ga0105241_113403102 128
197 3300009176 Ga0105242_10391373 Ga0105242_103913731 128
198 3300009177 Ga0105248_10000215 Ga0105248_1000021513 128
199 3300009177 Ga0105248_10001699 Ga0105248_100016992 128
200 3300009177 Ga0105248_10042744 Ga0105248_100427442 128
201 3300009177 Ga0105248_10518421 Ga0105248_105184212 128
202 3300009177 Ga0105248_10619197 Ga0105248_106191972 128
203 3300009177 Ga0105248_11337382 Ga0105248_113373821 128
204 3300009545 Ga0105237_10013174 Ga0105237_100131742 128
205 3300009545 Ga0105237_10740706 Ga0105237_107407062 128
206 3300009551 Ga0105238_10011466 Ga0105238_100114663 128
207 3300009551 Ga0105238_10073130 Ga0105238_100731304 128
208 3300009553 Ga0105249_10000037 Ga0105249_1000003751 128
209 3300009553 Ga0105249_10003751 Ga0105249_1000375120 128
210 3300009553 Ga0105249_10043616 Ga0105249_100436163 128
211 3300009553 Ga0105249_10096738 Ga0105249_100967382 128
212 3300009553 Ga0105249_10265716 Ga0105249_102657162 128
213 3300009553 Ga0105249_10691019 Ga0105249_106910192 128
214 3300010375 Ga0105239_10091863 Ga0105239_100918632 128
215 3300011119 Ga0105246_10549576 Ga0105246_105495762 128
216 3300012513 Ga0157326_1003355 Ga0157326_10033552 128
217 3300012513 Ga0157326_1054590 Ga0157326_10545902 128
218 3300013100 Ga0157373_10163390 Ga0157373_101633901 128
219 3300013100 Ga0157373_10330442 Ga0157373_103304422 128
220 3300013104 Ga0157370_10028542 Ga0157370_100285422 128
221 3300013104 Ga0157370_10255508 Ga0157370_102555081 128
222 3300013296 Ga0157374_10208625 Ga0157374_102086253 128
223 3300013297 Ga0157378_10010139 Ga0157378_100101392 128
224 3300013307 Ga0157372_10360404 Ga0157372_103604042 128
225 3300013308 Ga0157375_10392127 Ga0157375_103921272 128
226 3300014325 Ga0163163_10058436 Ga0163163_100584362 128
227 3300014326 Ga0157380_10000338 Ga0157380_1000033834 128
228 3300014326 Ga0157380_10396282 Ga0157380_103962822 128
229 3300014326 Ga0157380_12049952 Ga0157380_120499522 128
230 3300014968 Ga0157379_10068957 Ga0157379_100689574 128
231 3300014968 Ga0157379_10163282 Ga0157379_101632823 128
232 3300017792 Ga0163161_10046923 Ga0163161_100469232 128
233 3300017792 Ga0163161_10164283 Ga0163161_101642831 128
234 3300017792 Ga0163161_10405967 Ga0163161_104059672 128
235 3300025229 Ga0209147_100193 Ga0209147_10019334 128
236 3300025229 Ga0209147_100193 Ga0209147_10019349 128
237 3300025245 Ga0207425_1000027 Ga0207425_100002735 128
238 3300025258 Ga0209129_1001145 Ga0209129_100114513 128
239 3300025263 Ga0209565_1000007 Ga0209565_1000007515 128
240 3300025263 Ga0209565_1002221 Ga0209565_10022218 128
241 3300025272 Ga0209455_1011052 Ga0209455_10110523 128
242 3300025273 Ga0209673_1001760 Ga0209673_100176011 128
243 3300025291 Ga0209675_1055659 Ga0209675_10556591 128
244 3300025292 Ga0209676_1004998 Ga0209676_10049985 128
245 3300025292 Ga0209676_1020009 Ga0209676_10200092 128
246 3300025294 Ga0209025_1002001 Ga0209025_100200112 128
247 3300025295 Ga0209564_1075041 Ga0209564_10750412 128
248 3300025297 Ga0209758_1000009 Ga0209758_1000009208 128
249 3300025297 Ga0209758_1014811 Ga0209758_10148113 128
250 3300025297 Ga0209758_1019936 Ga0209758_10199362 128
251 3300025298 Ga0209050_1000005 Ga0209050_1000005956 128
252 3300025298 Ga0209050_1000306 Ga0209050_10003062 128
253 3300025298 Ga0209050_1006913 Ga0209050_10069133 128
254 3300025298 Ga0209050_1013810 Ga0209050_10138102 128
255 3300025298 Ga0209050_1036282 Ga0209050_10362821 128
256 3300025298 Ga0209050_1058224 Ga0209050_10582242 128
257 3300025298 Ga0209050_1086656 Ga0209050_10866561 128
258 3300025299 Ga0209256_1000008 Ga0209256_1000008357 128
259 3300025303 Ga0209051_1000525 Ga0209051_100052511 128
260 3300025304 Ga0209257_1004962 Ga0209257_10049627 128
261 3300025304 Ga0209257_1004986 Ga0209257_10049867 128
262 3300025304 Ga0209257_1006030 Ga0209257_10060304 128
263 3300025315 Ga0207697_10001759 Ga0207697_100017594 128
264 3300025321 Ga0207656_10028345 Ga0207656_100283453 128
265 3300025321 Ga0207656_10075570 Ga0207656_100755702 128
266 3300025735 Ga0207713_1001241 Ga0207713_100124122 128
267 3300025900 Ga0207710_10001753 Ga0207710_100017539 128
268 3300025900 Ga0207710_10027488 Ga0207710_100274882 128
269 3300025903 Ga0207680_10000030 Ga0207680_1000003027 128
270 3300025903 Ga0207680_10011474 Ga0207680_100114745 128
271 3300025903 Ga0207680_10291364 Ga0207680_102913641 128
272 3300025904 Ga0207647_10000037 Ga0207647_1000003759 128
273 3300025904 Ga0207647_10000283 Ga0207647_1000028333 128
274 3300025904 Ga0207647_10007862 Ga0207647_100078627 128
275 3300025909 Ga0207705_10000318 Ga0207705_1000031818 128
276 3300025909 Ga0207705_10083002 Ga0207705_100830022 128
277 3300025909 Ga0207705_10866818 Ga0207705_108668181 128
278 3300025911 Ga0207654_10011219 Ga0207654_100112191 128
279 3300025911 Ga0207654_10718201 Ga0207654_107182012 128
280 3300025914 Ga0207671_10003187 Ga0207671_1000318718 128
281 3300025914 Ga0207671_11441810 Ga0207671_114418101 128
282 3300025919 Ga0207657_10006137 Ga0207657_1000613715 128
283 3300025919 Ga0207657_10018007 Ga0207657_100180079 128
284 3300025919 Ga0207657_10043386 Ga0207657_100433864 128
285 3300025920 Ga0207649_10032910 Ga0207649_100329102 128
286 3300025923 Ga0207681_10000004 Ga0207681_10000004171 128
287 3300025923 Ga0207681_10178284 Ga0207681_101782842 128
288 3300025924 Ga0207694_10074360 Ga0207694_100743603 128
289 3300025925 Ga0207650_10004287 Ga0207650_100042875 128
290 3300025925 Ga0207650_10044802 Ga0207650_100448022 128
291 3300025925 Ga0207650_10048381 Ga0207650_100483812 128
292 3300025925 Ga0207650_10114020 Ga0207650_101140203 128
293 3300025927 Ga0207687_10022221 Ga0207687_100222214 128
294 3300025931 Ga0207644_10000024 Ga0207644_10000024135 128
295 3300025931 Ga0207644_10005374 Ga0207644_100053744 128
296 3300025931 Ga0207644_10143367 Ga0207644_101433672 128
297 3300025932 Ga0207690_10038914 Ga0207690_100389142 128
298 3300025933 Ga0207706_10003179 Ga0207706_100031798 128
299 3300025933 Ga0207706_10458062 Ga0207706_104580622 128
300 3300025933 Ga0207706_10541448 Ga0207706_105414482 128
301 3300025934 Ga0207686_10764736 Ga0207686_107647362 128
302 3300025936 Ga0207670_10866149 Ga0207670_108661493 128
303 3300025938 Ga0207704_11319133 Ga0207704_113191331 128
304 3300025941 Ga0207711_10005829 Ga0207711_1000582913 128
305 3300025941 Ga0207711_10029671 Ga0207711_100296712 128
306 3300025941 Ga0207711_10080001 Ga0207711_100800013 128
307 3300025941 Ga0207711_10537824 Ga0207711_105378241 128
308 3300025941 Ga0207711_11333390 Ga0207711_113333902 128
309 3300025945 Ga0207679_10933838 Ga0207679_109338382 128
310 3300025949 Ga0207667_10005214 Ga0207667_1000521414 128
311 3300025949 Ga0207667_10758276 Ga0207667_107582762 128
312 3300025961 Ga0207712_10000035 Ga0207712_1000003552 128
313 3300025961 Ga0207712_10002076 Ga0207712_1000207621 128
314 3300025961 Ga0207712_10089181 Ga0207712_100891812 128
315 3300025961 Ga0207712_10344285 Ga0207712_103442852 128
316 3300025961 Ga0207712_10741785 Ga0207712_107417852 128
317 3300025972 Ga0207668_10000024 Ga0207668_10000024145 128
318 3300025972 Ga0207668_10006763 Ga0207668_100067632 128
319 3300025972 Ga0207668_10487586 Ga0207668_104875861 128
320 3300025972 Ga0207668_10644976 Ga0207668_106449761 128
321 3300025981 Ga0207640_10124675 Ga0207640_101246752 128
322 3300025981 Ga0207640_10326145 Ga0207640_103261452 128
323 3300025981 Ga0207640_10465590 Ga0207640_104655902 128
324 3300025986 Ga0207658_10000002 Ga0207658_10000002366 128
325 3300025986 Ga0207658_10001681 Ga0207658_100016816 128
326 3300025986 Ga0207658_10002307 Ga0207658_100023072 128
327 3300025986 Ga0207658_10005226 Ga0207658_100052263 128
328 3300025986 Ga0207658_10104779 Ga0207658_101047794 128
329 3300026035 Ga0207703_10001071 Ga0207703_100010719 128
330 3300026035 Ga0207703_10005709 Ga0207703_1000570910 128
331 3300026035 Ga0207703_10030236 Ga0207703_100302362 128
332 3300026041 Ga0207639_10020538 Ga0207639_100205384 128
333 3300026041 Ga0207639_10030857 Ga0207639_100308572 128
334 3300026041 Ga0207639_12019499 Ga0207639_120194992 128
335 3300026067 Ga0207678_10428357 Ga0207678_104283572 128
336 3300026067 Ga0207678_10680341 Ga0207678_106803412 128
337 3300026078 Ga0207702_10056612 Ga0207702_100566122 128
338 3300026078 Ga0207702_10152972 Ga0207702_101529722 128
339 3300026078 Ga0207702_10220120 Ga0207702_102201201 128
340 3300026088 Ga0207641_10000993 Ga0207641_1000099324 128
341 3300026088 Ga0207641_10001724 Ga0207641_1000172410 128
342 3300026088 Ga0207641_10028187 Ga0207641_100281872 128
343 3300026088 Ga0207641_10144018 Ga0207641_101440182 128
344 3300026088 Ga0207641_10593907 Ga0207641_105939072 128
345 3300026088 Ga0207641_11293094 Ga0207641_112930942 128
346 3300026095 Ga0207676_10000041 Ga0207676_10000041132 128
347 3300026095 Ga0207676_10001253 Ga0207676_1000125317 128
348 3300026095 Ga0207676_11451931 Ga0207676_114519312 128
349 3300026116 Ga0207674_10005947 Ga0207674_100059473 128
350 3300026116 Ga0207674_10066940 Ga0207674_100669402 128
351 3300026116 Ga0207674_10263918 Ga0207674_102639182 128
352 3300026116 Ga0207674_10313693 Ga0207674_103136932 128
353 3300026116 Ga0207674_10588448 Ga0207674_105884482 128
354 3300026118 Ga0207675_100046282 Ga0207675_1000462822 128
355 3300026142 Ga0207698_10000638 Ga0207698_1000063822 128
356 3300026142 Ga0207698_10001101 Ga0207698_100011012 128
357 3300026142 Ga0207698_10172845 Ga0207698_101728452 128
358 3300026142 Ga0207698_10189980 Ga0207698_101899802 128
359 3300027866 Ga0209813_10000022 Ga0209813_1000002252 128
360 3300028379 Ga0268266_10012843 Ga0268266_100128432 128
361 3300028379 Ga0268266_10046959 Ga0268266_100469593 128
362 3300028379 Ga0268266_10567665 Ga0268266_105676652 128
363 3300028379 Ga0268266_11020659 Ga0268266_110206591 128
364 3300028380 Ga0268265_10000046 Ga0268265_10000046172 128
365 3300028380 Ga0268265_10000204 Ga0268265_100002044 128
366 3300028381 Ga0268264_10000001 Ga0268264_10000001691 128
367 3300028381 Ga0268264_10000069 Ga0268264_10000069254 128
368 3300028381 Ga0268264_10000139 Ga0268264_10000139118 128
369 3300028381 Ga0268264_10013044 Ga0268264_100130449 128
370 3300028381 Ga0268264_10013491 Ga0268264_100134913 128
371 3300028381 Ga0268264_10503592 Ga0268264_105035922 128
372 3300030733 Ga0314311_1012828 Ga0314311_10128282 128
373 3300031616 Ga0307508_10001675 Ga0307508_1000167527 128
374 3300031731 Ga0307405_10210133 Ga0307405_102101332 128
375 3300031731 Ga0307405_11407951 Ga0307405_114079512 128
376 3300031901 Ga0307406_10323422 Ga0307406_103234223 128
377 3300031911 Ga0307412_10008319 Ga0307412_100083194 128
378 3300031911 Ga0307412_10225497 Ga0307412_102254972 128
379 3300037471 Ga0395905_0125855 Ga0395905_0125855_1616_2020 128
380 3300037471 Ga0395905_1361185 Ga0395905_1361185_54_449 128
381 3300038443 Ga0395901_0056767 Ga0395901_0056767_2601_3005 128
382 3300041407 Ga0439447_140857 Ga0439447_140857_101_493 128
383 3300041410 Ga0439461_0002112 Ga0439461_0002112_1671_2063 128
384 3300041411 Ga0439466_0269951 Ga0439466_0269951_67_459 128
385 3300041413 Ga0439465_0002362 Ga0439465_0002362_3008_3400 128
386 3300041456 Ga0451795_1280467 Ga0451795_1280467_47_439 128
387 3300041997 Ga0439431_0063772 Ga0439431_0063772_473_862 128
388 3300042005 Ga0439448_0006413 Ga0439448_0006413_1618_2025 128
389 3300042006 Ga0439432_199668 Ga0439432_199668_159_551 128
390 3300042012 Ga0439455_0014055 Ga0439455_0014055_1270_1677 128
391 3300042015 Ga0439462_0000203 Ga0439462_0000203_8005_8397 128
392 3300042131 Ga0450894_004385 Ga0450894_004385_1237_1629 128
393 3300042156 Ga0439446_0013589 Ga0439446_0013589_1095_1487 128
394 3300042157 Ga0439458_0007872 Ga0439458_0007872_95_496 128
395 3300042435 Ga0439434_0001327 Ga0439434_0001327_2480_2872 128
396 3300042435 Ga0439434_0103531 Ga0439434_0103531_189_578 128
397 3300042531 Ga0450918_024190 Ga0450918_024190_163_555 128
398 3300044659 Ga0466973_0061162 Ga0466973_0061162_2756_3145 128
399 3300044712 Ga0453684_0954163 Ga0453684_0954163_376_762 128
400 3300046452 Ga0495617_066636 Ga0495617_066636_531_923 128
401 3300046453 Ga0495627_014898 Ga0495627_014898_1884_2270 128
402 3300046460 Ga0495638_0000073 Ga0495638_0000073_163664_164056 128
403 3300046460 Ga0495638_0028804 Ga0495638_0028804_264_650 128
404 3300046492 Ga0495585_0007258 Ga0495585_0007258_3631_4017 128
405 3300046492 Ga0495585_0345527 Ga0495585_0345527_78_464 128
406 3300046506 Ga0495583_0000087 Ga0495583_0000087_164338_164730 128
407 3300046506 Ga0495583_0004679 Ga0495583_0004679_8263_8652 128
408 3300046506 Ga0495583_0255552 Ga0495583_0255552_11_397 128
409 3300046507 Ga0495606_0122798 Ga0495606_0122798_42_431 128
410 3300046518 Ga0495631_0011282 Ga0495631_0011282_724_1113 128
411 3300046518 Ga0495631_0065744 Ga0495631_0065744_167_556 128
412 3300046519 Ga0495632_0000270 Ga0495632_0000270_50784_51176 128
413 3300046522 Ga0495643_0000821 Ga0495643_0000821_20637_21026 128
414 3300046522 Ga0495643_0142485 Ga0495643_0142485_405_791 128
415 3300046524 Ga0495648_0000049 Ga0495648_0000049_163664_164056 128
416 3300046524 Ga0495648_0001291 Ga0495648_0001291_18001_18390 128
417 3300046524 Ga0495648_0042003 Ga0495648_0042003_1085_1492 128
418 3300046525 Ga0495663_0000384 Ga0495663_0000384_4548_4937 128
419 3300046530 Ga0495654_0018975 Ga0495654_0018975_2991_3395 128
420 3300046542 Ga0495597_0012950 Ga0495597_0012950_2425_2811 128
421 3300046558 Ga0495633_0000835 Ga0495633_0000835_12881_13270 128
422 3300046558 Ga0495633_0014074 Ga0495633_0014074_3675_4067 128
423 3300046616 Ga0495668_0173952 Ga0495668_0173952_612_1001 128
424 3300046616 Ga0495668_0193130 Ga0495668_0193130_520_906 128
425 3300046648 Ga0495611_0016099 Ga0495611_0016099_1666_2055 128
426 3300046660 Ga0495625_0000083 Ga0495625_0000083_137637_138026 128
427 3300046660 Ga0495625_0000504 Ga0495625_0000504_52413_52799 128
428 3300046660 Ga0495625_0144756 Ga0495625_0144756_148_537 128
429 3300046660 Ga0495625_0815224 Ga0495625_0815224_13_402 128
430 3300046665 Ga0495661_0218290 Ga0495661_0218290_29_415 128
431 3300046684 Ga0495669_0022887 Ga0495669_0022887_881_1267 128
432 3300046684 Ga0495669_0144968 Ga0495669_0144968_83_487 128
433 3300046691 Ga0495670_0028995 Ga0495670_0028995_1902_2291 128
434 3300046692 Ga0495671_0000042 Ga0495671_0000042_164565_164957 128
435 3300046692 Ga0495671_0040060 Ga0495671_0040060_1023_1412 128
436 3300046694 Ga0495649_0023890 Ga0495649_0023890_2620_3009 128
437 3300046694 Ga0495649_0680018 Ga0495649_0680018_39_443 128
438 3300046810 Ga0495660_0015030 Ga0495660_0015030_1529_1918 128
439 3300047318 Ga0495636_0175656 Ga0495636_0175656_167_553 128
440 3300047318 Ga0495636_0199572 Ga0495636_0199572_220_609 128
441 3300047323 Ga0495683_0002424 Ga0495683_0002424_2970_3359 128
442 3300047445 Ga0495677_0030320 Ga0495677_0030320_856_1245 128
443 3300047469 Ga0495673_0000111 Ga0495673_0000111_245_637 128
444 3300047469 Ga0495673_0284347 Ga0495673_0284347_148_537 128
445 3300047470 Ga0495681_0004964 Ga0495681_0004964_1211_1600 128
446 3300047470 Ga0495681_0005683 Ga0495681_0005683_6739_7125 128
447 3300047472 Ga0495686_0007128 Ga0495686_0007128_1723_2112 128
448 3300048903 Ga0496100_0000293 Ga0496100_0000293_11174_11560 128
449 3300048903 Ga0496100_0002267 Ga0496100_0002267_2847_3233 128
450 3300048904 Ga0496101_0004670 Ga0496101_0004670_5714_6100 128
451 3300048904 Ga0496101_0062347 Ga0496101_0062347_1073_1459 128
452 3300048905 Ga0496102_0000481 Ga0496102_0000481_36161_36547 128
453 3300048905 Ga0496102_0000493 Ga0496102_0000493_30772_31161 128
454 3300048906 Ga0496103_0000045 Ga0496103_0000045_8258_8647 128
455 3300048906 Ga0496103_0000347 Ga0496103_0000347_35933_36319 128
456 3300048906 Ga0496103_0014007 Ga0496103_0014007_2584_2970 128
457 3300048906 Ga0496103_0242814 Ga0496103_0242814_38_442 128
458 3300048907 Ga0496104_0246076 Ga0496104_0246076_692_1078 128
459 3300048907 Ga0496104_0350720 Ga0496104_0350720_621_1010 128
460 3300048908 Ga0496105_0000310 Ga0496105_0000310_3857_4246 128
461 3300048908 Ga0496105_0115639 Ga0496105_0115639_1525_1911 128
462 3300048909 Ga0496106_0000047 Ga0496106_0000047_37804_38190 128
463 3300048909 Ga0496106_0000047 Ga0496106_0000047_67950_68336 128
464 3300048909 Ga0496106_0371698 Ga0496106_0371698_372_776 128
465 3300048910 Ga0496107_0000035 Ga0496107_0000035_66076_66462 128
466 3300048910 Ga0496107_0000232 Ga0496107_0000232_9721_10107 128
467 3300048912 Ga0496109_0686862 Ga0496109_0686862_58_447 128
468 3300048912 Ga0496109_1453136 Ga0496109_1453136_101_505 128
469 3300048913 Ga0496110_0173460 Ga0496110_0173460_1545_1934 128
470 3300048914 Ga0496111_0023748 Ga0496111_0023748_496_885 128
471 3300048915 Ga0496112_0579223 Ga0496112_0579223_389_778 128
472 3300048916 Ga0496113_0066049 Ga0496113_0066049_1094_1483 128
473 3300048917 Ga0496114_0003057 Ga0496114_0003057_304_693 128
474 3300048918 Ga0496115_0000136 Ga0496115_0000136_59477_59866 128
475 3300048919 Ga0496116_0000193 Ga0496116_0000193_27523_27909 128
476 3300048919 Ga0496116_0014335 Ga0496116_0014335_4659_5045 128
477 3300048919 Ga0496116_0021771 Ga0496116_0021771_1579_1968 128
478 3300048919 Ga0496116_0132219 Ga0496116_0132219_752_1159 128
479 3300048920 Ga0496117_0000046 Ga0496117_0000046_267081_267470 128
480 3300048920 Ga0496117_0001149 Ga0496117_0001149_3752_4138 128
481 3300048920 Ga0496117_0001656 Ga0496117_0001656_27437_27823 128
482 3300048920 Ga0496117_0025898 Ga0496117_0025898_4072_4458 128
483 3300048920 Ga0496117_0055953 Ga0496117_0055953_1200_1589 128
484 3300048920 Ga0496117_0072272 Ga0496117_0072272_1869_2273 128
485 3300048920 Ga0496117_0140715 Ga0496117_0140715_648_1055 128
486 3300048921 Ga0496118_0000036 Ga0496118_0000036_33410_33799 128
487 3300048921 Ga0496118_0000156 Ga0496118_0000156_27865_28251 128
488 3300048921 Ga0496118_0001071 Ga0496118_0001071_39369_39755 128
489 3300048921 Ga0496118_0008681 Ga0496118_0008681_6267_6653 128
490 3300048921 Ga0496118_0023716 Ga0496118_0023716_3855_4244 128
491 3300048921 Ga0496118_0057954 Ga0496118_0057954_897_1301 128
492 3300048921 Ga0496118_0226697 Ga0496118_0226697_536_943 128
493 3300048922 Ga0496119_0012384 Ga0496119_0012384_761_1150 128
494 3300048922 Ga0496119_0035790 Ga0496119_0035790_482_868 128
495 3300048922 Ga0496119_0077142 Ga0496119_0077142_983_1387 128
496 3300048922 Ga0496119_0215251 Ga0496119_0215251_358_765 128
497 3300048923 Ga0496120_0011251 Ga0496120_0011251_637_1026 128
498 3300048924 Ga0496121_0000267 Ga0496121_0000267_106683_107072 128
499 3300048924 Ga0496121_0008703 Ga0496121_0008703_10810_11214 128
500 3300048924 Ga0496121_0022946 Ga0496121_0022946_1692_2135 128
501 3300048924 Ga0496121_0082072 Ga0496121_0082072_1240_1626 128
502 3300048925 Ga0496122_0010908 Ga0496122_0010908_7877_8266 128
503 3300048925 Ga0496122_0011160 Ga0496122_0011160_1523_1927 128
504 3300048926 Ga0496123_0003433 Ga0496123_0003433_7521_7910 128
505 3300048926 Ga0496123_0089722 Ga0496123_0089722_907_1311 128
506 3300048927 Ga0496124_0000011 Ga0496124_0000011_420316_420705 128
507 3300048927 Ga0496124_0000996 Ga0496124_0000996_8342_8728 128
508 3300048927 Ga0496124_0014240 Ga0496124_0014240_4251_4637 128
509 3300048927 Ga0496124_0901682 Ga0496124_0901682_29_433 128
510 3300048928 Ga0496125_0000309 Ga0496125_0000309_7814_8203 128
511 3300048928 Ga0496125_0004416 Ga0496125_0004416_8210_8596 128
512 3300048928 Ga0496125_0299955 Ga0496125_0299955_277_663 128
513 3300048929 Ga0496126_0000771 Ga0496126_0000771_33410_33799 128
514 3300049459 Ga0495678_025215 Ga0495678_025215_646_1032 128
515 3300049570 Ga0501033_0838774 Ga0501033_0838774_197_607 128
516 3300049571 Ga0501034_0163439 Ga0501034_0163439_104_514 128
517 3300049571 Ga0501034_0193038 Ga0501034_0193038_924_1334 128
518 3300049571 Ga0501034_0305992 Ga0501034_0305992_1024_1410 128
519 3300049572 Ga0501036_1014176 Ga0501036_1014176_223_633 128
520 3300049573 Ga0501037_0089386 Ga0501037_0089386_1619_2029 128
521 3300049573 Ga0501037_0165509 Ga0501037_0165509_754_1140 128
522 3300049575 Ga0501039_0501514 Ga0501039_0501514_389_775 128
523 3300049575 Ga0501039_0892037 Ga0501039_0892037_121_510 128
524 3300049579 Ga0501043_0009351 Ga0501043_0009351_1127_1513 128
525 3300049579 Ga0501043_0481267 Ga0501043_0481267_186_587 128
526 3300049580 Ga0501046_0099070 Ga0501046_0099070_251_637 128
527 3300049581 Ga0501047_0037604 Ga0501047_0037604_2014_2400 128
528 3300049581 Ga0501047_0137025 Ga0501047_0137025_1723_2133 128
529 3300049581 Ga0501047_0489583 Ga0501047_0489583_285_674 128
530 3300049766 Ga0501269_037144 Ga0501269_037144_144_536 128
531 3300049822 Ga0501035_0028723 Ga0501035_0028723_380_766 128
532 3300049822 Ga0501035_0181180 Ga0501035_0181180_815_1225 128
533 3300049823 Ga0501044_0000453 Ga0501044_0000453_35961_36350 128
534 3300049823 Ga0501044_0025060 Ga0501044_0025060_3027_3437 128
535 3300049823 Ga0501044_0193118 Ga0501044_0193118_1347_1733 128
536 3300049823 Ga0501044_0475386 Ga0501044_0475386_149_535 128
537 3300049823 Ga0501044_0759502 Ga0501044_0759502_299_700 128
538 3300050493 nmdc:mga0k408_304895_c1 nmdc:mga0k408_304895_c1_334_723 128
539 3300050496 nmdc:mga07m45_2_c1 nmdc:mga07m45_2_c1_146409_146804 128
540 3300050508 nmdc:mga09592_163515_c1 nmdc:mga09592_163515_c1_1212_1607 128
541 3300050516 nmdc:mga0sz30_69514_c1 nmdc:mga0sz30_69514_c1_419_808 128
542 3300053077 Ga0495601_0702328 Ga0495601_0702328_224_613 128
543 3300053087 Ga0500643_001365 Ga0500643_001365_3357_3749 128
544 3300053087 Ga0500643_011896 Ga0500643_011896_1825_2211 128
545 3300053088 Ga0500644_0033469 Ga0500644_0033469_1132_1524 128
546 3300053091 Ga0500647_0134914 Ga0500647_0134914_187_573 128
547 3300053093 Ga0500651_0049563 Ga0500651_0049563_2189_2575 128
548 3300053094 Ga0500566_0060749 Ga0500566_0060749_217_621 128
549 3300053096 Ga0500641_0013706 Ga0500641_0013706_172_558 128
550 3300053116 Ga0500592_000011 Ga0500592_000011_71955_72359 128
551 3300053119 Ga0500595_068728 Ga0500595_068728_100_489 128
552 3300053123 Ga0500614_007358 Ga0500614_007358_1482_1868 128
553 3300053130 Ga0500642_0020139 Ga0500642_0020139_996_1385 128
554 3300053133 Ga0500655_000088 Ga0500655_000088_14971_15357 128
555 3300053134 Ga0500658_0001649 Ga0500658_0001649_2926_3315 128
556 3300053134 Ga0500658_0016625 Ga0500658_0016625_1559_1945 128
557 3300053139 Ga0500568_0020652 Ga0500568_0020652_1525_1911 128
558 3300053142 Ga0500577_0111183 Ga0500577_0111183_446_832 128
559 3300053148 Ga0500590_007719 Ga0500590_007719_4341_4727 128
560 3300053151 Ga0500604_0007243 Ga0500604_0007243_1780_2166 128
561 3300053151 Ga0500604_0019219 Ga0500604_0019219_1272_1661 128
562 3300053151 Ga0500604_0188270 Ga0500604_0188270_132_536 128
563 3300053156 Ga0500622_0008732 Ga0500622_0008732_1027_1413 128
564 3300053158 Ga0500627_0000032 Ga0500627_0000032_79096_79482 128
565 3300053158 Ga0500627_0000590 Ga0500627_0000590_4019_4405 128
566 3300053163 Ga0500639_214460 Ga0500639_214460_77_463 128
567 3300053177 Ga0500636_0032948 Ga0500636_0032948_361_747 128
568 3300053724 Ga0500570_014959 Ga0500570_014959_1238_1624 128
569 3300053730 Ga0500645_073673 Ga0500645_073673_572_958 128
570 3300053730 Ga0500645_077800 Ga0500645_077800_527_913 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

24

61

0.98

PF09278

MerR-DNA-bind

MerR, DNA binding

66

130

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

23

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9432 1 67
6jni-assembly4.cif.gz_G crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.9416 1 128
4wlw-assembly1.cif.gz_A-2 crystal structure of the ag(i) (activator) form of e. coli cuer, a copper efflux regulator, bound to copa promoter dna 0.9227 1 126
4wlw-assembly2.cif.gz_A crystal structure of the ag(i) (activator) form of e. coli cuer, a copper efflux regulator, bound to copa promoter dna 0.9227 1 126
4wlw-assembly2.cif.gz_A-2 crystal structure of the ag(i) (activator) form of e. coli cuer, a copper efflux regulator, bound to copa promoter dna 0.9227 1 126
ID Description Score Start End Superfamily
4wlwA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9207 2 126 1.10.1660.10
4r22B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9127 1 71 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9073 1 67 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9056 1 71 1.10.1660.10
3iaoA01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9015 1 68 1.10.1660.10
ID Description Score Start End GO Terms
AF-M4RKH4-F1-model_v4 Copper-translocating P-type ATPase 0.965 1 127 GO:0003677
GO:0003700
GO:0005507
GO:0005524
GO:0005886
GO:0012505
GO:0016887
GO:0043682
GO:0045893
GO:0055070
AF-A0A8A3KEQ3-F1-model_v4 deleted 0.9644 1 127
AF-A0A2G1MBV0-F1-model_v4 MerR family transcriptional regulator 0.9636 1 91 GO:0003677
GO:0003700
AF-A0A6M1T767-F1-model_v4 MerR family transcriptional regulator 0.9591 1 127 GO:0003677
GO:0003700
AF-A0A0F7PRM9-F1-model_v4 Cu(I)-responsive transcriptional regulator 0.9588 1 128 GO:0003677
GO:0003700
GO:0005507
GO:0005737
GO:0045893

Feature Viewer

pLDDT pTM Quality
91.29 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map