F464829
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 283 | 555 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10068957|Ga0157379_100689574 |
| Length | 153 |
| Sequence | MANCDLEQARVQRFQQWRYRRHMNIGQASDASGVSQRMIRHYEKIGLIPPASRRGSGYRDYALPDVHRLKFIANARDLGFPIEEIRVLLDLWRDRGRSSAEVKALAMARAEELERKAAALEAMRRTLLELAERCQGDDRPDCPILANLAGEAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 6 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 7 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 8 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 9 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 10 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 11 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 12 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 13 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 14 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 15 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 22 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 26 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 27 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 157 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 164 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 165 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 166 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 167 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 170 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 171 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 172 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 173 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 174 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 175 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 176 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 177 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 178 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 179 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 226 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 227 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 228 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 229 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 232 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 247 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 248 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 251 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 256 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 262 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 263 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 264 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 265 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 267 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 268 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 269 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 270 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 271 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 272 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 276 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 277 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 278 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 279 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 281 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 283 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.72 |
| Metatranscriptomes | 0 |
| Isolates | 2.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.74 |
| Nodule | 0 |
| Rhizoplane | 5.09 |
| Rhizosphere | 71.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1222108 | 2162886006 | Bacteria | 2328 |
| 2 | SwRhRL2b_contig_2859919 | 2162886007 | Bacteria | 2224 |
| 3 | JGI24740J21852_10000027 | 3300001979 | Bacteria | 48883 |
| 4 | JGI24740J21852_10004226 | 3300001979 | Bacteria | 6202 |
| 5 | JGI24739J22299_10005808 | 3300001989 | Bacteria | 4674 |
| 6 | JGI24739J22299_10080870 | 3300001989 | Bacteria | 998 |
| 7 | JGI24739J22299_10114684 | 3300001989 | Bacteria | 807 |
| 8 | JGI24737J22298_10004860 | 3300001990 | Bacteria | 4659 |
| 9 | JGI24737J22298_10099372 | 3300001990 | Bacteria | 862 |
| 10 | JGI24735J21928_10006398 | 3300002067 | Bacteria | 3877 |
| 11 | JGI24738J21930_10001851 | 3300002075 | Bacteria | 5727 |
| 12 | JGI24751J29686_10000440 | 3300002459 | Bacteria | 12756 |
| 13 | JGI24751J29686_10000497 | 3300002459 | Bacteria | 11547 |
| 14 | JGI24751J29686_10026212 | 3300002459 | Bacteria | 1209 |
| 15 | JGI25150J39212_1000080 | 3300002774 | Bacteria | 58442 |
| 16 | JGI25151J46595_10094567 | 3300003187 | Bacteria | 822 |
| 17 | JGI25153J46596_10000025 | 3300003215 | Bacteria | 237813 |
| 18 | JGI25153J46596_10027565 | 3300003215 | Bacteria | 1987 |
| 19 | rootL2_10249575 | 3300003322 | Bacteria | 1259 |
| 20 | rootH1_10044141 | 3300003323 | Bacteria | 2223 |
| 21 | Ga0055532_1002166 | 3300003758 | Bacteria | 4366 |
| 22 | Ga0055537_1002285 | 3300003773 | Bacteria | 6579 |
| 23 | Ga0055524_1000165 | 3300003775 | Bacteria | 75996 |
| 24 | Ga0055531_10016648 | 3300003794 | Bacteria | 3157 |
| 25 | Ga0055543_1022956 | 3300004625 | Bacteria | 1129 |
| 26 | Ga0065165_1008357 | 3300005262 | Bacteria | 4862 |
| 27 | Ga0065704_10082602 | 3300005289 | Bacteria | 3577 |
| 28 | Ga0065707_10081738 | 3300005295 | Bacteria | 54410 |
| 29 | Ga0070658_10000732 | 3300005327 | Bacteria | 28217 |
| 30 | Ga0070658_10168660 | 3300005327 | Bacteria | 1839 |
| 31 | Ga0070670_100000919 | 3300005331 | Bacteria | 23130 |
| 32 | Ga0070670_100007788 | 3300005331 | Bacteria | 9116 |
| 33 | Ga0070670_100020112 | 3300005331 | Bacteria | 5734 |
| 34 | Ga0070670_100034334 | 3300005331 | Bacteria | 4364 |
| 35 | Ga0070670_100536236 | 3300005331 | Bacteria | 1043 |
| 36 | Ga0070666_10001752 | 3300005335 | Bacteria | 13244 |
| 37 | Ga0070666_10005173 | 3300005335 | Bacteria | 7988 |
| 38 | Ga0070666_10016835 | 3300005335 | Bacteria | 4681 |
| 39 | Ga0070666_10159037 | 3300005335 | Bacteria | 1578 |
| 40 | Ga0070682_101863428 | 3300005337 | Bacteria | 526 |
| 41 | Ga0070660_100010454 | 3300005339 | Bacteria | 6560 |
| 42 | Ga0070660_100032776 | 3300005339 | Bacteria | 3912 |
| 43 | Ga0070660_100112435 | 3300005339 | Bacteria | 2168 |
| 44 | Ga0070661_100008597 | 3300005344 | Bacteria | 7060 |
| 45 | Ga0070668_100000005 | 3300005347 | Bacteria | 187511 |
| 46 | Ga0070668_100000842 | 3300005347 | Bacteria | 21233 |
| 47 | Ga0070668_100024742 | 3300005347 | Bacteria | 4551 |
| 48 | Ga0070668_100224755 | 3300005347 | Bacteria | 1550 |
| 49 | Ga0070668_100456974 | 3300005347 | Bacteria | 1099 |
| 50 | Ga0070669_100000023 | 3300005353 | Bacteria | 174496 |
| 51 | Ga0070669_100058704 | 3300005353 | Bacteria | 2824 |
| 52 | Ga0070669_100123275 | 3300005353 | Bacteria | 1980 |
| 53 | Ga0070675_101019311 | 3300005354 | Bacteria | 760 |
| 54 | Ga0070671_100000017 | 3300005355 | Bacteria | 154265 |
| 55 | Ga0070671_100000027 | 3300005355 | Bacteria | 114189 |
| 56 | Ga0070671_100005382 | 3300005355 | Bacteria | 10205 |
| 57 | Ga0070671_100016967 | 3300005355 | Bacteria | 5888 |
| 58 | Ga0070671_100457148 | 3300005355 | Bacteria | 1096 |
| 59 | Ga0070667_100000004 | 3300005367 | Bacteria | 444091 |
| 60 | Ga0070667_100000926 | 3300005367 | Bacteria | 27083 |
| 61 | Ga0070667_100001278 | 3300005367 | Bacteria | 22765 |
| 62 | Ga0070667_100001638 | 3300005367 | Bacteria | 20032 |
| 63 | Ga0070667_100002555 | 3300005367 | Bacteria | 15820 |
| 64 | Ga0070667_100242226 | 3300005367 | Bacteria | 1610 |
| 65 | Ga0070667_100601053 | 3300005367 | Bacteria | 1013 |
| 66 | Ga0070663_100163758 | 3300005455 | Bacteria | 1714 |
| 67 | Ga0070663_100189159 | 3300005455 | Bacteria | 1601 |
| 68 | Ga0070662_100406366 | 3300005457 | Bacteria | 1124 |
| 69 | Ga0070662_100783497 | 3300005457 | Bacteria | 810 |
| 70 | Ga0070684_100735986 | 3300005535 | Bacteria | 920 |
| 71 | Ga0068853_100014246 | 3300005539 | Bacteria | 6508 |
| 72 | Ga0068853_100075906 | 3300005539 | Bacteria | 2934 |
| 73 | Ga0068853_100732192 | 3300005539 | Bacteria | 944 |
| 74 | Ga0068853_101115036 | 3300005539 | Bacteria | 761 |
| 75 | Ga0070672_100106769 | 3300005543 | Bacteria | 2278 |
| 76 | Ga0070686_100086503 | 3300005544 | Bacteria | 2087 |
| 77 | Ga0070665_100007103 | 3300005548 | Bacteria | 11380 |
| 78 | Ga0070665_100015137 | 3300005548 | Bacteria | 7743 |
| 79 | Ga0070665_100220945 | 3300005548 | Bacteria | 1895 |
| 80 | Ga0070665_100820977 | 3300005548 | Bacteria | 943 |
| 81 | Ga0070665_101280644 | 3300005548 | Bacteria | 743 |
| 82 | Ga0070664_100635822 | 3300005564 | Bacteria | 991 |
| 83 | Ga0070664_100663763 | 3300005564 | Bacteria | 969 |
| 84 | Ga0068857_100023653 | 3300005577 | Bacteria | 5409 |
| 85 | Ga0068857_100683751 | 3300005577 | Bacteria | 974 |
| 86 | Ga0068857_101419221 | 3300005577 | Bacteria | 676 |
| 87 | Ga0068857_101837345 | 3300005577 | Bacteria | 593 |
| 88 | Ga0068854_100214323 | 3300005578 | Bacteria | 1520 |
| 89 | Ga0068854_100572012 | 3300005578 | Bacteria | 961 |
| 90 | Ga0068854_100672334 | 3300005578 | Bacteria | 891 |
| 91 | Ga0068856_100037453 | 3300005614 | Bacteria | 4759 |
| 92 | Ga0068856_100060150 | 3300005614 | Bacteria | 3753 |
| 93 | Ga0068852_100002290 | 3300005616 | Bacteria | 13168 |
| 94 | Ga0068852_100025970 | 3300005616 | Bacteria | 4753 |
| 95 | Ga0068852_100116816 | 3300005616 | Bacteria | 2435 |
| 96 | Ga0068852_100222309 | 3300005616 | Bacteria | 1796 |
| 97 | Ga0068852_101634295 | 3300005616 | Bacteria | 667 |
| 98 | Ga0068859_100000222 | 3300005617 | Bacteria | 56119 |
| 99 | Ga0068859_100005182 | 3300005617 | Bacteria | 13238 |
| 100 | Ga0068859_100039462 | 3300005617 | Bacteria | 4736 |
| 101 | Ga0068859_100051134 | 3300005617 | Bacteria | 4152 |
| 102 | Ga0068859_100111996 | 3300005617 | Bacteria | 2792 |
| 103 | Ga0068859_100112139 | 3300005617 | Bacteria | 2790 |
| 104 | Ga0068864_100004787 | 3300005618 | Bacteria | 11091 |
| 105 | Ga0068864_100013251 | 3300005618 | Bacteria | 6829 |
| 106 | Ga0068861_100012534 | 3300005719 | Bacteria | 5915 |
| 107 | Ga0068851_10016266 | 3300005834 | Bacteria | 3557 |
| 108 | Ga0068851_10031427 | 3300005834 | Bacteria | 2637 |
| 109 | Ga0068863_100000169 | 3300005841 | Bacteria | 70831 |
| 110 | Ga0068863_100000180 | 3300005841 | Bacteria | 67219 |
| 111 | Ga0068863_100003732 | 3300005841 | Bacteria | 15062 |
| 112 | Ga0068863_100020948 | 3300005841 | Bacteria | 6244 |
| 113 | Ga0068863_100074852 | 3300005841 | Bacteria | 3204 |
| 114 | Ga0068863_100105718 | 3300005841 | Bacteria | 2678 |
| 115 | Ga0068863_100326954 | 3300005841 | Bacteria | 1490 |
| 116 | Ga0068858_100005317 | 3300005842 | Bacteria | 12622 |
| 117 | Ga0068858_100007319 | 3300005842 | Bacteria | 10688 |
| 118 | Ga0068858_100021538 | 3300005842 | Bacteria | 6024 |
| 119 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 120 | Ga0068860_100000076 | 3300005843 | Bacteria | 171786 |
| 121 | Ga0068860_100002340 | 3300005843 | Bacteria | 19901 |
| 122 | Ga0068860_100003659 | 3300005843 | Bacteria | 15822 |
| 123 | Ga0068860_100010828 | 3300005843 | Bacteria | 9001 |
| 124 | Ga0068860_100013735 | 3300005843 | Bacteria | 7941 |
| 125 | Ga0068860_100289225 | 3300005843 | Bacteria | 1603 |
| 126 | Ga0068860_100509856 | 3300005843 | Bacteria | 1202 |
| 127 | Ga0068862_100003522 | 3300005844 | Bacteria | 13428 |
| 128 | Ga0068862_100004848 | 3300005844 | Bacteria | 11333 |
| 129 | Ga0075368_10000004 | 3300006042 | Bacteria | 56092 |
| 130 | Ga0075363_100000007 | 3300006048 | Bacteria | 46308 |
| 131 | Ga0075364_10000003 | 3300006051 | Bacteria | 111353 |
| 132 | Ga0075362_10000675 | 3300006177 | Bacteria | 10079 |
| 133 | Ga0075367_10000036 | 3300006178 | Bacteria | 29484 |
| 134 | Ga0075367_10344496 | 3300006178 | Bacteria | 940 |
| 135 | Ga0075369_10001160 | 3300006186 | Bacteria | 8905 |
| 136 | Ga0075366_10002940 | 3300006195 | Bacteria | 8862 |
| 137 | Ga0075366_10126594 | 3300006195 | Bacteria | 1541 |
| 138 | Ga0075366_10377669 | 3300006195 | Bacteria | 871 |
| 139 | Ga0075370_10000001 | 3300006353 | Bacteria | 239876 |
| 140 | Ga0075370_10000092 | 3300006353 | Bacteria | 27792 |
| 141 | Ga0097620_100000222 | 3300006931 | Bacteria | 56119 |
| 142 | Ga0097620_100005182 | 3300006931 | Bacteria | 13238 |
| 143 | Ga0097620_100039463 | 3300006931 | Bacteria | 4736 |
| 144 | Ga0097620_100051139 | 3300006931 | Bacteria | 4152 |
| 145 | Ga0097620_100111997 | 3300006931 | Bacteria | 2792 |
| 146 | Ga0097620_100112137 | 3300006931 | Bacteria | 2790 |
| 147 | Ga0105251_10000071 | 3300009011 | Bacteria | 97636 |
| 148 | Ga0105240_11223108 | 3300009093 | Bacteria | 795 |
| 149 | Ga0105245_10009117 | 3300009098 | Bacteria | 8651 |
| 150 | Ga0105247_10002563 | 3300009101 | Bacteria | 12321 |
| 151 | Ga0105247_10221912 | 3300009101 | Bacteria | 1280 |
| 152 | Ga0105243_10118450 | 3300009148 | Bacteria | 2228 |
| 153 | Ga0105243_10353511 | 3300009148 | Bacteria | 1350 |
| 154 | Ga0105241_10087920 | 3300009174 | Bacteria | 2446 |
| 155 | Ga0105241_11340310 | 3300009174 | Bacteria | 683 |
| 156 | Ga0105242_10391373 | 3300009176 | Bacteria | 1295 |
| 157 | Ga0105248_10000215 | 3300009177 | Bacteria | 66694 |
| 158 | Ga0105248_10001699 | 3300009177 | Bacteria | 24508 |
| 159 | Ga0105248_10042744 | 3300009177 | Bacteria | 5082 |
| 160 | Ga0105248_10518421 | 3300009177 | Bacteria | 1344 |
| 161 | Ga0105248_10619197 | 3300009177 | Bacteria | 1221 |
| 162 | Ga0105248_11337382 | 3300009177 | Bacteria | 810 |
| 163 | Ga0105237_10013174 | 3300009545 | Bacteria | 8676 |
| 164 | Ga0105237_10740706 | 3300009545 | Bacteria | 989 |
| 165 | Ga0105238_10011466 | 3300009551 | Bacteria | 8926 |
| 166 | Ga0105238_10073130 | 3300009551 | Bacteria | 3423 |
| 167 | Ga0105249_10000037 | 3300009553 | Bacteria | 197428 |
| 168 | Ga0105249_10003751 | 3300009553 | Bacteria | 13116 |
| 169 | Ga0105249_10043616 | 3300009553 | Bacteria | 4078 |
| 170 | Ga0105249_10096738 | 3300009553 | Bacteria | 2771 |
| 171 | Ga0105249_10265716 | 3300009553 | Bacteria | 1707 |
| 172 | Ga0105249_10691019 | 3300009553 | Bacteria | 1080 |
| 173 | Ga0105239_10091863 | 3300010375 | Bacteria | 3350 |
| 174 | Ga0105246_10549576 | 3300011119 | Bacteria | 989 |
| 175 | Ga0157326_1003355 | 3300012513 | Bacteria | 1685 |
| 176 | Ga0157326_1054590 | 3300012513 | Bacteria | 596 |
| 177 | Ga0157373_10163390 | 3300013100 | Bacteria | 1567 |
| 178 | Ga0157373_10330442 | 3300013100 | Bacteria | 1085 |
| 179 | Ga0157371_10125316 | 3300013102 | Bacteria | 1827 |
| 180 | Ga0157370_10028542 | 3300013104 | Bacteria | 5487 |
| 181 | Ga0157370_10255508 | 3300013104 | Bacteria | 1620 |
| 182 | Ga0157374_10208625 | 3300013296 | Bacteria | 1915 |
| 183 | Ga0157378_10010139 | 3300013297 | Bacteria | 8217 |
| 184 | Ga0157372_10360404 | 3300013307 | Bacteria | 1694 |
| 185 | Ga0157375_10392127 | 3300013308 | Bacteria | 1555 |
| 186 | Ga0163163_10058436 | 3300014325 | Bacteria | 3813 |
| 187 | Ga0157380_10000338 | 3300014326 | Bacteria | 27963 |
| 188 | Ga0157380_10396282 | 3300014326 | Bacteria | 1308 |
| 189 | Ga0157380_10408303 | 3300014326 | Bacteria | 1291 |
| 190 | Ga0157380_12049952 | 3300014326 | Bacteria | 634 |
| 191 | Ga0157379_10068957 | 3300014968 | Bacteria | 3162 |
| 192 | Ga0157379_10163282 | 3300014968 | Bacteria | 2010 |
| 193 | Ga0163161_10046923 | 3300017792 | Bacteria | 3118 |
| 194 | Ga0163161_10164283 | 3300017792 | Bacteria | 1694 |
| 195 | Ga0163161_10405967 | 3300017792 | Bacteria | 1093 |
| 196 | Ga0209147_100193 | 3300025229 | Bacteria | 69946 |
| 197 | Ga0207425_1000027 | 3300025245 | Bacteria | 299995 |
| 198 | Ga0209129_1001145 | 3300025258 | Bacteria | 15345 |
| 199 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 200 | Ga0209565_1002221 | 3300025263 | Bacteria | 7252 |
| 201 | Ga0209455_1011052 | 3300025272 | Bacteria | 2247 |
| 202 | Ga0209673_1001760 | 3300025273 | Bacteria | 18033 |
| 203 | Ga0209675_1055659 | 3300025291 | Bacteria | 799 |
| 204 | Ga0209676_1004998 | 3300025292 | Bacteria | 7103 |
| 205 | Ga0209676_1020009 | 3300025292 | Bacteria | 2287 |
| 206 | Ga0209025_1002001 | 3300025294 | Bacteria | 23331 |
| 207 | Ga0209564_1075041 | 3300025295 | Bacteria | 685 |
| 208 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 209 | Ga0209758_1014811 | 3300025297 | Bacteria | 4107 |
| 210 | Ga0209758_1019936 | 3300025297 | Bacteria | 3203 |
| 211 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 212 | Ga0209050_1000306 | 3300025298 | Bacteria | 100510 |
| 213 | Ga0209050_1006913 | 3300025298 | Bacteria | 6559 |
| 214 | Ga0209050_1013810 | 3300025298 | Bacteria | 3548 |
| 215 | Ga0209050_1036282 | 3300025298 | Bacteria | 1442 |
| 216 | Ga0209050_1058224 | 3300025298 | Bacteria | 929 |
| 217 | Ga0209050_1086656 | 3300025298 | Bacteria | 652 |
| 218 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 219 | Ga0209051_1000525 | 3300025303 | Bacteria | 47573 |
| 220 | Ga0209257_1004962 | 3300025304 | Bacteria | 9753 |
| 221 | Ga0209257_1004986 | 3300025304 | Bacteria | 9703 |
| 222 | Ga0209257_1006030 | 3300025304 | Bacteria | 8096 |
| 223 | Ga0207697_10001759 | 3300025315 | Bacteria | 11632 |
| 224 | Ga0207656_10028345 | 3300025321 | Bacteria | 2298 |
| 225 | Ga0207656_10075570 | 3300025321 | Bacteria | 1505 |
| 226 | Ga0207713_1001241 | 3300025735 | Bacteria | 21135 |
| 227 | Ga0207710_10001753 | 3300025900 | Bacteria | 10468 |
| 228 | Ga0207710_10027488 | 3300025900 | Bacteria | 2464 |
| 229 | Ga0207680_10000030 | 3300025903 | Bacteria | 78257 |
| 230 | Ga0207680_10006852 | 3300025903 | Bacteria | 5530 |
| 231 | Ga0207680_10011474 | 3300025903 | Bacteria | 4479 |
| 232 | Ga0207680_10291364 | 3300025903 | Bacteria | 1136 |
| 233 | Ga0207647_10000037 | 3300025904 | Bacteria | 97521 |
| 234 | Ga0207647_10000283 | 3300025904 | Bacteria | 41512 |
| 235 | Ga0207647_10007862 | 3300025904 | Bacteria | 7671 |
| 236 | Ga0207705_10000318 | 3300025909 | Bacteria | 43984 |
| 237 | Ga0207705_10083002 | 3300025909 | Bacteria | 2337 |
| 238 | Ga0207705_10866818 | 3300025909 | Bacteria | 700 |
| 239 | Ga0207654_10011219 | 3300025911 | Bacteria | 4567 |
| 240 | Ga0207654_10718201 | 3300025911 | Bacteria | 718 |
| 241 | Ga0207671_10003187 | 3300025914 | Bacteria | 16539 |
| 242 | Ga0207671_11441810 | 3300025914 | Bacteria | 533 |
| 243 | Ga0207657_10006137 | 3300025919 | Bacteria | 12490 |
| 244 | Ga0207657_10018007 | 3300025919 | Bacteria | 6759 |
| 245 | Ga0207657_10043386 | 3300025919 | Bacteria | 3962 |
| 246 | Ga0207649_10032910 | 3300025920 | Bacteria | 3093 |
| 247 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 248 | Ga0207681_10050306 | 3300025923 | Bacteria | 2819 |
| 249 | Ga0207681_10178284 | 3300025923 | Bacteria | 1616 |
| 250 | Ga0207694_10074360 | 3300025924 | Bacteria | 2660 |
| 251 | Ga0207650_10004287 | 3300025925 | Bacteria | 9735 |
| 252 | Ga0207650_10044802 | 3300025925 | Bacteria | 3252 |
| 253 | Ga0207650_10048381 | 3300025925 | Bacteria | 3136 |
| 254 | Ga0207650_10114020 | 3300025925 | Bacteria | 2096 |
| 255 | Ga0207687_10022221 | 3300025927 | Bacteria | 4219 |
| 256 | Ga0207644_10000024 | 3300025931 | Bacteria | 154283 |
| 257 | Ga0207644_10005374 | 3300025931 | Bacteria | 8351 |
| 258 | Ga0207644_10143367 | 3300025931 | Bacteria | 1842 |
| 259 | Ga0207690_10038914 | 3300025932 | Bacteria | 3099 |
| 260 | Ga0207706_10003179 | 3300025933 | Bacteria | 15784 |
| 261 | Ga0207706_10458062 | 3300025933 | Bacteria | 1103 |
| 262 | Ga0207706_10541448 | 3300025933 | Bacteria | 1003 |
| 263 | Ga0207686_10764736 | 3300025934 | Bacteria | 772 |
| 264 | Ga0207670_10866149 | 3300025936 | Bacteria | 755 |
| 265 | Ga0207704_11319133 | 3300025938 | Bacteria | 617 |
| 266 | Ga0207711_10005829 | 3300025941 | Bacteria | 10407 |
| 267 | Ga0207711_10029671 | 3300025941 | Bacteria | 4614 |
| 268 | Ga0207711_10080001 | 3300025941 | Bacteria | 2854 |
| 269 | Ga0207711_10537824 | 3300025941 | Bacteria | 1090 |
| 270 | Ga0207711_11333390 | 3300025941 | Bacteria | 660 |
| 271 | Ga0207679_10933838 | 3300025945 | Bacteria | 794 |
| 272 | Ga0207667_10005214 | 3300025949 | Bacteria | 15859 |
| 273 | Ga0207667_10758276 | 3300025949 | Bacteria | 969 |
| 274 | Ga0207712_10000035 | 3300025961 | Bacteria | 201152 |
| 275 | Ga0207712_10002076 | 3300025961 | Bacteria | 13145 |
| 276 | Ga0207712_10089181 | 3300025961 | Bacteria | 2267 |
| 277 | Ga0207712_10344285 | 3300025961 | Bacteria | 1237 |
| 278 | Ga0207712_10741785 | 3300025961 | Bacteria | 860 |
| 279 | Ga0207668_10000024 | 3300025972 | Bacteria | 131871 |
| 280 | Ga0207668_10000265 | 3300025972 | Bacteria | 34885 |
| 281 | Ga0207668_10006763 | 3300025972 | Bacteria | 6786 |
| 282 | Ga0207668_10487586 | 3300025972 | Bacteria | 1058 |
| 283 | Ga0207668_10644976 | 3300025972 | Bacteria | 926 |
| 284 | Ga0207640_10124675 | 3300025981 | Bacteria | 1852 |
| 285 | Ga0207640_10326145 | 3300025981 | Bacteria | 1224 |
| 286 | Ga0207640_10465590 | 3300025981 | Bacteria | 1045 |
| 287 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 288 | Ga0207658_10000805 | 3300025986 | Bacteria | 26389 |
| 289 | Ga0207658_10001260 | 3300025986 | Bacteria | 20047 |
| 290 | Ga0207658_10001681 | 3300025986 | Bacteria | 16813 |
| 291 | Ga0207658_10002307 | 3300025986 | Bacteria | 14075 |
| 292 | Ga0207658_10005226 | 3300025986 | Bacteria | 8929 |
| 293 | Ga0207658_10104779 | 3300025986 | Bacteria | 2223 |
| 294 | Ga0207703_10001071 | 3300026035 | Bacteria | 26081 |
| 295 | Ga0207703_10005709 | 3300026035 | Bacteria | 9983 |
| 296 | Ga0207703_10030236 | 3300026035 | Bacteria | 4279 |
| 297 | Ga0207639_10020538 | 3300026041 | Bacteria | 4728 |
| 298 | Ga0207639_10030857 | 3300026041 | Bacteria | 3934 |
| 299 | Ga0207639_12019499 | 3300026041 | Bacteria | 538 |
| 300 | Ga0207678_10428357 | 3300026067 | Bacteria | 1148 |
| 301 | Ga0207678_10680341 | 3300026067 | Bacteria | 905 |
| 302 | Ga0207702_10056612 | 3300026078 | Bacteria | 3329 |
| 303 | Ga0207702_10152972 | 3300026078 | Bacteria | 2100 |
| 304 | Ga0207702_10220120 | 3300026078 | Bacteria | 1769 |
| 305 | Ga0207641_10000181 | 3300026088 | Bacteria | 87655 |
| 306 | Ga0207641_10000993 | 3300026088 | Bacteria | 29007 |
| 307 | Ga0207641_10001724 | 3300026088 | Bacteria | 21127 |
| 308 | Ga0207641_10010233 | 3300026088 | Bacteria | 7713 |
| 309 | Ga0207641_10028187 | 3300026088 | Bacteria | 4639 |
| 310 | Ga0207641_10144018 | 3300026088 | Bacteria | 2153 |
| 311 | Ga0207641_10391737 | 3300026088 | Bacteria | 1332 |
| 312 | Ga0207641_10593907 | 3300026088 | Bacteria | 1083 |
| 313 | Ga0207641_11293094 | 3300026088 | Bacteria | 730 |
| 314 | Ga0207676_10000041 | 3300026095 | Bacteria | 166172 |
| 315 | Ga0207676_10001253 | 3300026095 | Bacteria | 18906 |
| 316 | Ga0207676_11451931 | 3300026095 | Bacteria | 682 |
| 317 | Ga0207674_10005947 | 3300026116 | Bacteria | 14434 |
| 318 | Ga0207674_10066940 | 3300026116 | Bacteria | 3617 |
| 319 | Ga0207674_10263918 | 3300026116 | Bacteria | 1669 |
| 320 | Ga0207674_10313693 | 3300026116 | Bacteria | 1517 |
| 321 | Ga0207674_10588448 | 3300026116 | Bacteria | 1075 |
| 322 | Ga0207675_100046282 | 3300026118 | Bacteria | 4064 |
| 323 | Ga0207698_10000638 | 3300026142 | Bacteria | 20256 |
| 324 | Ga0207698_10001101 | 3300026142 | Bacteria | 15747 |
| 325 | Ga0207698_10172845 | 3300026142 | Bacteria | 1904 |
| 326 | Ga0207698_10189980 | 3300026142 | Bacteria | 1828 |
| 327 | Ga0209813_10000022 | 3300027866 | Bacteria | 72813 |
| 328 | Ga0268266_10012843 | 3300028379 | Bacteria | 7231 |
| 329 | Ga0268266_10046959 | 3300028379 | Bacteria | 3697 |
| 330 | Ga0268266_10567665 | 3300028379 | Bacteria | 1088 |
| 331 | Ga0268266_11020659 | 3300028379 | Bacteria | 800 |
| 332 | Ga0268266_12180433 | 3300028379 | Bacteria | 526 |
| 333 | Ga0268265_10000046 | 3300028380 | Bacteria | 179361 |
| 334 | Ga0268265_10000204 | 3300028380 | Bacteria | 68890 |
| 335 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 336 | Ga0268264_10000069 | 3300028381 | Bacteria | 270492 |
| 337 | Ga0268264_10000139 | 3300028381 | Bacteria | 171848 |
| 338 | Ga0268264_10000229 | 3300028381 | Bacteria | 108305 |
| 339 | Ga0268264_10013044 | 3300028381 | Bacteria | 6830 |
| 340 | Ga0268264_10013240 | 3300028381 | Bacteria | 6789 |
| 341 | Ga0268264_10013491 | 3300028381 | Bacteria | 6728 |
| 342 | Ga0268264_10503592 | 3300028381 | Bacteria | 1181 |
| 343 | Ga0314311_1012828 | 3300030733 | Bacteria | 1425 |
| 344 | Ga0307508_10001675 | 3300031616 | Bacteria | 24607 |
| 345 | Ga0307405_10210133 | 3300031731 | Bacteria | 1420 |
| 346 | Ga0307405_11407951 | 3300031731 | Bacteria | 610 |
| 347 | Ga0307406_10323422 | 3300031901 | Bacteria | 1194 |
| 348 | Ga0307412_10003252 | 3300031911 | Bacteria | 9027 |
| 349 | Ga0307412_10008319 | 3300031911 | Bacteria | 5914 |
| 350 | Ga0307412_10225497 | 3300031911 | Bacteria | 1439 |
| 351 | Ga0395905_0125855 | 3300037471 | Bacteria | 2410 |
| 352 | Ga0395905_1361185 | 3300037471 | Bacteria | 614 |
| 353 | Ga0395901_0056767 | 3300038443 | Bacteria | 4073 |
| 354 | Ga0439447_140857 | 3300041407 | Bacteria | 554 |
| 355 | Ga0439461_0002112 | 3300041410 | Bacteria | 3144 |
| 356 | Ga0439466_0269951 | 3300041411 | Bacteria | 515 |
| 357 | Ga0439465_0002362 | 3300041413 | Bacteria | 6189 |
| 358 | Ga0451793_0723615 | 3300041452 | Bacteria | 652 |
| 359 | Ga0451795_1280467 | 3300041456 | Bacteria | 659 |
| 360 | Ga0439431_0063772 | 3300041997 | Bacteria | 973 |
| 361 | Ga0439448_0006413 | 3300042005 | Bacteria | 3383 |
| 362 | Ga0439432_199668 | 3300042006 | Bacteria | 580 |
| 363 | Ga0439455_0014055 | 3300042012 | Bacteria | 1823 |
| 364 | Ga0439462_0000203 | 3300042015 | Bacteria | 10309 |
| 365 | Ga0450894_004385 | 3300042131 | Bacteria | 1833 |
| 366 | Ga0439446_0013589 | 3300042156 | Bacteria | 2236 |
| 367 | Ga0439458_0007872 | 3300042157 | Bacteria | 2370 |
| 368 | Ga0439434_0001327 | 3300042435 | Bacteria | 7133 |
| 369 | Ga0439434_0103531 | 3300042435 | Bacteria | 918 |
| 370 | Ga0450918_024190 | 3300042531 | Bacteria | 1063 |
| 371 | Ga0466973_0061162 | 3300044659 | Bacteria | 3410 |
| 372 | Ga0453684_0954163 | 3300044712 | Bacteria | 915 |
| 373 | Ga0495617_066636 | 3300046452 | Bacteria | 1186 |
| 374 | Ga0495627_014898 | 3300046453 | Bacteria | 2698 |
| 375 | Ga0495638_0000073 | 3300046460 | Bacteria | 164378 |
| 376 | Ga0495638_0028804 | 3300046460 | Bacteria | 3584 |
| 377 | Ga0495585_0007258 | 3300046492 | Bacteria | 6804 |
| 378 | Ga0495585_0345527 | 3300046492 | Bacteria | 724 |
| 379 | Ga0495583_0000087 | 3300046506 | Bacteria | 164974 |
| 380 | Ga0495583_0004679 | 3300046506 | Bacteria | 9646 |
| 381 | Ga0495583_0255552 | 3300046506 | Bacteria | 702 |
| 382 | Ga0495606_0122798 | 3300046507 | Bacteria | 1552 |
| 383 | Ga0495631_0011282 | 3300046518 | Bacteria | 4399 |
| 384 | Ga0495631_0065744 | 3300046518 | Bacteria | 1569 |
| 385 | Ga0495632_0000270 | 3300046519 | Bacteria | 51498 |
| 386 | Ga0495643_0000073 | 3300046522 | Bacteria | 168344 |
| 387 | Ga0495643_0000821 | 3300046522 | Bacteria | 33905 |
| 388 | Ga0495643_0142485 | 3300046522 | Bacteria | 1194 |
| 389 | Ga0495648_0000049 | 3300046524 | Bacteria | 164366 |
| 390 | Ga0495648_0001291 | 3300046524 | Bacteria | 24914 |
| 391 | Ga0495648_0042003 | 3300046524 | Bacteria | 2881 |
| 392 | Ga0495663_0000384 | 3300046525 | Bacteria | 16337 |
| 393 | Ga0495654_0018975 | 3300046530 | Bacteria | 3599 |
| 394 | Ga0495597_0012950 | 3300046542 | Bacteria | 4005 |
| 395 | Ga0495633_0000835 | 3300046558 | Bacteria | 27176 |
| 396 | Ga0495633_0014074 | 3300046558 | Bacteria | 4195 |
| 397 | Ga0495668_0173952 | 3300046616 | Bacteria | 1180 |
| 398 | Ga0495668_0193130 | 3300046616 | Bacteria | 1115 |
| 399 | Ga0495611_0016099 | 3300046648 | Bacteria | 3197 |
| 400 | Ga0495625_0000083 | 3300046660 | Bacteria | 152144 |
| 401 | Ga0495625_0000504 | 3300046660 | Bacteria | 57982 |
| 402 | Ga0495625_0144756 | 3300046660 | Bacteria | 1601 |
| 403 | Ga0495625_0815224 | 3300046660 | Bacteria | 541 |
| 404 | Ga0495661_0218290 | 3300046665 | Bacteria | 989 |
| 405 | Ga0495669_0022887 | 3300046684 | Bacteria | 2716 |
| 406 | Ga0495669_0144968 | 3300046684 | Bacteria | 1122 |
| 407 | Ga0495670_0028995 | 3300046691 | Bacteria | 2745 |
| 408 | Ga0495671_0000042 | 3300046692 | Bacteria | 165201 |
| 409 | Ga0495671_0040060 | 3300046692 | Bacteria | 2364 |
| 410 | Ga0495649_0023890 | 3300046694 | Bacteria | 3413 |
| 411 | Ga0495649_0680018 | 3300046694 | Bacteria | 505 |
| 412 | Ga0495660_0015030 | 3300046810 | Bacteria | 4474 |
| 413 | Ga0495636_0175656 | 3300047318 | Bacteria | 970 |
| 414 | Ga0495636_0199572 | 3300047318 | Bacteria | 913 |
| 415 | Ga0495683_0002424 | 3300047323 | Bacteria | 11275 |
| 416 | Ga0495677_0030320 | 3300047445 | Bacteria | 1968 |
| 417 | Ga0495673_0000111 | 3300047469 | Bacteria | 164974 |
| 418 | Ga0495673_0284347 | 3300047469 | Bacteria | 596 |
| 419 | Ga0495681_0004964 | 3300047470 | Bacteria | 8977 |
| 420 | Ga0495681_0005683 | 3300047470 | Bacteria | 8304 |
| 421 | Ga0495686_0007128 | 3300047472 | Bacteria | 8419 |
| 422 | Ga0496100_0000293 | 3300048903 | Bacteria | 25054 |
| 423 | Ga0496100_0002267 | 3300048903 | Bacteria | 9714 |
| 424 | Ga0496101_0004670 | 3300048904 | Bacteria | 8671 |
| 425 | Ga0496101_0062347 | 3300048904 | Bacteria | 2711 |
| 426 | Ga0496102_0000481 | 3300048905 | Bacteria | 44268 |
| 427 | Ga0496102_0000493 | 3300048905 | Bacteria | 43618 |
| 428 | Ga0496103_0000045 | 3300048906 | Bacteria | 165828 |
| 429 | Ga0496103_0000347 | 3300048906 | Bacteria | 42198 |
| 430 | Ga0496103_0014007 | 3300048906 | Bacteria | 4760 |
| 431 | Ga0496103_0242814 | 3300048906 | Bacteria | 1159 |
| 432 | Ga0496104_0246076 | 3300048907 | Bacteria | 1701 |
| 433 | Ga0496104_0350720 | 3300048907 | Bacteria | 1389 |
| 434 | Ga0496105_0000310 | 3300048908 | Bacteria | 31950 |
| 435 | Ga0496105_0115639 | 3300048908 | Bacteria | 2212 |
| 436 | Ga0496106_0000047 | 3300048909 | Bacteria | 100449 |
| 437 | Ga0496106_0371698 | 3300048909 | Bacteria | 1149 |
| 438 | Ga0496107_0000035 | 3300048910 | Bacteria | 86628 |
| 439 | Ga0496107_0000232 | 3300048910 | Bacteria | 29452 |
| 440 | Ga0496109_0686862 | 3300048912 | Bacteria | 961 |
| 441 | Ga0496109_1453136 | 3300048912 | Bacteria | 621 |
| 442 | Ga0496110_0173460 | 3300048913 | Bacteria | 1957 |
| 443 | Ga0496111_0023748 | 3300048914 | Bacteria | 4307 |
| 444 | Ga0496112_0579223 | 3300048915 | Bacteria | 1055 |
| 445 | Ga0496113_0066049 | 3300048916 | Bacteria | 2739 |
| 446 | Ga0496114_0003057 | 3300048917 | Bacteria | 12816 |
| 447 | Ga0496115_0000136 | 3300048918 | Bacteria | 67646 |
| 448 | Ga0496116_0000193 | 3300048919 | Bacteria | 122203 |
| 449 | Ga0496116_0014335 | 3300048919 | Bacteria | 6335 |
| 450 | Ga0496116_0021771 | 3300048919 | Bacteria | 4824 |
| 451 | Ga0496116_0132219 | 3300048919 | Bacteria | 1420 |
| 452 | Ga0496117_0000046 | 3300048920 | Bacteria | 300879 |
| 453 | Ga0496117_0001149 | 3300048920 | Bacteria | 39861 |
| 454 | Ga0496117_0001656 | 3300048920 | Bacteria | 31249 |
| 455 | Ga0496117_0025898 | 3300048920 | Bacteria | 4599 |
| 456 | Ga0496117_0055953 | 3300048920 | Bacteria | 2752 |
| 457 | Ga0496117_0072272 | 3300048920 | Bacteria | 2307 |
| 458 | Ga0496117_0140715 | 3300048920 | Bacteria | 1445 |
| 459 | Ga0496118_0000036 | 3300048921 | Bacteria | 318213 |
| 460 | Ga0496118_0000156 | 3300048921 | Bacteria | 121630 |
| 461 | Ga0496118_0001071 | 3300048921 | Bacteria | 42731 |
| 462 | Ga0496118_0008681 | 3300048921 | Bacteria | 10445 |
| 463 | Ga0496118_0023716 | 3300048921 | Bacteria | 5318 |
| 464 | Ga0496118_0057954 | 3300048921 | Bacteria | 2899 |
| 465 | Ga0496118_0226697 | 3300048921 | Bacteria | 1082 |
| 466 | Ga0496119_0012384 | 3300048922 | Bacteria | 6934 |
| 467 | Ga0496119_0035790 | 3300048922 | Bacteria | 3248 |
| 468 | Ga0496119_0077142 | 3300048922 | Bacteria | 1931 |
| 469 | Ga0496119_0215251 | 3300048922 | Bacteria | 986 |
| 470 | Ga0496120_0011251 | 3300048923 | Bacteria | 6168 |
| 471 | Ga0496121_0000267 | 3300048924 | Bacteria | 109129 |
| 472 | Ga0496121_0008703 | 3300048924 | Bacteria | 11852 |
| 473 | Ga0496121_0022946 | 3300048924 | Bacteria | 6030 |
| 474 | Ga0496121_0082072 | 3300048924 | Bacteria | 2550 |
| 475 | Ga0496122_0010908 | 3300048925 | Bacteria | 9293 |
| 476 | Ga0496122_0011160 | 3300048925 | Bacteria | 9150 |
| 477 | Ga0496123_0003433 | 3300048926 | Bacteria | 17794 |
| 478 | Ga0496123_0089722 | 3300048926 | Bacteria | 1830 |
| 479 | Ga0496124_0000011 | 3300048927 | Bacteria | 524145 |
| 480 | Ga0496124_0000996 | 3300048927 | Bacteria | 44925 |
| 481 | Ga0496124_0014240 | 3300048927 | Bacteria | 7704 |
| 482 | Ga0496124_0901682 | 3300048927 | Bacteria | 536 |
| 483 | Ga0496125_0000309 | 3300048928 | Bacteria | 96047 |
| 484 | Ga0496125_0004416 | 3300048928 | Bacteria | 16247 |
| 485 | Ga0496125_0299955 | 3300048928 | Bacteria | 985 |
| 486 | Ga0496126_0000771 | 3300048929 | Bacteria | 57837 |
| 487 | Ga0496126_1124125 | 3300048929 | Bacteria | 582 |
| 488 | Ga0495678_025215 | 3300049459 | Bacteria | 2557 |
| 489 | Ga0501298_100371 | 3300049521 | Bacteria | 659 |
| 490 | Ga0501033_0838774 | 3300049570 | Bacteria | 620 |
| 491 | Ga0501034_0163439 | 3300049571 | Bacteria | 2196 |
| 492 | Ga0501034_0193038 | 3300049571 | Bacteria | 1998 |
| 493 | Ga0501034_0305992 | 3300049571 | Bacteria | 1525 |
| 494 | Ga0501036_1014176 | 3300049572 | Bacteria | 679 |
| 495 | Ga0501037_0089386 | 3300049573 | Bacteria | 2229 |
| 496 | Ga0501037_0165509 | 3300049573 | Bacteria | 1575 |
| 497 | Ga0501039_0501514 | 3300049575 | Bacteria | 953 |
| 498 | Ga0501039_0892037 | 3300049575 | Bacteria | 692 |
| 499 | Ga0501043_0009351 | 3300049579 | Bacteria | 7697 |
| 500 | Ga0501043_0481267 | 3300049579 | Bacteria | 929 |
| 501 | Ga0501046_0099070 | 3300049580 | Bacteria | 2238 |
| 502 | Ga0501047_0037604 | 3300049581 | Bacteria | 4680 |
| 503 | Ga0501047_0137025 | 3300049581 | Bacteria | 2328 |
| 504 | Ga0501047_0489583 | 3300049581 | Bacteria | 1057 |
| 505 | Ga0501222_058846 | 3300049662 | Bacteria | 578 |
| 506 | Ga0501257_000070 | 3300049686 | Bacteria | 26460 |
| 507 | Ga0501259_000063 | 3300049688 | Bacteria | 14845 |
| 508 | Ga0501261_000005 | 3300049690 | Bacteria | 80000 |
| 509 | Ga0501245_001714 | 3300049708 | Bacteria | 2868 |
| 510 | Ga0501269_037144 | 3300049766 | Bacteria | 640 |
| 511 | Ga0501282_015249 | 3300049778 | Bacteria | 835 |
| 512 | Ga0501035_0028723 | 3300049822 | Bacteria | 5074 |
| 513 | Ga0501035_0181180 | 3300049822 | Bacteria | 1815 |
| 514 | Ga0501044_0000453 | 3300049823 | Bacteria | 49990 |
| 515 | Ga0501044_0025060 | 3300049823 | Bacteria | 6326 |
| 516 | Ga0501044_0193118 | 3300049823 | Bacteria | 1997 |
| 517 | Ga0501044_0475386 | 3300049823 | Bacteria | 1153 |
| 518 | Ga0501044_0759502 | 3300049823 | Bacteria | 851 |
| 519 | nmdc:mga0k408_126908_c1 | 3300050493 | Bacteria | 1513 |
| 520 | nmdc:mga0k408_304895_c1 | 3300050493 | Bacteria | 950 |
| 521 | nmdc:mga07m45_2_c1 | 3300050496 | Bacteria | 451154 |
| 522 | nmdc:mga09592_163515_c1 | 3300050508 | Bacteria | 1923 |
| 523 | nmdc:mga0sz30_69514_c1 | 3300050516 | Bacteria | 1514 |
| 524 | Ga0495601_0004795 | 3300053077 | Bacteria | 7843 |
| 525 | Ga0495601_0702328 | 3300053077 | Bacteria | 645 |
| 526 | Ga0495619_0061614 | 3300053085 | Bacteria | 2496 |
| 527 | Ga0500643_001365 | 3300053087 | Bacteria | 14159 |
| 528 | Ga0500643_011896 | 3300053087 | Bacteria | 3145 |
| 529 | Ga0500644_0033469 | 3300053088 | Bacteria | 1650 |
| 530 | Ga0500647_0134914 | 3300053091 | Bacteria | 1162 |
| 531 | Ga0500651_0049563 | 3300053093 | Bacteria | 2637 |
| 532 | Ga0500566_0060749 | 3300053094 | Bacteria | 2140 |
| 533 | Ga0500641_0013706 | 3300053096 | Bacteria | 2982 |
| 534 | Ga0500592_000011 | 3300053116 | Bacteria | 73738 |
| 535 | Ga0500595_068728 | 3300053119 | Bacteria | 1054 |
| 536 | Ga0500614_007358 | 3300053123 | Bacteria | 2320 |
| 537 | Ga0500642_0020139 | 3300053130 | Bacteria | 2616 |
| 538 | Ga0500655_000088 | 3300053133 | Bacteria | 24231 |
| 539 | Ga0500658_0001649 | 3300053134 | Bacteria | 8876 |
| 540 | Ga0500658_0016625 | 3300053134 | Bacteria | 2742 |
| 541 | Ga0500559_0115552 | 3300053136 | Bacteria | 1245 |
| 542 | Ga0500568_0020652 | 3300053139 | Bacteria | 2846 |
| 543 | Ga0500577_0111183 | 3300053142 | Bacteria | 1131 |
| 544 | Ga0500590_007719 | 3300053148 | Bacteria | 5338 |
| 545 | Ga0500604_0007243 | 3300053151 | Bacteria | 2940 |
| 546 | Ga0500604_0019219 | 3300053151 | Bacteria | 1911 |
| 547 | Ga0500604_0188270 | 3300053151 | Bacteria | 708 |
| 548 | Ga0500622_0008732 | 3300053156 | Bacteria | 5651 |
| 549 | Ga0500627_0000032 | 3300053158 | Bacteria | 84395 |
| 550 | Ga0500627_0000590 | 3300053158 | Bacteria | 9731 |
| 551 | Ga0500639_214460 | 3300053163 | Bacteria | 811 |
| 552 | Ga0500636_0032948 | 3300053177 | Bacteria | 3068 |
| 553 | Ga0500570_014959 | 3300053724 | Bacteria | 4355 |
| 554 | Ga0500645_073673 | 3300053730 | Bacteria | 978 |
| 555 | Ga0500645_077800 | 3300053730 | Bacteria | 948 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10408303 | Ga0157380_104083033 | 120 |
| 2 | 3300049521 | Ga0501298_100371 | Ga0501298_100371_51_443 | 124 |
| 3 | 3300049662 | Ga0501222_058846 | Ga0501222_058846_27_419 | 124 |
| 4 | 3300049686 | Ga0501257_000070 | Ga0501257_000070_25074_25466 | 124 |
| 5 | 3300049688 | Ga0501259_000063 | Ga0501259_000063_882_1274 | 124 |
| 6 | 3300049690 | Ga0501261_000005 | Ga0501261_000005_38151_38543 | 124 |
| 7 | 3300049708 | Ga0501245_001714 | Ga0501245_001714_2302_2694 | 124 |
| 8 | 3300049778 | Ga0501282_015249 | Ga0501282_015249_56_448 | 124 |
| 9 | iso_pu_bacteria | 2582581305 | 2585264017 | 124 |
| 10 | iso_pu_bacteria | 2643221541 | 2643728654 | 124 |
| 11 | iso_pu_bacteria | 2643221606 | 2644042529 | 124 |
| 12 | iso_pu_bacteria | 2643221622 | 2644125424 | 124 |
| 13 | iso_pu_bacteria | 2643221671 | 2644392108 | 124 |
| 14 | iso_pu_bacteria | 2739367664 | 2739652383 | 124 |
| 15 | iso_pu_bacteria | 2739367865 | 2740030857 | 124 |
| 16 | iso_pu_bacteria | 2751185897 | 2753763209 | 124 |
| 17 | iso_pu_bacteria | 2775507255 | 2778126312 | 124 |
| 18 | iso_pu_bacteria | 2808606401 | 2809064557 | 124 |
| 19 | iso_pu_bacteria | 2808606404 | 2809080532 | 124 |
| 20 | iso_pu_bacteria | 2808606405 | 2809084896 | 124 |
| 21 | iso_pu_bacteria | 2880518877 | 2880523639 | 124 |
| 22 | 3300005335 | Ga0070666_10005173 | Ga0070666_100051733 | 127 |
| 23 | 3300005347 | Ga0070668_100000842 | Ga0070668_10000084213 | 127 |
| 24 | 3300005353 | Ga0070669_100058704 | Ga0070669_1000587042 | 127 |
| 25 | 3300005367 | Ga0070667_100001638 | Ga0070667_10000163811 | 127 |
| 26 | 3300005367 | Ga0070667_100002555 | Ga0070667_10000255512 | 127 |
| 27 | 3300005548 | Ga0070665_101280644 | Ga0070665_1012806441 | 127 |
| 28 | 3300005841 | Ga0068863_100000169 | Ga0068863_1000001694 | 127 |
| 29 | 3300005841 | Ga0068863_100003732 | Ga0068863_1000037322 | 127 |
| 30 | 3300005841 | Ga0068863_100074852 | Ga0068863_1000748525 | 127 |
| 31 | 3300005843 | Ga0068860_100002340 | Ga0068860_10000234012 | 127 |
| 32 | 3300005843 | Ga0068860_100003659 | Ga0068860_1000036595 | 127 |
| 33 | 3300006195 | Ga0075366_10126594 | Ga0075366_101265942 | 127 |
| 34 | 3300013102 | Ga0157371_10125316 | Ga0157371_101253163 | 127 |
| 35 | 3300025903 | Ga0207680_10006852 | Ga0207680_100068524 | 127 |
| 36 | 3300025923 | Ga0207681_10050306 | Ga0207681_100503063 | 127 |
| 37 | 3300025972 | Ga0207668_10000265 | Ga0207668_100002652 | 127 |
| 38 | 3300025986 | Ga0207658_10000805 | Ga0207658_1000080522 | 127 |
| 39 | 3300025986 | Ga0207658_10001260 | Ga0207658_100012603 | 127 |
| 40 | 3300026088 | Ga0207641_10000181 | Ga0207641_100001814 | 127 |
| 41 | 3300026088 | Ga0207641_10010233 | Ga0207641_100102332 | 127 |
| 42 | 3300026088 | Ga0207641_10391737 | Ga0207641_103917372 | 127 |
| 43 | 3300028379 | Ga0268266_12180433 | Ga0268266_121804331 | 127 |
| 44 | 3300028381 | Ga0268264_10000229 | Ga0268264_100002295 | 127 |
| 45 | 3300028381 | Ga0268264_10013240 | Ga0268264_100132402 | 127 |
| 46 | 3300031911 | Ga0307412_10003252 | Ga0307412_100032529 | 127 |
| 47 | 3300041452 | Ga0451793_0723615 | Ga0451793_0723615_212_595 | 127 |
| 48 | 3300046522 | Ga0495643_0000073 | Ga0495643_0000073_49353_49736 | 127 |
| 49 | 3300048929 | Ga0496126_1124125 | Ga0496126_1124125_127_510 | 127 |
| 50 | 3300050493 | nmdc:mga0k408_126908_c1 | nmdc:mga0k408_126908_c1_546_929 | 127 |
| 51 | 3300053077 | Ga0495601_0004795 | Ga0495601_0004795_4014_4397 | 127 |
| 52 | 3300053085 | Ga0495619_0061614 | Ga0495619_0061614_966_1349 | 127 |
| 53 | 3300053136 | Ga0500559_0115552 | Ga0500559_0115552_40_423 | 127 |
| 54 | 2162886006 | SwRhRL3b_contig_1222108 | SwRhRL3b_0784.00001220 | 128 |
| 55 | 2162886007 | SwRhRL2b_contig_2859919 | SwRhRL2b_0034.00006530 | 128 |
| 56 | 3300001979 | JGI24740J21852_10000027 | JGI24740J21852_1000002730 | 128 |
| 57 | 3300001979 | JGI24740J21852_10004226 | JGI24740J21852_100042266 | 128 |
| 58 | 3300001989 | JGI24739J22299_10005808 | JGI24739J22299_100058082 | 128 |
| 59 | 3300001989 | JGI24739J22299_10080870 | JGI24739J22299_100808702 | 128 |
| 60 | 3300001989 | JGI24739J22299_10114684 | JGI24739J22299_101146842 | 128 |
| 61 | 3300001990 | JGI24737J22298_10004860 | JGI24737J22298_100048605 | 128 |
| 62 | 3300001990 | JGI24737J22298_10099372 | JGI24737J22298_100993721 | 128 |
| 63 | 3300002067 | JGI24735J21928_10006398 | JGI24735J21928_100063982 | 128 |
| 64 | 3300002075 | JGI24738J21930_10001851 | JGI24738J21930_100018512 | 128 |
| 65 | 3300002459 | JGI24751J29686_10000440 | JGI24751J29686_1000044014 | 128 |
| 66 | 3300002459 | JGI24751J29686_10000497 | JGI24751J29686_100004976 | 128 |
| 67 | 3300002459 | JGI24751J29686_10026212 | JGI24751J29686_100262122 | 128 |
| 68 | 3300002774 | JGI25150J39212_1000080 | JGI25150J39212_10000802 | 128 |
| 69 | 3300003187 | JGI25151J46595_10094567 | JGI25151J46595_100945671 | 128 |
| 70 | 3300003215 | JGI25153J46596_10000025 | JGI25153J46596_1000002531 | 128 |
| 71 | 3300003215 | JGI25153J46596_10027565 | JGI25153J46596_100275652 | 128 |
| 72 | 3300003322 | rootL2_10249575 | rootL2_102495751 | 128 |
| 73 | 3300003323 | rootH1_10044141 | rootH1_100441412 | 128 |
| 74 | 3300003758 | Ga0055532_1002166 | Ga0055532_10021662 | 128 |
| 75 | 3300003773 | Ga0055537_1002285 | Ga0055537_10022852 | 128 |
| 76 | 3300003775 | Ga0055524_1000165 | Ga0055524_100016561 | 128 |
| 77 | 3300003794 | Ga0055531_10016648 | Ga0055531_100166482 | 128 |
| 78 | 3300004625 | Ga0055543_1022956 | Ga0055543_10229561 | 128 |
| 79 | 3300005262 | Ga0065165_1008357 | Ga0065165_10083576 | 128 |
| 80 | 3300005289 | Ga0065704_10082602 | Ga0065704_100826022 | 128 |
| 81 | 3300005295 | Ga0065707_10081738 | Ga0065707_1008173848 | 128 |
| 82 | 3300005327 | Ga0070658_10000732 | Ga0070658_1000073225 | 128 |
| 83 | 3300005327 | Ga0070658_10168660 | Ga0070658_101686602 | 128 |
| 84 | 3300005331 | Ga0070670_100000919 | Ga0070670_1000009197 | 128 |
| 85 | 3300005331 | Ga0070670_100007788 | Ga0070670_1000077885 | 128 |
| 86 | 3300005331 | Ga0070670_100020112 | Ga0070670_1000201123 | 128 |
| 87 | 3300005331 | Ga0070670_100034334 | Ga0070670_1000343344 | 128 |
| 88 | 3300005331 | Ga0070670_100536236 | Ga0070670_1005362362 | 128 |
| 89 | 3300005335 | Ga0070666_10001752 | Ga0070666_100017528 | 128 |
| 90 | 3300005335 | Ga0070666_10016835 | Ga0070666_100168356 | 128 |
| 91 | 3300005335 | Ga0070666_10159037 | Ga0070666_101590372 | 128 |
| 92 | 3300005337 | Ga0070682_101863428 | Ga0070682_1018634281 | 128 |
| 93 | 3300005339 | Ga0070660_100010454 | Ga0070660_1000104542 | 128 |
| 94 | 3300005339 | Ga0070660_100032776 | Ga0070660_1000327762 | 128 |
| 95 | 3300005339 | Ga0070660_100112435 | Ga0070660_1001124352 | 128 |
| 96 | 3300005344 | Ga0070661_100008597 | Ga0070661_1000085972 | 128 |
| 97 | 3300005347 | Ga0070668_100000005 | Ga0070668_10000000530 | 128 |
| 98 | 3300005347 | Ga0070668_100024742 | Ga0070668_1000247422 | 128 |
| 99 | 3300005347 | Ga0070668_100224755 | Ga0070668_1002247552 | 128 |
| 100 | 3300005347 | Ga0070668_100456974 | Ga0070668_1004569741 | 128 |
| 101 | 3300005353 | Ga0070669_100000023 | Ga0070669_1000000237 | 128 |
| 102 | 3300005353 | Ga0070669_100123275 | Ga0070669_1001232754 | 128 |
| 103 | 3300005354 | Ga0070675_101019311 | Ga0070675_1010193111 | 128 |
| 104 | 3300005355 | Ga0070671_100000017 | Ga0070671_100000017138 | 128 |
| 105 | 3300005355 | Ga0070671_100000027 | Ga0070671_10000002785 | 128 |
| 106 | 3300005355 | Ga0070671_100005382 | Ga0070671_1000053828 | 128 |
| 107 | 3300005355 | Ga0070671_100016967 | Ga0070671_1000169675 | 128 |
| 108 | 3300005355 | Ga0070671_100457148 | Ga0070671_1004571482 | 128 |
| 109 | 3300005367 | Ga0070667_100000004 | Ga0070667_10000000473 | 128 |
| 110 | 3300005367 | Ga0070667_100000926 | Ga0070667_1000009262 | 128 |
| 111 | 3300005367 | Ga0070667_100001278 | Ga0070667_10000127820 | 128 |
| 112 | 3300005367 | Ga0070667_100242226 | Ga0070667_1002422262 | 128 |
| 113 | 3300005367 | Ga0070667_100601053 | Ga0070667_1006010532 | 128 |
| 114 | 3300005455 | Ga0070663_100163758 | Ga0070663_1001637581 | 128 |
| 115 | 3300005455 | Ga0070663_100189159 | Ga0070663_1001891592 | 128 |
| 116 | 3300005457 | Ga0070662_100406366 | Ga0070662_1004063662 | 128 |
| 117 | 3300005457 | Ga0070662_100783497 | Ga0070662_1007834972 | 128 |
| 118 | 3300005535 | Ga0070684_100735986 | Ga0070684_1007359862 | 128 |
| 119 | 3300005539 | Ga0068853_100014246 | Ga0068853_1000142464 | 128 |
| 120 | 3300005539 | Ga0068853_100075906 | Ga0068853_1000759066 | 128 |
| 121 | 3300005539 | Ga0068853_100732192 | Ga0068853_1007321921 | 128 |
| 122 | 3300005539 | Ga0068853_101115036 | Ga0068853_1011150361 | 128 |
| 123 | 3300005543 | Ga0070672_100106769 | Ga0070672_1001067692 | 128 |
| 124 | 3300005544 | Ga0070686_100086503 | Ga0070686_1000865031 | 128 |
| 125 | 3300005548 | Ga0070665_100007103 | Ga0070665_1000071037 | 128 |
| 126 | 3300005548 | Ga0070665_100015137 | Ga0070665_1000151372 | 128 |
| 127 | 3300005548 | Ga0070665_100220945 | Ga0070665_1002209452 | 128 |
| 128 | 3300005548 | Ga0070665_100820977 | Ga0070665_1008209772 | 128 |
| 129 | 3300005564 | Ga0070664_100635822 | Ga0070664_1006358222 | 128 |
| 130 | 3300005564 | Ga0070664_100663763 | Ga0070664_1006637632 | 128 |
| 131 | 3300005577 | Ga0068857_100023653 | Ga0068857_1000236532 | 128 |
| 132 | 3300005577 | Ga0068857_100683751 | Ga0068857_1006837512 | 128 |
| 133 | 3300005577 | Ga0068857_101419221 | Ga0068857_1014192211 | 128 |
| 134 | 3300005577 | Ga0068857_101837345 | Ga0068857_1018373452 | 128 |
| 135 | 3300005578 | Ga0068854_100214323 | Ga0068854_1002143232 | 128 |
| 136 | 3300005578 | Ga0068854_100572012 | Ga0068854_1005720122 | 128 |
| 137 | 3300005578 | Ga0068854_100672334 | Ga0068854_1006723341 | 128 |
| 138 | 3300005614 | Ga0068856_100037453 | Ga0068856_1000374534 | 128 |
| 139 | 3300005614 | Ga0068856_100060150 | Ga0068856_1000601502 | 128 |
| 140 | 3300005616 | Ga0068852_100002290 | Ga0068852_1000022906 | 128 |
| 141 | 3300005616 | Ga0068852_100025970 | Ga0068852_1000259703 | 128 |
| 142 | 3300005616 | Ga0068852_100116816 | Ga0068852_1001168162 | 128 |
| 143 | 3300005616 | Ga0068852_100222309 | Ga0068852_1002223091 | 128 |
| 144 | 3300005616 | Ga0068852_101634295 | Ga0068852_1016342952 | 128 |
| 145 | 3300005617 | Ga0068859_100000222 | Ga0068859_10000022243 | 128 |
| 146 | 3300005617 | Ga0068859_100005182 | Ga0068859_10000518211 | 128 |
| 147 | 3300005617 | Ga0068859_100039462 | Ga0068859_1000394622 | 128 |
| 148 | 3300005617 | Ga0068859_100051134 | Ga0068859_1000511342 | 128 |
| 149 | 3300005617 | Ga0068859_100111996 | Ga0068859_1001119964 | 128 |
| 150 | 3300005617 | Ga0068859_100112139 | Ga0068859_1001121392 | 128 |
| 151 | 3300005618 | Ga0068864_100004787 | Ga0068864_1000047879 | 128 |
| 152 | 3300005618 | Ga0068864_100013251 | Ga0068864_1000132515 | 128 |
| 153 | 3300005719 | Ga0068861_100012534 | Ga0068861_1000125342 | 128 |
| 154 | 3300005834 | Ga0068851_10016266 | Ga0068851_100162664 | 128 |
| 155 | 3300005834 | Ga0068851_10031427 | Ga0068851_100314272 | 128 |
| 156 | 3300005841 | Ga0068863_100000180 | Ga0068863_10000018060 | 128 |
| 157 | 3300005841 | Ga0068863_100020948 | Ga0068863_1000209483 | 128 |
| 158 | 3300005841 | Ga0068863_100105718 | Ga0068863_1001057181 | 128 |
| 159 | 3300005841 | Ga0068863_100326954 | Ga0068863_1003269542 | 128 |
| 160 | 3300005842 | Ga0068858_100005317 | Ga0068858_10000531712 | 128 |
| 161 | 3300005842 | Ga0068858_100007319 | Ga0068858_1000073199 | 128 |
| 162 | 3300005842 | Ga0068858_100021538 | Ga0068858_1000215383 | 128 |
| 163 | 3300005843 | Ga0068860_100000002 | Ga0068860_10000000259 | 128 |
| 164 | 3300005843 | Ga0068860_100000076 | Ga0068860_10000007618 | 128 |
| 165 | 3300005843 | Ga0068860_100010828 | Ga0068860_10001082813 | 128 |
| 166 | 3300005843 | Ga0068860_100013735 | Ga0068860_1000137355 | 128 |
| 167 | 3300005843 | Ga0068860_100289225 | Ga0068860_1002892252 | 128 |
| 168 | 3300005843 | Ga0068860_100509856 | Ga0068860_1005098562 | 128 |
| 169 | 3300005844 | Ga0068862_100003522 | Ga0068862_1000035224 | 128 |
| 170 | 3300005844 | Ga0068862_100004848 | Ga0068862_10000484811 | 128 |
| 171 | 3300006042 | Ga0075368_10000004 | Ga0075368_1000000452 | 128 |
| 172 | 3300006048 | Ga0075363_100000007 | Ga0075363_10000000742 | 128 |
| 173 | 3300006051 | Ga0075364_10000003 | Ga0075364_1000000391 | 128 |
| 174 | 3300006177 | Ga0075362_10000675 | Ga0075362_100006753 | 128 |
| 175 | 3300006178 | Ga0075367_10000036 | Ga0075367_100000366 | 128 |
| 176 | 3300006178 | Ga0075367_10344496 | Ga0075367_103444962 | 128 |
| 177 | 3300006186 | Ga0075369_10001160 | Ga0075369_100011609 | 128 |
| 178 | 3300006195 | Ga0075366_10002940 | Ga0075366_100029403 | 128 |
| 179 | 3300006195 | Ga0075366_10377669 | Ga0075366_103776692 | 128 |
| 180 | 3300006353 | Ga0075370_10000001 | Ga0075370_10000001107 | 128 |
| 181 | 3300006353 | Ga0075370_10000092 | Ga0075370_1000009223 | 128 |
| 182 | 3300006931 | Ga0097620_100000222 | Ga0097620_10000022213 | 128 |
| 183 | 3300006931 | Ga0097620_100005182 | Ga0097620_10000518211 | 128 |
| 184 | 3300006931 | Ga0097620_100039463 | Ga0097620_1000394632 | 128 |
| 185 | 3300006931 | Ga0097620_100051139 | Ga0097620_1000511394 | 128 |
| 186 | 3300006931 | Ga0097620_100111997 | Ga0097620_1001119974 | 128 |
| 187 | 3300006931 | Ga0097620_100112137 | Ga0097620_1001121372 | 128 |
| 188 | 3300009011 | Ga0105251_10000071 | Ga0105251_1000007115 | 128 |
| 189 | 3300009093 | Ga0105240_11223108 | Ga0105240_112231081 | 128 |
| 190 | 3300009098 | Ga0105245_10009117 | Ga0105245_100091172 | 128 |
| 191 | 3300009101 | Ga0105247_10002563 | Ga0105247_1000256310 | 128 |
| 192 | 3300009101 | Ga0105247_10221912 | Ga0105247_102219122 | 128 |
| 193 | 3300009148 | Ga0105243_10118450 | Ga0105243_101184502 | 128 |
| 194 | 3300009148 | Ga0105243_10353511 | Ga0105243_103535112 | 128 |
| 195 | 3300009174 | Ga0105241_10087920 | Ga0105241_100879202 | 128 |
| 196 | 3300009174 | Ga0105241_11340310 | Ga0105241_113403102 | 128 |
| 197 | 3300009176 | Ga0105242_10391373 | Ga0105242_103913731 | 128 |
| 198 | 3300009177 | Ga0105248_10000215 | Ga0105248_1000021513 | 128 |
| 199 | 3300009177 | Ga0105248_10001699 | Ga0105248_100016992 | 128 |
| 200 | 3300009177 | Ga0105248_10042744 | Ga0105248_100427442 | 128 |
| 201 | 3300009177 | Ga0105248_10518421 | Ga0105248_105184212 | 128 |
| 202 | 3300009177 | Ga0105248_10619197 | Ga0105248_106191972 | 128 |
| 203 | 3300009177 | Ga0105248_11337382 | Ga0105248_113373821 | 128 |
| 204 | 3300009545 | Ga0105237_10013174 | Ga0105237_100131742 | 128 |
| 205 | 3300009545 | Ga0105237_10740706 | Ga0105237_107407062 | 128 |
| 206 | 3300009551 | Ga0105238_10011466 | Ga0105238_100114663 | 128 |
| 207 | 3300009551 | Ga0105238_10073130 | Ga0105238_100731304 | 128 |
| 208 | 3300009553 | Ga0105249_10000037 | Ga0105249_1000003751 | 128 |
| 209 | 3300009553 | Ga0105249_10003751 | Ga0105249_1000375120 | 128 |
| 210 | 3300009553 | Ga0105249_10043616 | Ga0105249_100436163 | 128 |
| 211 | 3300009553 | Ga0105249_10096738 | Ga0105249_100967382 | 128 |
| 212 | 3300009553 | Ga0105249_10265716 | Ga0105249_102657162 | 128 |
| 213 | 3300009553 | Ga0105249_10691019 | Ga0105249_106910192 | 128 |
| 214 | 3300010375 | Ga0105239_10091863 | Ga0105239_100918632 | 128 |
| 215 | 3300011119 | Ga0105246_10549576 | Ga0105246_105495762 | 128 |
| 216 | 3300012513 | Ga0157326_1003355 | Ga0157326_10033552 | 128 |
| 217 | 3300012513 | Ga0157326_1054590 | Ga0157326_10545902 | 128 |
| 218 | 3300013100 | Ga0157373_10163390 | Ga0157373_101633901 | 128 |
| 219 | 3300013100 | Ga0157373_10330442 | Ga0157373_103304422 | 128 |
| 220 | 3300013104 | Ga0157370_10028542 | Ga0157370_100285422 | 128 |
| 221 | 3300013104 | Ga0157370_10255508 | Ga0157370_102555081 | 128 |
| 222 | 3300013296 | Ga0157374_10208625 | Ga0157374_102086253 | 128 |
| 223 | 3300013297 | Ga0157378_10010139 | Ga0157378_100101392 | 128 |
| 224 | 3300013307 | Ga0157372_10360404 | Ga0157372_103604042 | 128 |
| 225 | 3300013308 | Ga0157375_10392127 | Ga0157375_103921272 | 128 |
| 226 | 3300014325 | Ga0163163_10058436 | Ga0163163_100584362 | 128 |
| 227 | 3300014326 | Ga0157380_10000338 | Ga0157380_1000033834 | 128 |
| 228 | 3300014326 | Ga0157380_10396282 | Ga0157380_103962822 | 128 |
| 229 | 3300014326 | Ga0157380_12049952 | Ga0157380_120499522 | 128 |
| 230 | 3300014968 | Ga0157379_10068957 | Ga0157379_100689574 | 128 |
| 231 | 3300014968 | Ga0157379_10163282 | Ga0157379_101632823 | 128 |
| 232 | 3300017792 | Ga0163161_10046923 | Ga0163161_100469232 | 128 |
| 233 | 3300017792 | Ga0163161_10164283 | Ga0163161_101642831 | 128 |
| 234 | 3300017792 | Ga0163161_10405967 | Ga0163161_104059672 | 128 |
| 235 | 3300025229 | Ga0209147_100193 | Ga0209147_10019334 | 128 |
| 236 | 3300025229 | Ga0209147_100193 | Ga0209147_10019349 | 128 |
| 237 | 3300025245 | Ga0207425_1000027 | Ga0207425_100002735 | 128 |
| 238 | 3300025258 | Ga0209129_1001145 | Ga0209129_100114513 | 128 |
| 239 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007515 | 128 |
| 240 | 3300025263 | Ga0209565_1002221 | Ga0209565_10022218 | 128 |
| 241 | 3300025272 | Ga0209455_1011052 | Ga0209455_10110523 | 128 |
| 242 | 3300025273 | Ga0209673_1001760 | Ga0209673_100176011 | 128 |
| 243 | 3300025291 | Ga0209675_1055659 | Ga0209675_10556591 | 128 |
| 244 | 3300025292 | Ga0209676_1004998 | Ga0209676_10049985 | 128 |
| 245 | 3300025292 | Ga0209676_1020009 | Ga0209676_10200092 | 128 |
| 246 | 3300025294 | Ga0209025_1002001 | Ga0209025_100200112 | 128 |
| 247 | 3300025295 | Ga0209564_1075041 | Ga0209564_10750412 | 128 |
| 248 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009208 | 128 |
| 249 | 3300025297 | Ga0209758_1014811 | Ga0209758_10148113 | 128 |
| 250 | 3300025297 | Ga0209758_1019936 | Ga0209758_10199362 | 128 |
| 251 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005956 | 128 |
| 252 | 3300025298 | Ga0209050_1000306 | Ga0209050_10003062 | 128 |
| 253 | 3300025298 | Ga0209050_1006913 | Ga0209050_10069133 | 128 |
| 254 | 3300025298 | Ga0209050_1013810 | Ga0209050_10138102 | 128 |
| 255 | 3300025298 | Ga0209050_1036282 | Ga0209050_10362821 | 128 |
| 256 | 3300025298 | Ga0209050_1058224 | Ga0209050_10582242 | 128 |
| 257 | 3300025298 | Ga0209050_1086656 | Ga0209050_10866561 | 128 |
| 258 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008357 | 128 |
| 259 | 3300025303 | Ga0209051_1000525 | Ga0209051_100052511 | 128 |
| 260 | 3300025304 | Ga0209257_1004962 | Ga0209257_10049627 | 128 |
| 261 | 3300025304 | Ga0209257_1004986 | Ga0209257_10049867 | 128 |
| 262 | 3300025304 | Ga0209257_1006030 | Ga0209257_10060304 | 128 |
| 263 | 3300025315 | Ga0207697_10001759 | Ga0207697_100017594 | 128 |
| 264 | 3300025321 | Ga0207656_10028345 | Ga0207656_100283453 | 128 |
| 265 | 3300025321 | Ga0207656_10075570 | Ga0207656_100755702 | 128 |
| 266 | 3300025735 | Ga0207713_1001241 | Ga0207713_100124122 | 128 |
| 267 | 3300025900 | Ga0207710_10001753 | Ga0207710_100017539 | 128 |
| 268 | 3300025900 | Ga0207710_10027488 | Ga0207710_100274882 | 128 |
| 269 | 3300025903 | Ga0207680_10000030 | Ga0207680_1000003027 | 128 |
| 270 | 3300025903 | Ga0207680_10011474 | Ga0207680_100114745 | 128 |
| 271 | 3300025903 | Ga0207680_10291364 | Ga0207680_102913641 | 128 |
| 272 | 3300025904 | Ga0207647_10000037 | Ga0207647_1000003759 | 128 |
| 273 | 3300025904 | Ga0207647_10000283 | Ga0207647_1000028333 | 128 |
| 274 | 3300025904 | Ga0207647_10007862 | Ga0207647_100078627 | 128 |
| 275 | 3300025909 | Ga0207705_10000318 | Ga0207705_1000031818 | 128 |
| 276 | 3300025909 | Ga0207705_10083002 | Ga0207705_100830022 | 128 |
| 277 | 3300025909 | Ga0207705_10866818 | Ga0207705_108668181 | 128 |
| 278 | 3300025911 | Ga0207654_10011219 | Ga0207654_100112191 | 128 |
| 279 | 3300025911 | Ga0207654_10718201 | Ga0207654_107182012 | 128 |
| 280 | 3300025914 | Ga0207671_10003187 | Ga0207671_1000318718 | 128 |
| 281 | 3300025914 | Ga0207671_11441810 | Ga0207671_114418101 | 128 |
| 282 | 3300025919 | Ga0207657_10006137 | Ga0207657_1000613715 | 128 |
| 283 | 3300025919 | Ga0207657_10018007 | Ga0207657_100180079 | 128 |
| 284 | 3300025919 | Ga0207657_10043386 | Ga0207657_100433864 | 128 |
| 285 | 3300025920 | Ga0207649_10032910 | Ga0207649_100329102 | 128 |
| 286 | 3300025923 | Ga0207681_10000004 | Ga0207681_10000004171 | 128 |
| 287 | 3300025923 | Ga0207681_10178284 | Ga0207681_101782842 | 128 |
| 288 | 3300025924 | Ga0207694_10074360 | Ga0207694_100743603 | 128 |
| 289 | 3300025925 | Ga0207650_10004287 | Ga0207650_100042875 | 128 |
| 290 | 3300025925 | Ga0207650_10044802 | Ga0207650_100448022 | 128 |
| 291 | 3300025925 | Ga0207650_10048381 | Ga0207650_100483812 | 128 |
| 292 | 3300025925 | Ga0207650_10114020 | Ga0207650_101140203 | 128 |
| 293 | 3300025927 | Ga0207687_10022221 | Ga0207687_100222214 | 128 |
| 294 | 3300025931 | Ga0207644_10000024 | Ga0207644_10000024135 | 128 |
| 295 | 3300025931 | Ga0207644_10005374 | Ga0207644_100053744 | 128 |
| 296 | 3300025931 | Ga0207644_10143367 | Ga0207644_101433672 | 128 |
| 297 | 3300025932 | Ga0207690_10038914 | Ga0207690_100389142 | 128 |
| 298 | 3300025933 | Ga0207706_10003179 | Ga0207706_100031798 | 128 |
| 299 | 3300025933 | Ga0207706_10458062 | Ga0207706_104580622 | 128 |
| 300 | 3300025933 | Ga0207706_10541448 | Ga0207706_105414482 | 128 |
| 301 | 3300025934 | Ga0207686_10764736 | Ga0207686_107647362 | 128 |
| 302 | 3300025936 | Ga0207670_10866149 | Ga0207670_108661493 | 128 |
| 303 | 3300025938 | Ga0207704_11319133 | Ga0207704_113191331 | 128 |
| 304 | 3300025941 | Ga0207711_10005829 | Ga0207711_1000582913 | 128 |
| 305 | 3300025941 | Ga0207711_10029671 | Ga0207711_100296712 | 128 |
| 306 | 3300025941 | Ga0207711_10080001 | Ga0207711_100800013 | 128 |
| 307 | 3300025941 | Ga0207711_10537824 | Ga0207711_105378241 | 128 |
| 308 | 3300025941 | Ga0207711_11333390 | Ga0207711_113333902 | 128 |
| 309 | 3300025945 | Ga0207679_10933838 | Ga0207679_109338382 | 128 |
| 310 | 3300025949 | Ga0207667_10005214 | Ga0207667_1000521414 | 128 |
| 311 | 3300025949 | Ga0207667_10758276 | Ga0207667_107582762 | 128 |
| 312 | 3300025961 | Ga0207712_10000035 | Ga0207712_1000003552 | 128 |
| 313 | 3300025961 | Ga0207712_10002076 | Ga0207712_1000207621 | 128 |
| 314 | 3300025961 | Ga0207712_10089181 | Ga0207712_100891812 | 128 |
| 315 | 3300025961 | Ga0207712_10344285 | Ga0207712_103442852 | 128 |
| 316 | 3300025961 | Ga0207712_10741785 | Ga0207712_107417852 | 128 |
| 317 | 3300025972 | Ga0207668_10000024 | Ga0207668_10000024145 | 128 |
| 318 | 3300025972 | Ga0207668_10006763 | Ga0207668_100067632 | 128 |
| 319 | 3300025972 | Ga0207668_10487586 | Ga0207668_104875861 | 128 |
| 320 | 3300025972 | Ga0207668_10644976 | Ga0207668_106449761 | 128 |
| 321 | 3300025981 | Ga0207640_10124675 | Ga0207640_101246752 | 128 |
| 322 | 3300025981 | Ga0207640_10326145 | Ga0207640_103261452 | 128 |
| 323 | 3300025981 | Ga0207640_10465590 | Ga0207640_104655902 | 128 |
| 324 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002366 | 128 |
| 325 | 3300025986 | Ga0207658_10001681 | Ga0207658_100016816 | 128 |
| 326 | 3300025986 | Ga0207658_10002307 | Ga0207658_100023072 | 128 |
| 327 | 3300025986 | Ga0207658_10005226 | Ga0207658_100052263 | 128 |
| 328 | 3300025986 | Ga0207658_10104779 | Ga0207658_101047794 | 128 |
| 329 | 3300026035 | Ga0207703_10001071 | Ga0207703_100010719 | 128 |
| 330 | 3300026035 | Ga0207703_10005709 | Ga0207703_1000570910 | 128 |
| 331 | 3300026035 | Ga0207703_10030236 | Ga0207703_100302362 | 128 |
| 332 | 3300026041 | Ga0207639_10020538 | Ga0207639_100205384 | 128 |
| 333 | 3300026041 | Ga0207639_10030857 | Ga0207639_100308572 | 128 |
| 334 | 3300026041 | Ga0207639_12019499 | Ga0207639_120194992 | 128 |
| 335 | 3300026067 | Ga0207678_10428357 | Ga0207678_104283572 | 128 |
| 336 | 3300026067 | Ga0207678_10680341 | Ga0207678_106803412 | 128 |
| 337 | 3300026078 | Ga0207702_10056612 | Ga0207702_100566122 | 128 |
| 338 | 3300026078 | Ga0207702_10152972 | Ga0207702_101529722 | 128 |
| 339 | 3300026078 | Ga0207702_10220120 | Ga0207702_102201201 | 128 |
| 340 | 3300026088 | Ga0207641_10000993 | Ga0207641_1000099324 | 128 |
| 341 | 3300026088 | Ga0207641_10001724 | Ga0207641_1000172410 | 128 |
| 342 | 3300026088 | Ga0207641_10028187 | Ga0207641_100281872 | 128 |
| 343 | 3300026088 | Ga0207641_10144018 | Ga0207641_101440182 | 128 |
| 344 | 3300026088 | Ga0207641_10593907 | Ga0207641_105939072 | 128 |
| 345 | 3300026088 | Ga0207641_11293094 | Ga0207641_112930942 | 128 |
| 346 | 3300026095 | Ga0207676_10000041 | Ga0207676_10000041132 | 128 |
| 347 | 3300026095 | Ga0207676_10001253 | Ga0207676_1000125317 | 128 |
| 348 | 3300026095 | Ga0207676_11451931 | Ga0207676_114519312 | 128 |
| 349 | 3300026116 | Ga0207674_10005947 | Ga0207674_100059473 | 128 |
| 350 | 3300026116 | Ga0207674_10066940 | Ga0207674_100669402 | 128 |
| 351 | 3300026116 | Ga0207674_10263918 | Ga0207674_102639182 | 128 |
| 352 | 3300026116 | Ga0207674_10313693 | Ga0207674_103136932 | 128 |
| 353 | 3300026116 | Ga0207674_10588448 | Ga0207674_105884482 | 128 |
| 354 | 3300026118 | Ga0207675_100046282 | Ga0207675_1000462822 | 128 |
| 355 | 3300026142 | Ga0207698_10000638 | Ga0207698_1000063822 | 128 |
| 356 | 3300026142 | Ga0207698_10001101 | Ga0207698_100011012 | 128 |
| 357 | 3300026142 | Ga0207698_10172845 | Ga0207698_101728452 | 128 |
| 358 | 3300026142 | Ga0207698_10189980 | Ga0207698_101899802 | 128 |
| 359 | 3300027866 | Ga0209813_10000022 | Ga0209813_1000002252 | 128 |
| 360 | 3300028379 | Ga0268266_10012843 | Ga0268266_100128432 | 128 |
| 361 | 3300028379 | Ga0268266_10046959 | Ga0268266_100469593 | 128 |
| 362 | 3300028379 | Ga0268266_10567665 | Ga0268266_105676652 | 128 |
| 363 | 3300028379 | Ga0268266_11020659 | Ga0268266_110206591 | 128 |
| 364 | 3300028380 | Ga0268265_10000046 | Ga0268265_10000046172 | 128 |
| 365 | 3300028380 | Ga0268265_10000204 | Ga0268265_100002044 | 128 |
| 366 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001691 | 128 |
| 367 | 3300028381 | Ga0268264_10000069 | Ga0268264_10000069254 | 128 |
| 368 | 3300028381 | Ga0268264_10000139 | Ga0268264_10000139118 | 128 |
| 369 | 3300028381 | Ga0268264_10013044 | Ga0268264_100130449 | 128 |
| 370 | 3300028381 | Ga0268264_10013491 | Ga0268264_100134913 | 128 |
| 371 | 3300028381 | Ga0268264_10503592 | Ga0268264_105035922 | 128 |
| 372 | 3300030733 | Ga0314311_1012828 | Ga0314311_10128282 | 128 |
| 373 | 3300031616 | Ga0307508_10001675 | Ga0307508_1000167527 | 128 |
| 374 | 3300031731 | Ga0307405_10210133 | Ga0307405_102101332 | 128 |
| 375 | 3300031731 | Ga0307405_11407951 | Ga0307405_114079512 | 128 |
| 376 | 3300031901 | Ga0307406_10323422 | Ga0307406_103234223 | 128 |
| 377 | 3300031911 | Ga0307412_10008319 | Ga0307412_100083194 | 128 |
| 378 | 3300031911 | Ga0307412_10225497 | Ga0307412_102254972 | 128 |
| 379 | 3300037471 | Ga0395905_0125855 | Ga0395905_0125855_1616_2020 | 128 |
| 380 | 3300037471 | Ga0395905_1361185 | Ga0395905_1361185_54_449 | 128 |
| 381 | 3300038443 | Ga0395901_0056767 | Ga0395901_0056767_2601_3005 | 128 |
| 382 | 3300041407 | Ga0439447_140857 | Ga0439447_140857_101_493 | 128 |
| 383 | 3300041410 | Ga0439461_0002112 | Ga0439461_0002112_1671_2063 | 128 |
| 384 | 3300041411 | Ga0439466_0269951 | Ga0439466_0269951_67_459 | 128 |
| 385 | 3300041413 | Ga0439465_0002362 | Ga0439465_0002362_3008_3400 | 128 |
| 386 | 3300041456 | Ga0451795_1280467 | Ga0451795_1280467_47_439 | 128 |
| 387 | 3300041997 | Ga0439431_0063772 | Ga0439431_0063772_473_862 | 128 |
| 388 | 3300042005 | Ga0439448_0006413 | Ga0439448_0006413_1618_2025 | 128 |
| 389 | 3300042006 | Ga0439432_199668 | Ga0439432_199668_159_551 | 128 |
| 390 | 3300042012 | Ga0439455_0014055 | Ga0439455_0014055_1270_1677 | 128 |
| 391 | 3300042015 | Ga0439462_0000203 | Ga0439462_0000203_8005_8397 | 128 |
| 392 | 3300042131 | Ga0450894_004385 | Ga0450894_004385_1237_1629 | 128 |
| 393 | 3300042156 | Ga0439446_0013589 | Ga0439446_0013589_1095_1487 | 128 |
| 394 | 3300042157 | Ga0439458_0007872 | Ga0439458_0007872_95_496 | 128 |
| 395 | 3300042435 | Ga0439434_0001327 | Ga0439434_0001327_2480_2872 | 128 |
| 396 | 3300042435 | Ga0439434_0103531 | Ga0439434_0103531_189_578 | 128 |
| 397 | 3300042531 | Ga0450918_024190 | Ga0450918_024190_163_555 | 128 |
| 398 | 3300044659 | Ga0466973_0061162 | Ga0466973_0061162_2756_3145 | 128 |
| 399 | 3300044712 | Ga0453684_0954163 | Ga0453684_0954163_376_762 | 128 |
| 400 | 3300046452 | Ga0495617_066636 | Ga0495617_066636_531_923 | 128 |
| 401 | 3300046453 | Ga0495627_014898 | Ga0495627_014898_1884_2270 | 128 |
| 402 | 3300046460 | Ga0495638_0000073 | Ga0495638_0000073_163664_164056 | 128 |
| 403 | 3300046460 | Ga0495638_0028804 | Ga0495638_0028804_264_650 | 128 |
| 404 | 3300046492 | Ga0495585_0007258 | Ga0495585_0007258_3631_4017 | 128 |
| 405 | 3300046492 | Ga0495585_0345527 | Ga0495585_0345527_78_464 | 128 |
| 406 | 3300046506 | Ga0495583_0000087 | Ga0495583_0000087_164338_164730 | 128 |
| 407 | 3300046506 | Ga0495583_0004679 | Ga0495583_0004679_8263_8652 | 128 |
| 408 | 3300046506 | Ga0495583_0255552 | Ga0495583_0255552_11_397 | 128 |
| 409 | 3300046507 | Ga0495606_0122798 | Ga0495606_0122798_42_431 | 128 |
| 410 | 3300046518 | Ga0495631_0011282 | Ga0495631_0011282_724_1113 | 128 |
| 411 | 3300046518 | Ga0495631_0065744 | Ga0495631_0065744_167_556 | 128 |
| 412 | 3300046519 | Ga0495632_0000270 | Ga0495632_0000270_50784_51176 | 128 |
| 413 | 3300046522 | Ga0495643_0000821 | Ga0495643_0000821_20637_21026 | 128 |
| 414 | 3300046522 | Ga0495643_0142485 | Ga0495643_0142485_405_791 | 128 |
| 415 | 3300046524 | Ga0495648_0000049 | Ga0495648_0000049_163664_164056 | 128 |
| 416 | 3300046524 | Ga0495648_0001291 | Ga0495648_0001291_18001_18390 | 128 |
| 417 | 3300046524 | Ga0495648_0042003 | Ga0495648_0042003_1085_1492 | 128 |
| 418 | 3300046525 | Ga0495663_0000384 | Ga0495663_0000384_4548_4937 | 128 |
| 419 | 3300046530 | Ga0495654_0018975 | Ga0495654_0018975_2991_3395 | 128 |
| 420 | 3300046542 | Ga0495597_0012950 | Ga0495597_0012950_2425_2811 | 128 |
| 421 | 3300046558 | Ga0495633_0000835 | Ga0495633_0000835_12881_13270 | 128 |
| 422 | 3300046558 | Ga0495633_0014074 | Ga0495633_0014074_3675_4067 | 128 |
| 423 | 3300046616 | Ga0495668_0173952 | Ga0495668_0173952_612_1001 | 128 |
| 424 | 3300046616 | Ga0495668_0193130 | Ga0495668_0193130_520_906 | 128 |
| 425 | 3300046648 | Ga0495611_0016099 | Ga0495611_0016099_1666_2055 | 128 |
| 426 | 3300046660 | Ga0495625_0000083 | Ga0495625_0000083_137637_138026 | 128 |
| 427 | 3300046660 | Ga0495625_0000504 | Ga0495625_0000504_52413_52799 | 128 |
| 428 | 3300046660 | Ga0495625_0144756 | Ga0495625_0144756_148_537 | 128 |
| 429 | 3300046660 | Ga0495625_0815224 | Ga0495625_0815224_13_402 | 128 |
| 430 | 3300046665 | Ga0495661_0218290 | Ga0495661_0218290_29_415 | 128 |
| 431 | 3300046684 | Ga0495669_0022887 | Ga0495669_0022887_881_1267 | 128 |
| 432 | 3300046684 | Ga0495669_0144968 | Ga0495669_0144968_83_487 | 128 |
| 433 | 3300046691 | Ga0495670_0028995 | Ga0495670_0028995_1902_2291 | 128 |
| 434 | 3300046692 | Ga0495671_0000042 | Ga0495671_0000042_164565_164957 | 128 |
| 435 | 3300046692 | Ga0495671_0040060 | Ga0495671_0040060_1023_1412 | 128 |
| 436 | 3300046694 | Ga0495649_0023890 | Ga0495649_0023890_2620_3009 | 128 |
| 437 | 3300046694 | Ga0495649_0680018 | Ga0495649_0680018_39_443 | 128 |
| 438 | 3300046810 | Ga0495660_0015030 | Ga0495660_0015030_1529_1918 | 128 |
| 439 | 3300047318 | Ga0495636_0175656 | Ga0495636_0175656_167_553 | 128 |
| 440 | 3300047318 | Ga0495636_0199572 | Ga0495636_0199572_220_609 | 128 |
| 441 | 3300047323 | Ga0495683_0002424 | Ga0495683_0002424_2970_3359 | 128 |
| 442 | 3300047445 | Ga0495677_0030320 | Ga0495677_0030320_856_1245 | 128 |
| 443 | 3300047469 | Ga0495673_0000111 | Ga0495673_0000111_245_637 | 128 |
| 444 | 3300047469 | Ga0495673_0284347 | Ga0495673_0284347_148_537 | 128 |
| 445 | 3300047470 | Ga0495681_0004964 | Ga0495681_0004964_1211_1600 | 128 |
| 446 | 3300047470 | Ga0495681_0005683 | Ga0495681_0005683_6739_7125 | 128 |
| 447 | 3300047472 | Ga0495686_0007128 | Ga0495686_0007128_1723_2112 | 128 |
| 448 | 3300048903 | Ga0496100_0000293 | Ga0496100_0000293_11174_11560 | 128 |
| 449 | 3300048903 | Ga0496100_0002267 | Ga0496100_0002267_2847_3233 | 128 |
| 450 | 3300048904 | Ga0496101_0004670 | Ga0496101_0004670_5714_6100 | 128 |
| 451 | 3300048904 | Ga0496101_0062347 | Ga0496101_0062347_1073_1459 | 128 |
| 452 | 3300048905 | Ga0496102_0000481 | Ga0496102_0000481_36161_36547 | 128 |
| 453 | 3300048905 | Ga0496102_0000493 | Ga0496102_0000493_30772_31161 | 128 |
| 454 | 3300048906 | Ga0496103_0000045 | Ga0496103_0000045_8258_8647 | 128 |
| 455 | 3300048906 | Ga0496103_0000347 | Ga0496103_0000347_35933_36319 | 128 |
| 456 | 3300048906 | Ga0496103_0014007 | Ga0496103_0014007_2584_2970 | 128 |
| 457 | 3300048906 | Ga0496103_0242814 | Ga0496103_0242814_38_442 | 128 |
| 458 | 3300048907 | Ga0496104_0246076 | Ga0496104_0246076_692_1078 | 128 |
| 459 | 3300048907 | Ga0496104_0350720 | Ga0496104_0350720_621_1010 | 128 |
| 460 | 3300048908 | Ga0496105_0000310 | Ga0496105_0000310_3857_4246 | 128 |
| 461 | 3300048908 | Ga0496105_0115639 | Ga0496105_0115639_1525_1911 | 128 |
| 462 | 3300048909 | Ga0496106_0000047 | Ga0496106_0000047_37804_38190 | 128 |
| 463 | 3300048909 | Ga0496106_0000047 | Ga0496106_0000047_67950_68336 | 128 |
| 464 | 3300048909 | Ga0496106_0371698 | Ga0496106_0371698_372_776 | 128 |
| 465 | 3300048910 | Ga0496107_0000035 | Ga0496107_0000035_66076_66462 | 128 |
| 466 | 3300048910 | Ga0496107_0000232 | Ga0496107_0000232_9721_10107 | 128 |
| 467 | 3300048912 | Ga0496109_0686862 | Ga0496109_0686862_58_447 | 128 |
| 468 | 3300048912 | Ga0496109_1453136 | Ga0496109_1453136_101_505 | 128 |
| 469 | 3300048913 | Ga0496110_0173460 | Ga0496110_0173460_1545_1934 | 128 |
| 470 | 3300048914 | Ga0496111_0023748 | Ga0496111_0023748_496_885 | 128 |
| 471 | 3300048915 | Ga0496112_0579223 | Ga0496112_0579223_389_778 | 128 |
| 472 | 3300048916 | Ga0496113_0066049 | Ga0496113_0066049_1094_1483 | 128 |
| 473 | 3300048917 | Ga0496114_0003057 | Ga0496114_0003057_304_693 | 128 |
| 474 | 3300048918 | Ga0496115_0000136 | Ga0496115_0000136_59477_59866 | 128 |
| 475 | 3300048919 | Ga0496116_0000193 | Ga0496116_0000193_27523_27909 | 128 |
| 476 | 3300048919 | Ga0496116_0014335 | Ga0496116_0014335_4659_5045 | 128 |
| 477 | 3300048919 | Ga0496116_0021771 | Ga0496116_0021771_1579_1968 | 128 |
| 478 | 3300048919 | Ga0496116_0132219 | Ga0496116_0132219_752_1159 | 128 |
| 479 | 3300048920 | Ga0496117_0000046 | Ga0496117_0000046_267081_267470 | 128 |
| 480 | 3300048920 | Ga0496117_0001149 | Ga0496117_0001149_3752_4138 | 128 |
| 481 | 3300048920 | Ga0496117_0001656 | Ga0496117_0001656_27437_27823 | 128 |
| 482 | 3300048920 | Ga0496117_0025898 | Ga0496117_0025898_4072_4458 | 128 |
| 483 | 3300048920 | Ga0496117_0055953 | Ga0496117_0055953_1200_1589 | 128 |
| 484 | 3300048920 | Ga0496117_0072272 | Ga0496117_0072272_1869_2273 | 128 |
| 485 | 3300048920 | Ga0496117_0140715 | Ga0496117_0140715_648_1055 | 128 |
| 486 | 3300048921 | Ga0496118_0000036 | Ga0496118_0000036_33410_33799 | 128 |
| 487 | 3300048921 | Ga0496118_0000156 | Ga0496118_0000156_27865_28251 | 128 |
| 488 | 3300048921 | Ga0496118_0001071 | Ga0496118_0001071_39369_39755 | 128 |
| 489 | 3300048921 | Ga0496118_0008681 | Ga0496118_0008681_6267_6653 | 128 |
| 490 | 3300048921 | Ga0496118_0023716 | Ga0496118_0023716_3855_4244 | 128 |
| 491 | 3300048921 | Ga0496118_0057954 | Ga0496118_0057954_897_1301 | 128 |
| 492 | 3300048921 | Ga0496118_0226697 | Ga0496118_0226697_536_943 | 128 |
| 493 | 3300048922 | Ga0496119_0012384 | Ga0496119_0012384_761_1150 | 128 |
| 494 | 3300048922 | Ga0496119_0035790 | Ga0496119_0035790_482_868 | 128 |
| 495 | 3300048922 | Ga0496119_0077142 | Ga0496119_0077142_983_1387 | 128 |
| 496 | 3300048922 | Ga0496119_0215251 | Ga0496119_0215251_358_765 | 128 |
| 497 | 3300048923 | Ga0496120_0011251 | Ga0496120_0011251_637_1026 | 128 |
| 498 | 3300048924 | Ga0496121_0000267 | Ga0496121_0000267_106683_107072 | 128 |
| 499 | 3300048924 | Ga0496121_0008703 | Ga0496121_0008703_10810_11214 | 128 |
| 500 | 3300048924 | Ga0496121_0022946 | Ga0496121_0022946_1692_2135 | 128 |
| 501 | 3300048924 | Ga0496121_0082072 | Ga0496121_0082072_1240_1626 | 128 |
| 502 | 3300048925 | Ga0496122_0010908 | Ga0496122_0010908_7877_8266 | 128 |
| 503 | 3300048925 | Ga0496122_0011160 | Ga0496122_0011160_1523_1927 | 128 |
| 504 | 3300048926 | Ga0496123_0003433 | Ga0496123_0003433_7521_7910 | 128 |
| 505 | 3300048926 | Ga0496123_0089722 | Ga0496123_0089722_907_1311 | 128 |
| 506 | 3300048927 | Ga0496124_0000011 | Ga0496124_0000011_420316_420705 | 128 |
| 507 | 3300048927 | Ga0496124_0000996 | Ga0496124_0000996_8342_8728 | 128 |
| 508 | 3300048927 | Ga0496124_0014240 | Ga0496124_0014240_4251_4637 | 128 |
| 509 | 3300048927 | Ga0496124_0901682 | Ga0496124_0901682_29_433 | 128 |
| 510 | 3300048928 | Ga0496125_0000309 | Ga0496125_0000309_7814_8203 | 128 |
| 511 | 3300048928 | Ga0496125_0004416 | Ga0496125_0004416_8210_8596 | 128 |
| 512 | 3300048928 | Ga0496125_0299955 | Ga0496125_0299955_277_663 | 128 |
| 513 | 3300048929 | Ga0496126_0000771 | Ga0496126_0000771_33410_33799 | 128 |
| 514 | 3300049459 | Ga0495678_025215 | Ga0495678_025215_646_1032 | 128 |
| 515 | 3300049570 | Ga0501033_0838774 | Ga0501033_0838774_197_607 | 128 |
| 516 | 3300049571 | Ga0501034_0163439 | Ga0501034_0163439_104_514 | 128 |
| 517 | 3300049571 | Ga0501034_0193038 | Ga0501034_0193038_924_1334 | 128 |
| 518 | 3300049571 | Ga0501034_0305992 | Ga0501034_0305992_1024_1410 | 128 |
| 519 | 3300049572 | Ga0501036_1014176 | Ga0501036_1014176_223_633 | 128 |
| 520 | 3300049573 | Ga0501037_0089386 | Ga0501037_0089386_1619_2029 | 128 |
| 521 | 3300049573 | Ga0501037_0165509 | Ga0501037_0165509_754_1140 | 128 |
| 522 | 3300049575 | Ga0501039_0501514 | Ga0501039_0501514_389_775 | 128 |
| 523 | 3300049575 | Ga0501039_0892037 | Ga0501039_0892037_121_510 | 128 |
| 524 | 3300049579 | Ga0501043_0009351 | Ga0501043_0009351_1127_1513 | 128 |
| 525 | 3300049579 | Ga0501043_0481267 | Ga0501043_0481267_186_587 | 128 |
| 526 | 3300049580 | Ga0501046_0099070 | Ga0501046_0099070_251_637 | 128 |
| 527 | 3300049581 | Ga0501047_0037604 | Ga0501047_0037604_2014_2400 | 128 |
| 528 | 3300049581 | Ga0501047_0137025 | Ga0501047_0137025_1723_2133 | 128 |
| 529 | 3300049581 | Ga0501047_0489583 | Ga0501047_0489583_285_674 | 128 |
| 530 | 3300049766 | Ga0501269_037144 | Ga0501269_037144_144_536 | 128 |
| 531 | 3300049822 | Ga0501035_0028723 | Ga0501035_0028723_380_766 | 128 |
| 532 | 3300049822 | Ga0501035_0181180 | Ga0501035_0181180_815_1225 | 128 |
| 533 | 3300049823 | Ga0501044_0000453 | Ga0501044_0000453_35961_36350 | 128 |
| 534 | 3300049823 | Ga0501044_0025060 | Ga0501044_0025060_3027_3437 | 128 |
| 535 | 3300049823 | Ga0501044_0193118 | Ga0501044_0193118_1347_1733 | 128 |
| 536 | 3300049823 | Ga0501044_0475386 | Ga0501044_0475386_149_535 | 128 |
| 537 | 3300049823 | Ga0501044_0759502 | Ga0501044_0759502_299_700 | 128 |
| 538 | 3300050493 | nmdc:mga0k408_304895_c1 | nmdc:mga0k408_304895_c1_334_723 | 128 |
| 539 | 3300050496 | nmdc:mga07m45_2_c1 | nmdc:mga07m45_2_c1_146409_146804 | 128 |
| 540 | 3300050508 | nmdc:mga09592_163515_c1 | nmdc:mga09592_163515_c1_1212_1607 | 128 |
| 541 | 3300050516 | nmdc:mga0sz30_69514_c1 | nmdc:mga0sz30_69514_c1_419_808 | 128 |
| 542 | 3300053077 | Ga0495601_0702328 | Ga0495601_0702328_224_613 | 128 |
| 543 | 3300053087 | Ga0500643_001365 | Ga0500643_001365_3357_3749 | 128 |
| 544 | 3300053087 | Ga0500643_011896 | Ga0500643_011896_1825_2211 | 128 |
| 545 | 3300053088 | Ga0500644_0033469 | Ga0500644_0033469_1132_1524 | 128 |
| 546 | 3300053091 | Ga0500647_0134914 | Ga0500647_0134914_187_573 | 128 |
| 547 | 3300053093 | Ga0500651_0049563 | Ga0500651_0049563_2189_2575 | 128 |
| 548 | 3300053094 | Ga0500566_0060749 | Ga0500566_0060749_217_621 | 128 |
| 549 | 3300053096 | Ga0500641_0013706 | Ga0500641_0013706_172_558 | 128 |
| 550 | 3300053116 | Ga0500592_000011 | Ga0500592_000011_71955_72359 | 128 |
| 551 | 3300053119 | Ga0500595_068728 | Ga0500595_068728_100_489 | 128 |
| 552 | 3300053123 | Ga0500614_007358 | Ga0500614_007358_1482_1868 | 128 |
| 553 | 3300053130 | Ga0500642_0020139 | Ga0500642_0020139_996_1385 | 128 |
| 554 | 3300053133 | Ga0500655_000088 | Ga0500655_000088_14971_15357 | 128 |
| 555 | 3300053134 | Ga0500658_0001649 | Ga0500658_0001649_2926_3315 | 128 |
| 556 | 3300053134 | Ga0500658_0016625 | Ga0500658_0016625_1559_1945 | 128 |
| 557 | 3300053139 | Ga0500568_0020652 | Ga0500568_0020652_1525_1911 | 128 |
| 558 | 3300053142 | Ga0500577_0111183 | Ga0500577_0111183_446_832 | 128 |
| 559 | 3300053148 | Ga0500590_007719 | Ga0500590_007719_4341_4727 | 128 |
| 560 | 3300053151 | Ga0500604_0007243 | Ga0500604_0007243_1780_2166 | 128 |
| 561 | 3300053151 | Ga0500604_0019219 | Ga0500604_0019219_1272_1661 | 128 |
| 562 | 3300053151 | Ga0500604_0188270 | Ga0500604_0188270_132_536 | 128 |
| 563 | 3300053156 | Ga0500622_0008732 | Ga0500622_0008732_1027_1413 | 128 |
| 564 | 3300053158 | Ga0500627_0000032 | Ga0500627_0000032_79096_79482 | 128 |
| 565 | 3300053158 | Ga0500627_0000590 | Ga0500627_0000590_4019_4405 | 128 |
| 566 | 3300053163 | Ga0500639_214460 | Ga0500639_214460_77_463 | 128 |
| 567 | 3300053177 | Ga0500636_0032948 | Ga0500636_0032948_361_747 | 128 |
| 568 | 3300053724 | Ga0500570_014959 | Ga0500570_014959_1238_1624 | 128 |
| 569 | 3300053730 | Ga0500645_073673 | Ga0500645_073673_572_958 | 128 |
| 570 | 3300053730 | Ga0500645_077800 | Ga0500645_077800_527_913 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.9432 | 1 | 67 |
| 6jni-assembly4.cif.gz_G | crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna | 0.9416 | 1 | 128 |
| 4wlw-assembly1.cif.gz_A-2 | crystal structure of the ag(i) (activator) form of e. coli cuer, a copper efflux regulator, bound to copa promoter dna | 0.9227 | 1 | 126 |
| 4wlw-assembly2.cif.gz_A | crystal structure of the ag(i) (activator) form of e. coli cuer, a copper efflux regulator, bound to copa promoter dna | 0.9227 | 1 | 126 |
| 4wlw-assembly2.cif.gz_A-2 | crystal structure of the ag(i) (activator) form of e. coli cuer, a copper efflux regulator, bound to copa promoter dna | 0.9227 | 1 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wlwA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9207 | 2 | 126 | 1.10.1660.10 |
| 4r22B00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9127 | 1 | 71 | 1.10.1660.10 |
| 3hh0C01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9073 | 1 | 67 | 1.10.1660.10 |
| 4r4eA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9056 | 1 | 71 | 1.10.1660.10 |
| 3iaoA01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9015 | 1 | 68 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M4RKH4-F1-model_v4 | Copper-translocating P-type ATPase | 0.965 | 1 | 127 |
GO:0003677
GO:0003700 GO:0005507 GO:0005524 GO:0005886 GO:0012505 GO:0016887 GO:0043682 GO:0045893 GO:0055070 |
| AF-A0A8A3KEQ3-F1-model_v4 | deleted | 0.9644 | 1 | 127 |
|
| AF-A0A2G1MBV0-F1-model_v4 | MerR family transcriptional regulator | 0.9636 | 1 | 91 |
GO:0003677
GO:0003700 |
| AF-A0A6M1T767-F1-model_v4 | MerR family transcriptional regulator | 0.9591 | 1 | 127 |
GO:0003677
GO:0003700 |
| AF-A0A0F7PRM9-F1-model_v4 | Cu(I)-responsive transcriptional regulator | 0.9588 | 1 | 128 |
GO:0003677
GO:0003700 GO:0005507 GO:0005737 GO:0045893 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar