F464815

General Info

Members Datasets Scaffolds Average Seq Length
570 337 523 350

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10152936|Ga0105240_101529362
Length 385
Sequence VWRGSRVIDQSISSLTITAILSGVTRRSAMQQVKAVIARAKGAPVEIVTINVPEPGPGEAVVRVQACRVCHTDLHYREGGINDEFPFLLGHEASGIVEAVGPGVTEVEPGDFVILNWRAVCGQCRACKRGEPWYCFATHNAKQKMTLEDGTELSPALGIGAFAEKTLVAAGQCTKVDPSARPAAVGLLGCGVMAGIGAAVNTGGVTRGKSVAGXXVAAIAGSALAGANPIIAVDIDAKKLATATRLGATHTVDSSSADPVAAIQELTGGFGADVVIEAVGRPDTWKQAFYARDLAGTVVLVGVPTPEMKVPDLPLIDVFGRGGSLKSSWYGDCLPSRDFPMLVDLYRRGKLDLDAFVSEEIALTDIEAAFERMHRGEVLRSVVIL

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
4 2643221615 Nocardioides sp. Root224 Isolate Unclassified
5 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
6 2643221641 Nocardioides sp. Root122 Isolate Unclassified
7 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
8 2643221696 Nocardioides sp. Root140 Isolate Unclassified
9 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
10 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
11 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
12 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
13 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
14 2739367898 Nocardioides sp. CF479 Isolate Unclassified
15 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
16 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
17 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
18 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
19 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
20 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
21 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
22 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
23 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
24 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
25 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
26 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
27 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
28 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
29 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
30 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
31 2922554459 Rhodococcus sp. 66b Isolate Unclassified
32 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
33 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
34 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
35 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
36 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
37 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
38 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
39 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
40 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
41 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
42 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
43 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
44 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
45 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
180 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
323 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
324 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
325 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
326 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
327 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
328 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
335 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
336 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
337 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.4
Metatranscriptomes 0.35
Isolates 8.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.77
Nodule 0.18
Rhizoplane 9.47
Rhizosphere 71.05
Stem 0
Stem Tuber 0.18
Unclassified 10.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001482 3300000549 Bacteria 3496
2 JGI24746J21847_1002752 3300001977 Bacteria 2771
3 JGI24739J22299_10032835 3300001989 Bacteria 1782
4 JGI24744J21845_10002772 3300002077 Bacteria 3579
5 JGI24751J29686_10005886 3300002459 Bacteria 2500
6 Ga0055540_1009061 3300003792 Bacteria 3495
7 Ga0070658_10205050 3300005327 Bacteria 1665
8 Ga0070683_100050182 3300005329 Bacteria 3861
9 Ga0068869_100052604 3300005334 Bacteria 2957
10 Ga0070666_10073811 3300005335 Bacteria 2324
11 Ga0070680_100094379 3300005336 Bacteria 2480
12 Ga0070660_100223257 3300005339 Bacteria 1531
13 Ga0070661_100108340 3300005344 Bacteria 2073
14 Ga0070668_100155585 3300005347 Bacteria 1852
15 Ga0070671_100005606 3300005355 Bacteria 9996
16 Ga0070674_100137104 3300005356 Bacteria 1832
17 Ga0070673_100218806 3300005364 Bacteria 1647
18 Ga0070667_100002627 3300005367 Bacteria 15564
19 Ga0070667_100186014 3300005367 Bacteria 1838
20 Ga0070714_100003328 3300005435 Bacteria 11980
21 Ga0070714_100208201 3300005435 Bacteria 1792
22 Ga0070701_10172094 3300005438 Bacteria 1262
23 Ga0070681_10069638 3300005458 Bacteria 3484
24 Ga0068867_100140733 3300005459 Bacteria 1885
25 Ga0070679_100013856 3300005530 Bacteria 7726
26 Ga0070679_100017913 3300005530 Bacteria 6861
27 Ga0070679_100104164 3300005530 Bacteria 2824
28 Ga0070684_100022378 3300005535 Bacteria 5271
29 Ga0070684_100243353 3300005535 Bacteria 1644
30 Ga0070684_100300113 3300005535 Bacteria 1474
31 Ga0070665_100051956 3300005548 Bacteria 4111
32 Ga0068855_100022328 3300005563 Bacteria 7582
33 Ga0068857_100070152 3300005577 Bacteria 3121
34 Ga0068859_100003059 3300005617 Bacteria 16971
35 Ga0068861_100044974 3300005719 Bacteria 3322
36 Ga0068851_10068449 3300005834 Bacteria 1832
37 Ga0068863_100009027 3300005841 Bacteria 9737
38 Ga0068858_100136816 3300005842 Bacteria 2299
39 Ga0068860_100003236 3300005843 Bacteria 16797
40 Ga0068860_100298525 3300005843 Bacteria 1578
41 Ga0081455_10000123 3300005937 Bacteria 89254
42 Ga0081455_10002627 3300005937 Bacteria 21291
43 Ga0081455_10154307 3300005937 Bacteria 1767
44 Ga0081538_10000729 3300005981 Bacteria 35897
45 Ga0081538_10064579 3300005981 Bacteria 2069
46 Ga0081538_10078148 3300005981 Bacteria 1778
47 Ga0075365_10000659 3300006038 Bacteria 13789
48 Ga0075365_10001308 3300006038 Bacteria 11113
49 Ga0075365_10002646 3300006038 Bacteria 8887
50 Ga0075365_10008080 3300006038 Bacteria 5942
51 Ga0075365_10010956 3300006038 Bacteria 5311
52 Ga0075368_10030599 3300006042 Bacteria 2085
53 Ga0075363_100001702 3300006048 Bacteria 8542
54 Ga0075363_100029127 3300006048 Bacteria 2847
55 Ga0075364_10001283 3300006051 Bacteria 13531
56 Ga0075364_10056460 3300006051 Bacteria 2571
57 Ga0075367_10023310 3300006178 Bacteria 3482
58 Ga0075369_10001022 3300006186 Bacteria 9338
59 Ga0075369_10012010 3300006186 Bacteria 3416
60 Ga0075369_10055197 3300006186 Bacteria 1726
61 Ga0075369_10065463 3300006186 Bacteria 1593
62 Ga0075370_10005701 3300006353 Bacteria 6213
63 Ga0075370_10073271 3300006353 Bacteria 1961
64 Ga0068871_100170732 3300006358 Bacteria 1864
65 Ga0075428_100001173 3300006844 Bacteria 28048
66 Ga0075428_100016876 3300006844 Bacteria 8063
67 Ga0075430_100001837 3300006846 Bacteria 17380
68 Ga0075431_100000320 3300006847 Bacteria 37830
69 Ga0075431_100002225 3300006847 Bacteria 18576
70 Ga0075429_100015793 3300006880 Bacteria 6539
71 Ga0097620_100003059 3300006931 Bacteria 16971
72 Ga0105240_10152936 3300009093 Bacteria 2746
73 Ga0111539_10015766 3300009094 Bacteria 9388
74 Ga0105245_10082246 3300009098 Bacteria 2946
75 Ga0105247_10002270 3300009101 Bacteria 13205
76 Ga0114129_10008242 3300009147 Bacteria 14861
77 Ga0105243_10000943 3300009148 Bacteria 27256
78 Ga0105243_10218493 3300009148 Bacteria 1683
79 Ga0105243_10219185 3300009148 Bacteria 1681
80 Ga0105241_10000752 3300009174 Bacteria 24686
81 Ga0105248_10058454 3300009177 Bacteria 4331
82 Ga0105237_10021898 3300009545 Bacteria 6564
83 Ga0105237_10201774 3300009545 Bacteria 1989
84 Ga0105238_10110895 3300009551 Bacteria 2724
85 Ga0105249_10105252 3300009553 Bacteria 2660
86 Ga0105035_101219 3300009988 Bacteria 1739
87 Ga0105239_10028303 3300010375 Bacteria 6165
88 Ga0105239_10100856 3300010375 Bacteria 3194
89 Ga0105239_10164051 3300010375 Bacteria 2484
90 Ga0105246_10113365 3300011119 Bacteria 1996
91 Ga0157374_10155123 3300013296 Bacteria 2228
92 Ga0163162_10138478 3300013306 Bacteria 2545
93 Ga0157375_10277237 3300013308 Bacteria 1839
94 Ga0163163_10047811 3300014325 Bacteria 4205
95 Ga0163163_10196109 3300014325 Bacteria 2067
96 Ga0157380_10165405 3300014326 Bacteria 1927
97 Ga0157380_10408624 3300014326 Bacteria 1290
98 Ga0163161_10046687 3300017792 Bacteria 3125
99 Ga0206354_10337988 3300020081 Bacteria 1946
100 Ga0206353_10313555 3300020082 Bacteria 6094
101 Ga0213876_10019281 3300021384 Bacteria 3602
102 Ga0209025_1033669 3300025294 Bacteria 2361
103 Ga0209051_1000959 3300025303 Bacteria 28324
104 Ga0209051_1002561 3300025303 Bacteria 12838
105 Ga0209051_1003092 3300025303 Bacteria 11227
106 Ga0207710_10003350 3300025900 Bacteria 7162
107 Ga0207688_10010961 3300025901 Bacteria 4933
108 Ga0207688_10035646 3300025901 Bacteria 2757
109 Ga0207647_10022335 3300025904 Bacteria 4204
110 Ga0207645_10009258 3300025907 Bacteria 6823
111 Ga0207705_10060292 3300025909 Bacteria 2740
112 Ga0207695_10000994 3300025913 Bacteria 50163
113 Ga0207671_10000748 3300025914 Bacteria 41241
114 Ga0207671_10011881 3300025914 Bacteria 7044
115 Ga0207671_10183533 3300025914 Bacteria 1629
116 Ga0207663_10062061 3300025916 Bacteria 2374
117 Ga0207660_10071919 3300025917 Bacteria 2518
118 Ga0207657_10055365 3300025919 Bacteria 3426
119 Ga0207657_10178659 3300025919 Bacteria 1716
120 Ga0207649_10060025 3300025920 Bacteria 2388
121 Ga0207652_10055313 3300025921 Bacteria 3412
122 Ga0207652_10161373 3300025921 Bacteria 2010
123 Ga0207694_10058904 3300025924 Bacteria 2987
124 Ga0207650_10263868 3300025925 Bacteria 1398
125 Ga0207664_10085348 3300025929 Bacteria 2576
126 Ga0207644_10002286 3300025931 Bacteria 12435
127 Ga0207644_10097546 3300025931 Bacteria 2202
128 Ga0207690_10007171 3300025932 Bacteria 6622
129 Ga0207686_10193755 3300025934 Bacteria 1451
130 Ga0207709_10001543 3300025935 Bacteria 15820
131 Ga0207709_10320099 3300025935 Bacteria 1160
132 Ga0207669_10016078 3300025937 Bacteria 3792
133 Ga0207669_10096564 3300025937 Bacteria 1940
134 Ga0207691_10037078 3300025940 Bacteria 4515
135 Ga0207711_10016788 3300025941 Bacteria 6080
136 Ga0207711_10325974 3300025941 Bacteria 1420
137 Ga0207689_10007513 3300025942 Bacteria 9557
138 Ga0207661_10021401 3300025944 Bacteria 4844
139 Ga0207661_10156891 3300025944 Bacteria 1972
140 Ga0207667_10149787 3300025949 Bacteria 2402
141 Ga0207668_10143529 3300025972 Bacteria 1839
142 Ga0207640_10138911 3300025981 Bacteria 1768
143 Ga0207658_10005374 3300025986 Bacteria 8795
144 Ga0207703_10112284 3300026035 Bacteria 2328
145 Ga0207703_10181347 3300026035 Bacteria 1858
146 Ga0207639_10039169 3300026041 Bacteria 3530
147 Ga0207678_10048580 3300026067 Bacteria 3667
148 Ga0207678_10200312 3300026067 Bacteria 1707
149 Ga0207641_10003083 3300026088 Bacteria 15021
150 Ga0207648_10146157 3300026089 Bacteria 2085
151 Ga0207674_10066814 3300026116 Bacteria 3621
152 Ga0207674_10111368 3300026116 Bacteria 2711
153 Ga0207675_100117645 3300026118 Bacteria 2513
154 Ga0207683_10069615 3300026121 Bacteria 3108
155 Ga0207683_10088104 3300026121 Bacteria 2761
156 Ga0207683_10092432 3300026121 Bacteria 2696
157 Ga0207698_10017391 3300026142 Bacteria 4876
158 Ga0207698_10073095 3300026142 Bacteria 2729
159 Ga0207698_10099075 3300026142 Bacteria 2410
160 Ga0207428_10013908 3300027907 Bacteria 7009
161 Ga0268266_10030514 3300028379 Bacteria 4580
162 Ga0268264_10000716 3300028381 Bacteria 38128
163 Ga0268264_10187928 3300028381 Bacteria 1881
164 Ga0307515_10059172 3300028794 Bacteria 5497
165 Ga0265338_10031430 3300028800 Bacteria 5206
166 Ga0265325_10001703 3300031241 Bacteria 15285
167 Ga0265340_10000864 3300031247 Bacteria 17200
168 Ga0265340_10002267 3300031247 Bacteria 10990
169 Ga0265339_10004725 3300031249 Bacteria 9230
170 Ga0265316_10035911 3300031344 Bacteria 4011
171 Ga0307513_10004144 3300031456 Bacteria 19417
172 Ga0307513_10021746 3300031456 Bacteria 7567
173 Ga0307408_100075340 3300031548 Bacteria 2507
174 Ga0307508_10021893 3300031616 Bacteria 5816
175 Ga0265314_10010299 3300031711 Bacteria 7810
176 Ga0265342_10053228 3300031712 Bacteria 2410
177 Ga0307413_10000126 3300031824 Bacteria 19849
178 Ga0307518_10005276 3300031838 Bacteria 9234
179 Ga0307410_10014641 3300031852 Bacteria 4623
180 Ga0307410_10279282 3300031852 Bacteria 1310
181 Ga0307412_10206466 3300031911 Bacteria 1496
182 Ga0307409_100009467 3300031995 Bacteria 5987
183 Ga0307416_100148697 3300032002 Bacteria 2144
184 Ga0307416_100346188 3300032002 Bacteria 1502
185 Ga0307415_100048596 3300032126 Bacteria 2864
186 Ga0307415_100068322 3300032126 Bacteria 2487
187 Ga0307507_10062572 3300033179 Bacteria 3455
188 Ga0373942_0024478 3300035207 Bacteria 1548
189 Ga0373937_0502016 3300036401 Bacteria 1152
190 Ga0395900_0008055 3300037418 Bacteria 10847
191 Ga0395900_0508515 3300037418 Bacteria 1154
192 Ga0395898_0129853 3300037466 Bacteria 2414
193 Ga0436364_1519819 3300037853 Bacteria 16812
194 Ga0395901_0020711 3300038443 Bacteria 6732
195 Ga0395901_0084502 3300038443 Bacteria 3317
196 Ga0400485_18483 3300038735 Bacteria 4148
197 Ga0400483_012695 3300039062 Bacteria 10466
198 Ga0436365_0967944 3300039437 Bacteria 29438
199 Ga0439436_0010993 3300041404 Bacteria 2753
200 Ga0439466_0008352 3300041411 Bacteria 3903
201 Ga0439466_0017501 3300041411 Bacteria 2582
202 Ga0439466_0029435 3300041411 Bacteria 1889
203 Ga0439465_0005793 3300041413 Bacteria 3933
204 Ga0439465_0009387 3300041413 Bacteria 3081
205 Ga0439465_0013447 3300041413 Bacteria 2551
206 Ga0451797_0406099 3300041453 Bacteria 1641
207 Ga0451795_1026876 3300041456 Bacteria 2445
208 Ga0451833_0141132 3300041491 Bacteria 2314
209 Ga0451853_0541938 3300041512 Bacteria 7574
210 Ga0439431_0001900 3300041997 Bacteria 4631
211 Ga0439431_0013019 3300041997 Bacteria 1916
212 Ga0439445_0035815 3300042004 Bacteria 1304
213 Ga0450907_008529 3300042146 Bacteria 1700
214 Ga0439459_0016704 3300042438 Bacteria 1359
215 Ga0466969_0000861 3300044656 Bacteria 16459
216 Ga0466972_0004743 3300044658 Bacteria 6806
217 Ga0466972_0021125 3300044658 Bacteria 3249
218 Ga0466972_0023072 3300044658 Bacteria 3097
219 Ga0466972_0023900 3300044658 Bacteria 3037
220 Ga0466965_0003350 3300044683 Bacteria 7023
221 Ga0466965_0006758 3300044683 Bacteria 5234
222 Ga0466965_0039860 3300044683 Bacteria 2310
223 Ga0466965_0042330 3300044683 Bacteria 2246
224 Ga0466966_0007637 3300044684 Bacteria 7166
225 Ga0466966_0014101 3300044684 Bacteria 5291
226 Ga0466966_0025427 3300044684 Bacteria 3867
227 Ga0466966_0088999 3300044684 Bacteria 1918
228 Ga0466966_0137619 3300044684 Bacteria 1493
229 Ga0466961_0001501 3300044693 Bacteria 14476
230 Ga0466961_0038074 3300044693 Bacteria 3085
231 Ga0466961_0044756 3300044693 Bacteria 2832
232 Ga0466961_0100599 3300044693 Bacteria 1821
233 Ga0466961_0222484 3300044693 Bacteria 1163
234 Ga0466963_0062109 3300044694 Bacteria 2499
235 Ga0466963_0203533 3300044694 Bacteria 1385
236 Ga0466971_0001550 3300044719 Bacteria 9689
237 Ga0466971_0014851 3300044719 Bacteria 3427
238 Ga0466971_0051425 3300044719 Bacteria 1855
239 Ga0466971_0059298 3300044719 Bacteria 1728
240 Ga0466968_0067733 3300044735 Bacteria 1549
241 Ga0466970_0004702 3300044765 Bacteria 6743
242 Ga0466970_0028789 3300044765 Bacteria 2921
243 Ga0466970_0034871 3300044765 Bacteria 2665
244 Ga0466970_0159862 3300044765 Bacteria 1246
245 Ga0466957_0034514 3300044842 Bacteria 3034
246 Ga0466957_0038929 3300044842 Bacteria 2867
247 Ga0466957_0049687 3300044842 Bacteria 2550
248 Ga0466960_0001280 3300044901 Bacteria 9119
249 Ga0466960_0001306 3300044901 Bacteria 9037
250 Ga0466960_0007000 3300044901 Bacteria 4555
251 Ga0466960_0048628 3300044901 Bacteria 2038
252 Ga0466959_0000764 3300045049 Bacteria 18820
253 Ga0466959_0036002 3300045049 Bacteria 3657
254 Ga0466959_0062948 3300045049 Bacteria 2695
255 Ga0466959_0108013 3300045049 Bacteria 1988
256 Ga0466958_0022989 3300045836 Bacteria 3656
257 Ga0466958_0024486 3300045836 Bacteria 3552
258 Ga0466967_0016168 3300045976 Bacteria 5874
259 Ga0466967_0016363 3300045976 Bacteria 5847
260 Ga0466967_0075917 3300045976 Bacteria 3021
261 Ga0466967_0159873 3300045976 Bacteria 2114
262 Ga0466967_0258817 3300045976 Bacteria 1665
263 Ga0495592_0006810 3300046454 Bacteria 8530
264 Ga0495603_0012208 3300046455 Bacteria 5202
265 Ga0495629_0004434 3300046459 Bacteria 10518
266 Ga0495638_0042428 3300046460 Bacteria 2873
267 Ga0495651_0004389 3300046462 Bacteria 10799
268 Ga0495651_0038183 3300046462 Bacteria 3739
269 Ga0495653_0001578 3300046463 Bacteria 17865
270 Ga0495580_0021072 3300046472 Bacteria 4813
271 Ga0495582_0080910 3300046473 Bacteria 1804
272 Ga0495582_0106358 3300046473 Bacteria 1574
273 Ga0495662_0000347 3300046476 Bacteria 20264
274 Ga0495664_0000303 3300046477 Bacteria 23601
275 Ga0495585_0047115 3300046492 Bacteria 2401
276 Ga0495594_0002274 3300046499 Bacteria 10008
277 Ga0495607_0016069 3300046501 Bacteria 4836
278 Ga0495608_0000841 3300046511 Bacteria 21466
279 Ga0495618_0029051 3300046514 Bacteria 3448
280 Ga0495620_0025476 3300046515 Bacteria 2797
281 Ga0495628_0001628 3300046516 Bacteria 20538
282 Ga0495628_0009680 3300046516 Bacteria 8222
283 Ga0495630_0025647 3300046517 Bacteria 4360
284 Ga0495666_0001587 3300046526 Bacteria 11187
285 Ga0495666_0002305 3300046526 Bacteria 9517
286 Ga0495652_0019766 3300046529 Bacteria 5992
287 Ga0495652_0024632 3300046529 Bacteria 5324
288 Ga0495586_0006495 3300046535 Bacteria 6243
289 Ga0495587_0046167 3300046536 Bacteria 2586
290 Ga0495645_0003244 3300046543 Bacteria 11037
291 Ga0495622_0001218 3300046557 Bacteria 13213
292 Ga0495667_0009494 3300046559 Bacteria 6591
293 Ga0495668_0000161 3300046616 Bacteria 101410
294 Ga0495668_0029479 3300046616 Bacteria 3100
295 Ga0495634_0090889 3300046642 Bacteria 1982
296 Ga0495635_0007609 3300046663 Bacteria 7557
297 Ga0495588_0014711 3300046674 Bacteria 3751
298 Ga0495599_0009966 3300046678 Bacteria 5817
299 Ga0495623_0013299 3300046679 Bacteria 5338
300 Ga0495646_0007078 3300046680 Bacteria 7124
301 Ga0495613_0001143 3300046689 Bacteria 20228
302 Ga0495624_0002611 3300046690 Bacteria 13602
303 Ga0495671_0055975 3300046692 Bacteria 1953
304 Ga0495589_0011588 3300046794 Bacteria 4578
305 Ga0495600_0007742 3300046809 Bacteria 6579
306 Ga0495600_0091640 3300046809 Bacteria 1982
307 Ga0495660_0114230 3300046810 Bacteria 1374
308 Ga0495604_0003188 3300047317 Bacteria 13105
309 Ga0495604_0106833 3300047317 Bacteria 2047
310 Ga0495674_0005877 3300047319 Bacteria 11773
311 Ga0495672_0093185 3300047320 Bacteria 1650
312 Ga0495676_0011711 3300047321 Bacteria 7908
313 Ga0495683_0000797 3300047323 Bacteria 22423
314 Ga0495675_0009417 3300047444 Bacteria 6077
315 Ga0495675_0022760 3300047444 Bacteria 3996
316 Ga0495675_0091437 3300047444 Bacteria 1910
317 Ga0495673_0000941 3300047469 Bacteria 26398
318 Ga0495614_0016363 3300048089 Bacteria 3228
319 Ga0495614_0056341 3300048089 Bacteria 1687
320 Ga0496100_0000053 3300048903 Bacteria 70913
321 Ga0496100_0000393 3300048903 Bacteria 21163
322 Ga0496100_0024885 3300048903 Bacteria 3657
323 Ga0496101_0000056 3300048904 Bacteria 135446
324 Ga0496101_0000057 3300048904 Bacteria 134204
325 Ga0496101_0001380 3300048904 Bacteria 14541
326 Ga0496101_0135045 3300048904 Bacteria 1876
327 Ga0496102_0000059 3300048905 Bacteria 168633
328 Ga0496102_0000177 3300048905 Bacteria 86724
329 Ga0496102_0025685 3300048905 Bacteria 5246
330 Ga0496102_0043506 3300048905 Bacteria 4073
331 Ga0496102_0059491 3300048905 Bacteria 3494
332 Ga0496102_0110446 3300048905 Bacteria 2563
333 Ga0496102_0347977 3300048905 Bacteria 1395
334 Ga0496103_0000003 3300048906 Bacteria 603967
335 Ga0496103_0000063 3300048906 Bacteria 128503
336 Ga0496104_0018629 3300048907 Bacteria 6337
337 Ga0496104_0076775 3300048907 Bacteria 3182
338 Ga0496104_0235625 3300048907 Bacteria 1742
339 Ga0496104_0273399 3300048907 Bacteria 1602
340 Ga0496105_0004900 3300048908 Bacteria 10120
341 Ga0496105_0016579 3300048908 Bacteria 5883
342 Ga0496106_0039599 3300048909 Bacteria 3530
343 Ga0496106_0373774 3300048909 Bacteria 1145
344 Ga0496107_0000167 3300048910 Bacteria 33889
345 Ga0496107_0165239 3300048910 Bacteria 1641
346 Ga0496108_0012895 3300048911 Bacteria 6810
347 Ga0496108_0023986 3300048911 Bacteria 5022
348 Ga0496108_0096397 3300048911 Bacteria 2519
349 Ga0496108_0209616 3300048911 Bacteria 1691
350 Ga0496108_0335157 3300048911 Bacteria 1319
351 Ga0496109_0000144 3300048912 Bacteria 71522
352 Ga0496109_0061039 3300048912 Bacteria 3446
353 Ga0496109_0157025 3300048912 Bacteria 2131
354 Ga0496109_0197435 3300048912 Bacteria 1892
355 Ga0496109_0226213 3300048912 Bacteria 1760
356 Ga0496110_0004181 3300048913 Bacteria 11149
357 Ga0496110_0012688 3300048913 Bacteria 6935
358 Ga0496110_0043249 3300048913 Bacteria 3933
359 Ga0496110_0159956 3300048913 Bacteria 2041
360 Ga0496111_0042099 3300048914 Bacteria 3279
361 Ga0496111_0042598 3300048914 Bacteria 3261
362 Ga0496111_0058221 3300048914 Bacteria 2797
363 Ga0496111_0270507 3300048914 Bacteria 1261
364 Ga0496113_0038302 3300048916 Bacteria 3525
365 Ga0496113_0424217 3300048916 Bacteria 1068
366 Ga0496114_0003438 3300048917 Bacteria 12146
367 Ga0496114_0004833 3300048917 Bacteria 10496
368 Ga0496115_0001472 3300048918 Bacteria 16914
369 Ga0496115_0021772 3300048918 Bacteria 4956
370 Ga0496115_0028898 3300048918 Bacteria 4349
371 Ga0496115_0172373 3300048918 Bacteria 1789
372 Ga0496116_0000013 3300048919 Bacteria 603993
373 Ga0496116_0002742 3300048919 Bacteria 18096
374 Ga0496117_0000013 3300048920 Bacteria 603995
375 Ga0496118_0000011 3300048921 Bacteria 603995
376 Ga0496119_0048377 3300048922 Bacteria 2637
377 Ga0496120_0021133 3300048923 Bacteria 4118
378 Ga0496121_0000060 3300048924 Bacteria 276682
379 Ga0496121_0000068 3300048924 Bacteria 259210
380 Ga0496121_0089971 3300048924 Bacteria 2401
381 Ga0496122_0000085 3300048925 Bacteria 208310
382 Ga0496124_0000065 3300048927 Bacteria 223594
383 Ga0496125_0000008 3300048928 Bacteria 704677
384 Ga0496125_0006840 3300048928 Bacteria 12229
385 Ga0496125_0143220 3300048928 Bacteria 1658
386 Ga0496126_0000062 3300048929 Bacteria 259210
387 Ga0496126_0012696 3300048929 Bacteria 8618
388 Ga0496126_0037170 3300048929 Bacteria 4546
389 Ga0496126_0221712 3300048929 Bacteria 1588
390 Ga0501031_0008726 3300049568 Bacteria 6592
391 Ga0501032_0006046 3300049569 Bacteria 8926
392 Ga0501032_0023150 3300049569 Bacteria 4299
393 Ga0501032_0038617 3300049569 Bacteria 3250
394 Ga0501032_0146327 3300049569 Bacteria 1555
395 Ga0501032_0175631 3300049569 Bacteria 1403
396 Ga0501033_0014181 3300049570 Bacteria 6060
397 Ga0501033_0026555 3300049570 Bacteria 4358
398 Ga0501033_0054056 3300049570 Bacteria 2972
399 Ga0501033_0185908 3300049570 Bacteria 1488
400 Ga0501034_0002539 3300049571 Bacteria 21826
401 Ga0501034_0006581 3300049571 Bacteria 12464
402 Ga0501034_0007104 3300049571 Bacteria 11949
403 Ga0501034_0055411 3300049571 Bacteria 3990
404 Ga0501034_0183218 3300049571 Bacteria 2059
405 Ga0501036_0011150 3300049572 Bacteria 7436
406 Ga0501036_0027797 3300049572 Bacteria 4781
407 Ga0501036_0154847 3300049572 Bacteria 1933
408 Ga0501036_0196029 3300049572 Bacteria 1699
409 Ga0501036_0318333 3300049572 Bacteria 1300
410 Ga0501037_0006073 3300049573 Bacteria 8823
411 Ga0501037_0006561 3300049573 Bacteria 8515
412 Ga0501037_0009150 3300049573 Bacteria 7255
413 Ga0501037_0095109 3300049573 Bacteria 2154
414 Ga0501038_0002083 3300049574 Bacteria 18540
415 Ga0501038_0012225 3300049574 Bacteria 7839
416 Ga0501038_0023272 3300049574 Bacteria 5540
417 Ga0501038_0206002 3300049574 Bacteria 1576
418 Ga0501039_0004016 3300049575 Bacteria 11054
419 Ga0501039_0025599 3300049575 Bacteria 4535
420 Ga0501039_0097967 3300049575 Bacteria 2287
421 Ga0501039_0173481 3300049575 Bacteria 1695
422 Ga0501040_0207738 3300049576 Bacteria 1391
423 Ga0501041_0033840 3300049577 Bacteria 3093
424 Ga0501041_0103610 3300049577 Bacteria 1762
425 Ga0501042_0167440 3300049578 Bacteria 1585
426 Ga0501043_0002178 3300049579 Bacteria 16718
427 Ga0501043_0053426 3300049579 Bacteria 3173
428 Ga0501043_0060602 3300049579 Bacteria 2971
429 Ga0501043_0152801 3300049579 Bacteria 1806
430 Ga0501046_0000879 3300049580 Bacteria 29216
431 Ga0501046_0003598 3300049580 Bacteria 14198
432 Ga0501046_0006444 3300049580 Bacteria 10393
433 Ga0501046_0055571 3300049580 Bacteria 3110
434 Ga0501046_0143886 3300049580 Bacteria 1802
435 Ga0501047_0006214 3300049581 Bacteria 11226
436 Ga0501047_0022965 3300049581 Bacteria 5987
437 Ga0501047_0024286 3300049581 Bacteria 5819
438 Ga0501047_0048096 3300049581 Bacteria 4120
439 Ga0501047_0080758 3300049581 Bacteria 3125
440 Ga0501048_0009602 3300049582 Bacteria 7260
441 Ga0501048_0011448 3300049582 Bacteria 6618
442 Ga0501048_0020414 3300049582 Bacteria 4855
443 Ga0501048_0050636 3300049582 Bacteria 2957
444 Ga0501067_0008339 3300049583 Bacteria 5753
445 Ga0501067_0029600 3300049583 Bacteria 3035
446 Ga0501069_0006522 3300049585 Bacteria 6101
447 Ga0501070_0000482 3300049586 Bacteria 36204
448 Ga0501070_0000545 3300049586 Bacteria 34467
449 Ga0501070_0015717 3300049586 Bacteria 6365
450 Ga0501071_0035037 3300049587 Bacteria 3574
451 Ga0501072_0018612 3300049588 Bacteria 5352
452 Ga0501072_0159443 3300049588 Bacteria 1800
453 Ga0501073_0023699 3300049589 Bacteria 4406
454 Ga0501073_0042005 3300049589 Bacteria 3229
455 Ga0501074_0013440 3300049590 Bacteria 5951
456 Ga0501074_0036770 3300049590 Bacteria 3547
457 Ga0501075_0091578 3300049591 Bacteria 2307
458 Ga0501076_0006752 3300049592 Bacteria 8328
459 Ga0501077_0010215 3300049593 Bacteria 5846
460 Ga0501077_0144259 3300049593 Bacteria 1510
461 Ga0501079_0202523 3300049741 Bacteria 1550
462 Ga0501080_0211759 3300049742 Bacteria 1776
463 Ga0501080_0248399 3300049742 Bacteria 1622
464 Ga0501081_0017097 3300049743 Bacteria 4797
465 Ga0501081_0123774 3300049743 Bacteria 1844
466 Ga0501035_0001148 3300049822 Bacteria 27666
467 Ga0501035_0001215 3300049822 Bacteria 26839
468 Ga0501035_0020032 3300049822 Bacteria 6144
469 Ga0501035_0028571 3300049822 Bacteria 5091
470 Ga0501035_0057098 3300049822 Bacteria 3481
471 Ga0501035_0067768 3300049822 Bacteria 3166
472 Ga0501035_0166021 3300049822 Bacteria 1909
473 Ga0501044_0003581 3300049823 Bacteria 17477
474 Ga0501044_0004709 3300049823 Bacteria 15252
475 Ga0501044_0007806 3300049823 Bacteria 11761
476 Ga0501044_0008986 3300049823 Bacteria 10925
477 Ga0501044_0015695 3300049823 Bacteria 8156
478 Ga0501044_0073875 3300049823 Bacteria 3465
479 Ga0501045_0000424 3300049824 Bacteria 25806
480 nmdc:mga03n38_142993_c1 3300050490 Bacteria 1197
481 nmdc:mga03n38_146867_c1 3300050490 Bacteria 1183
482 nmdc:mga03n38_5425_c1 3300050490 Bacteria 4343
483 nmdc:mga00v17_151559_c1 3300050491 Bacteria 1490
484 nmdc:mga00v17_2428_c1 3300050491 Bacteria 9527
485 nmdc:mga0yw44_15186_c1 3300050492 Bacteria 4115
486 nmdc:mga0yw44_18593_c1 3300050492 Bacteria 3811
487 nmdc:mga0yw44_4222_c1 3300050492 Bacteria 6543
488 nmdc:mga0yw44_4450_c1 3300050492 Bacteria 6427
489 nmdc:mga0yw44_7629_c1 3300050492 Bacteria 5334
490 nmdc:mga07m45_105225_c1 3300050496 Bacteria 1623
491 nmdc:mga07m45_6192_c1 3300050496 Bacteria 6036
492 nmdc:mga07m45_7450_c1 3300050496 Bacteria 5594
493 nmdc:mga05p37_2234_c1 3300050507 Bacteria 22561
494 nmdc:mga09592_261_c1 3300050508 Bacteria 38455
495 nmdc:mga0qj67_7414_c1 3300050509 Bacteria 8109
496 nmdc:mga06r32_13005_c1 3300050510 Bacteria 7530
497 nmdc:mga06r32_7443_c1 3300050510 Bacteria 9853
498 nmdc:mga08y16_103424_c1 3300050511 Bacteria 2965
499 nmdc:mga08y16_16168_c1 3300050511 Bacteria 7844
500 nmdc:mga0sz30_1905_c1 3300050516 Bacteria 7447
501 nmdc:mga0sz30_8675_c1 3300050516 Bacteria 1660
502 nmdc:mga0sz30_88316_c1 3300050516 Bacteria 1347
503 Ga0495601_0006119 3300053077 Bacteria 7023
504 Ga0495601_0015329 3300053077 Bacteria 4632
505 Ga0495612_0069122 3300053078 Bacteria 1471
506 Ga0495619_0024537 3300053085 Bacteria 3868
507 Ga0500643_001717 3300053087 Bacteria 12170
508 Ga0500643_016514 3300053087 Bacteria 2497
509 Ga0500644_0000667 3300053088 Bacteria 12577
510 Ga0500556_0000762 3300053104 Bacteria 19126
511 Ga0500593_008726 3300053117 Bacteria 4176
512 Ga0500573_0167861 3300053140 Bacteria 1189
513 Ga0500588_0041527 3300053146 Bacteria 1389
514 Ga0500604_0061358 3300053151 Bacteria 1182
515 Ga0500616_0000060 3300053153 Bacteria 252252
516 Ga0500616_0021260 3300053153 Bacteria 3641
517 Ga0500616_0021763 3300053153 Bacteria 3587
518 Ga0500627_0015515 3300053158 Bacteria 2947
519 Ga0501084_0108493 3300054114 Bacteria 2332
520 Ga0501082_0196789 3300060353 Bacteria 1753
521 Ga0466962_0001313 3300061719 Bacteria 11468
522 Ga0466962_0027202 3300061719 Bacteria 2746
523 Ga0466962_0061638 3300061719 Bacteria 1790

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050490 nmdc:mga03n38_146867_c1 nmdc:mga03n38_146867_c1_204_1157 301
2 3300050511 nmdc:mga08y16_103424_c1 nmdc:mga08y16_103424_c1_639_1724 301
3 3300044693 Ga0466961_0222484 Ga0466961_0222484_13_1008 308
4 3300048918 Ga0496115_0028898 Ga0496115_0028898_23_988 310
5 3300037418 Ga0395900_0008055 Ga0395900_0008055_7197_8297 311
6 3300037466 Ga0395898_0129853 Ga0395898_0129853_360_1460 311
7 3300042146 Ga0450907_008529 Ga0450907_008529_378_1511 311
8 3300053088 Ga0500644_0000667 Ga0500644_0000667_7475_8560 314
9 3300045976 Ga0466967_0258817 Ga0466967_0258817_15_986 315
10 3300048905 Ga0496102_0347977 Ga0496102_0347977_378_1367 315
11 3300048916 Ga0496113_0424217 Ga0496113_0424217_50_1039 315
12 iso_pu_bacteria 8025478263 8025480684 315
13 3300047444 Ga0495675_0022760 Ga0495675_0022760_337_1422 316
14 3300048911 Ga0496108_0335157 Ga0496108_0335157_336_1304 316
15 3300050492 nmdc:mga0yw44_15186_c1 nmdc:mga0yw44_15186_c1_1516_2601 317
16 3300006051 Ga0075364_10056460 Ga0075364_100564603 320
17 3300005617 Ga0068859_100003059 Ga0068859_1000030597 323
18 3300006931 Ga0097620_100003059 Ga0097620_1000030597 323
19 3300009101 Ga0105247_10002270 Ga0105247_100022707 323
20 3300025900 Ga0207710_10003350 Ga0207710_100033507 323
21 3300036401 Ga0373937_0502016 Ga0373937_0502016_140_1126 323
22 3300048905 Ga0496102_0000059 Ga0496102_0000059_131378_132463 323
23 3300048906 Ga0496103_0000063 Ga0496103_0000063_46482_47567 323
24 3300048922 Ga0496119_0048377 Ga0496119_0048377_578_1663 323
25 3300048924 Ga0496121_0089971 Ga0496121_0089971_447_1532 323
26 3300005843 Ga0068860_100003236 Ga0068860_10000323612 324
27 3300006038 Ga0075365_10010956 Ga0075365_100109564 324
28 3300028381 Ga0268264_10000716 Ga0268264_100007169 324
29 3300050492 nmdc:mga0yw44_7629_c1 nmdc:mga0yw44_7629_c1_1999_3096 324
30 3300005329 Ga0070683_100050182 Ga0070683_1000501822 325
31 3300005344 Ga0070661_100108340 Ga0070661_1001083402 325
32 3300005530 Ga0070679_100013856 Ga0070679_1000138562 325
33 3300005535 Ga0070684_100022378 Ga0070684_1000223786 325
34 3300020081 Ga0206354_10337988 Ga0206354_103379882 325
35 3300025920 Ga0207649_10060025 Ga0207649_100600252 325
36 3300025921 Ga0207652_10055313 Ga0207652_100553132 325
37 3300025932 Ga0207690_10007171 Ga0207690_100071711 325
38 3300025944 Ga0207661_10021401 Ga0207661_100214012 325
39 3300044658 Ga0466972_0023900 Ga0466972_0023900_1512_2546 326
40 3300020082 Ga0206353_10313555 Ga0206353_103135552 327
41 3300048907 Ga0496104_0076775 Ga0496104_0076775_130_1227 327
42 3300005327 Ga0070658_10205050 Ga0070658_102050503 328
43 3300010375 Ga0105239_10028303 Ga0105239_100283034 328
44 3300025914 Ga0207671_10183533 Ga0207671_101835332 328
45 3300048909 Ga0496106_0373774 Ga0496106_0373774_102_1133 328
46 3300053146 Ga0500588_0041527 Ga0500588_0041527_342_1373 328
47 3300006844 Ga0075428_100001173 Ga0075428_1000011736 329
48 3300006846 Ga0075430_100001837 Ga0075430_1000018372 329
49 3300006847 Ga0075431_100002225 Ga0075431_10000222512 329
50 3300006880 Ga0075429_100015793 Ga0075429_1000157933 329
51 3300009147 Ga0114129_10008242 Ga0114129_1000824212 329
52 3300011119 Ga0105246_10113365 Ga0105246_101133653 329
53 3300014326 Ga0157380_10408624 Ga0157380_104086241 329
54 3300027907 Ga0207428_10013908 Ga0207428_100139083 329
55 3300050492 nmdc:mga0yw44_4450_c1 nmdc:mga0yw44_4450_c1_1634_2719 329
56 3300050507 nmdc:mga05p37_2234_c1 nmdc:mga05p37_2234_c1_16069_17157 329
57 3300050508 nmdc:mga09592_261_c1 nmdc:mga09592_261_c1_14923_16011 329
58 3300050509 nmdc:mga0qj67_7414_c1 nmdc:mga0qj67_7414_c1_843_1931 329
59 3300050510 nmdc:mga06r32_7443_c1 nmdc:mga06r32_7443_c1_2195_3283 329
60 3300050511 nmdc:mga08y16_16168_c1 nmdc:mga08y16_16168_c1_4916_6004 329
61 3300049581 Ga0501047_0006214 Ga0501047_0006214_5331_6416 331
62 3300049823 Ga0501044_0073875 Ga0501044_0073875_1676_2761 331
63 3300053140 Ga0500573_0167861 Ga0500573_0167861_90_1175 331
64 3300053153 Ga0500616_0021763 Ga0500616_0021763_930_1991 331
65 3300031456 Ga0307513_10004144 Ga0307513_1000414422 332
66 3300048914 Ga0496111_0042598 Ga0496111_0042598_1819_2868 332
67 3300005356 Ga0070674_100137104 Ga0070674_1001371042 333
68 3300005530 Ga0070679_100104164 Ga0070679_1001041642 333
69 3300006358 Ga0068871_100170732 Ga0068871_1001707323 333
70 3300025921 Ga0207652_10161373 Ga0207652_101613732 333
71 3300025937 Ga0207669_10096564 Ga0207669_100965642 333
72 3300025941 Ga0207711_10016788 Ga0207711_100167885 333
73 3300026035 Ga0207703_10181347 Ga0207703_101813472 333
74 3300037418 Ga0395900_0508515 Ga0395900_0508515_32_1105 333
75 3300048903 Ga0496100_0000393 Ga0496100_0000393_14031_15116 333
76 3300048904 Ga0496101_0001380 Ga0496101_0001380_7652_8737 333
77 3300048911 Ga0496108_0023986 Ga0496108_0023986_3763_4848 333
78 3300048912 Ga0496109_0061039 Ga0496109_0061039_2205_3290 333
79 3300048917 Ga0496114_0004833 Ga0496114_0004833_2776_3861 333
80 3300048918 Ga0496115_0172373 Ga0496115_0172373_334_1419 333
81 iso_pu_bacteria 2866552031 2866553571 333
82 3300001989 JGI24739J22299_10032835 JGI24739J22299_100328352 334
83 3300005347 Ga0070668_100155585 Ga0070668_1001555851 334
84 3300005577 Ga0068857_100070152 Ga0068857_1000701523 334
85 3300009094 Ga0111539_10015766 Ga0111539_1001576611 334
86 3300009148 Ga0105243_10219185 Ga0105243_102191851 334
87 3300009177 Ga0105248_10058454 Ga0105248_100584541 334
88 3300014325 Ga0163163_10196109 Ga0163163_101961092 334
89 3300014326 Ga0157380_10165405 Ga0157380_101654052 334
90 3300025919 Ga0207657_10055365 Ga0207657_100553651 334
91 3300025925 Ga0207650_10263868 Ga0207650_102638682 334
92 3300025934 Ga0207686_10193755 Ga0207686_101937552 334
93 3300025972 Ga0207668_10143529 Ga0207668_101435292 334
94 3300026116 Ga0207674_10066814 Ga0207674_100668143 334
95 3300028381 Ga0268264_10187928 Ga0268264_101879282 334
96 3300032126 Ga0307415_100068322 Ga0307415_1000683223 334
97 3300041404 Ga0439436_0010993 Ga0439436_0010993_1529_2626 334
98 3300046473 Ga0495582_0080910 Ga0495582_0080910_406_1491 334
99 3300049569 Ga0501032_0146327 Ga0501032_0146327_100_1185 334
100 3300049572 Ga0501036_0196029 Ga0501036_0196029_170_1255 334
101 3300049575 Ga0501039_0025599 Ga0501039_0025599_2263_3348 334
102 3300049576 Ga0501040_0207738 Ga0501040_0207738_93_1178 334
103 3300049588 Ga0501072_0018612 Ga0501072_0018612_2935_4020 334
104 3300053085 Ga0495619_0024537 Ga0495619_0024537_2096_3184 334
105 3300053104 Ga0500556_0000762 Ga0500556_0000762_15565_16665 334
106 3300053153 Ga0500616_0021260 Ga0500616_0021260_854_1939 334
107 3300013308 Ga0157375_10277237 Ga0157375_102772373 335
108 3300026041 Ga0207639_10039169 Ga0207639_100391692 335
109 3300044658 Ga0466972_0021125 Ga0466972_0021125_1726_2811 335
110 3300048907 Ga0496104_0235625 Ga0496104_0235625_302_1435 335
111 3300005981 Ga0081538_10000729 Ga0081538_1000072915 336
112 3300026121 Ga0207683_10069615 Ga0207683_100696152 336
113 3300028800 Ga0265338_10031430 Ga0265338_100314305 336
114 3300031241 Ga0265325_10001703 Ga0265325_1000170310 336
115 3300031247 Ga0265340_10000864 Ga0265340_100008648 336
116 3300031249 Ga0265339_10004725 Ga0265339_100047254 336
117 3300031344 Ga0265316_10035911 Ga0265316_100359112 336
118 3300031711 Ga0265314_10010299 Ga0265314_100102993 336
119 3300031712 Ga0265342_10053228 Ga0265342_100532282 336
120 3300038443 Ga0395901_0084502 Ga0395901_0084502_821_1909 336
121 3300041456 Ga0451795_1026876 Ga0451795_1026876_986_2071 336
122 3300047444 Ga0495675_0091437 Ga0495675_0091437_462_1547 336
123 3300048905 Ga0496102_0110446 Ga0496102_0110446_229_1314 336
124 3300048909 Ga0496106_0039599 Ga0496106_0039599_890_1975 336
125 3300048910 Ga0496107_0165239 Ga0496107_0165239_357_1442 336
126 3300005937 Ga0081455_10002627 Ga0081455_100026273 337
127 3300006847 Ga0075431_100000320 Ga0075431_10000032011 337
128 3300041453 Ga0451797_0406099 Ga0451797_0406099_75_1160 337
129 3300048907 Ga0496104_0273399 Ga0496104_0273399_404_1504 337
130 3300048913 Ga0496110_0012688 Ga0496110_0012688_1892_2992 337
131 3300048928 Ga0496125_0143220 Ga0496125_0143220_434_1534 337
132 3300048929 Ga0496126_0221712 Ga0496126_0221712_446_1546 337
133 3300049581 Ga0501047_0048096 Ga0501047_0048096_708_1823 337
134 3300049822 Ga0501035_0067768 Ga0501035_0067768_2014_3129 337
135 3300050510 nmdc:mga06r32_13005_c1 nmdc:mga06r32_13005_c1_505_1593 337
136 3300053153 Ga0500616_0000060 Ga0500616_0000060_245635_246720 337
137 3300005981 Ga0081538_10064579 Ga0081538_100645792 338
138 3300031852 Ga0307410_10014641 Ga0307410_100146413 338
139 3300031995 Ga0307409_100009467 Ga0307409_1000094674 338
140 3300032126 Ga0307415_100048596 Ga0307415_1000485962 338
141 3300046501 Ga0495607_0016069 Ga0495607_0016069_336_1418 338
142 3300047323 Ga0495683_0000797 Ga0495683_0000797_4255_5337 338
143 3300049580 Ga0501046_0000879 Ga0501046_0000879_27981_29066 338
144 3300005535 Ga0070684_100300113 Ga0070684_1003001132 339
145 3300009098 Ga0105245_10082246 Ga0105245_100822462 339
146 3300025904 Ga0207647_10022335 Ga0207647_100223351 339
147 3300026142 Ga0207698_10099075 Ga0207698_100990753 339
148 3300044684 Ga0466966_0137619 Ga0466966_0137619_237_1334 339
149 3300044693 Ga0466961_0044756 Ga0466961_0044756_554_1651 339
150 3300045049 Ga0466959_0108013 Ga0466959_0108013_541_1638 339
151 3300048912 Ga0496109_0226213 Ga0496109_0226213_641_1726 339
152 3300049571 Ga0501034_0007104 Ga0501034_0007104_10752_11864 339
153 3300049573 Ga0501037_0009150 Ga0501037_0009150_1697_2809 339
154 3300049574 Ga0501038_0002083 Ga0501038_0002083_13139_14251 339
155 3300049822 Ga0501035_0001148 Ga0501035_0001148_10751_11863 339
156 3300049823 Ga0501044_0003581 Ga0501044_0003581_12737_13849 339
157 3300050490 nmdc:mga03n38_142993_c1 nmdc:mga03n38_142993_c1_18_1082 339
158 3300053117 Ga0500593_008726 Ga0500593_008726_733_1878 339
159 3300003792 Ga0055540_1009061 Ga0055540_10090614 340
160 3300006186 Ga0075369_10012010 Ga0075369_100120102 340
161 3300025303 Ga0209051_1000959 Ga0209051_100095923 340
162 3300025303 Ga0209051_1002561 Ga0209051_10025612 340
163 3300025303 Ga0209051_1003092 Ga0209051_10030928 340
164 3300031247 Ga0265340_10002267 Ga0265340_100022676 340
165 3300031456 Ga0307513_10021746 Ga0307513_100217463 340
166 3300041491 Ga0451833_0141132 Ga0451833_0141132_1177_2262 340
167 3300044842 Ga0466957_0034514 Ga0466957_0034514_695_1762 340
168 3300048904 Ga0496101_0135045 Ga0496101_0135045_66_1190 340
169 3300049568 Ga0501031_0008726 Ga0501031_0008726_684_1781 340
170 3300049572 Ga0501036_0027797 Ga0501036_0027797_853_1950 340
171 3300049573 Ga0501037_0095109 Ga0501037_0095109_987_2084 340
172 3300049574 Ga0501038_0012225 Ga0501038_0012225_4606_5703 340
173 3300049575 Ga0501039_0097967 Ga0501039_0097967_149_1246 340
174 3300049577 Ga0501041_0103610 Ga0501041_0103610_436_1533 340
175 3300049578 Ga0501042_0167440 Ga0501042_0167440_243_1340 340
176 3300049579 Ga0501043_0060602 Ga0501043_0060602_93_1190 340
177 3300049582 Ga0501048_0050636 Ga0501048_0050636_1033_2130 340
178 3300049587 Ga0501071_0035037 Ga0501071_0035037_2314_3411 340
179 3300049742 Ga0501080_0211759 Ga0501080_0211759_97_1194 340
180 3300049743 Ga0501081_0123774 Ga0501081_0123774_467_1564 340
181 3300049822 Ga0501035_0057098 Ga0501035_0057098_2307_3404 340
182 3300050516 nmdc:mga0sz30_1905_c1 nmdc:mga0sz30_1905_c1_5536_6624 340
183 3300054114 Ga0501084_0108493 Ga0501084_0108493_284_1381 340
184 3300025944 Ga0207661_10156891 Ga0207661_101568912 341
185 3300044656 Ga0466969_0000861 Ga0466969_0000861_3921_5006 341
186 3300044684 Ga0466966_0007637 Ga0466966_0007637_3211_4296 341
187 3300044693 Ga0466961_0001501 Ga0466961_0001501_4468_5553 341
188 3300044719 Ga0466971_0001550 Ga0466971_0001550_7869_8954 341
189 3300044765 Ga0466970_0159862 Ga0466970_0159862_90_1175 341
190 3300045049 Ga0466959_0000764 Ga0466959_0000764_13815_14900 341
191 3300045836 Ga0466958_0024486 Ga0466958_0024486_1880_2965 341
192 3300048914 Ga0496111_0058221 Ga0496111_0058221_659_1744 341
193 3300049570 Ga0501033_0026555 Ga0501033_0026555_77_1195 341
194 3300049822 Ga0501035_0166021 Ga0501035_0166021_172_1290 341
195 3300061719 Ga0466962_0001313 Ga0466962_0001313_3152_4237 341
196 3300005535 Ga0070684_100243353 Ga0070684_1002433531 342
197 3300038443 Ga0395901_0020711 Ga0395901_0020711_4559_5698 342
198 3300044683 Ga0466965_0006758 Ga0466965_0006758_2182_3270 342
199 3300044683 Ga0466965_0042330 Ga0466965_0042330_86_1174 342
200 3300045836 Ga0466958_0022989 Ga0466958_0022989_50_1165 342
201 3300048913 Ga0496110_0004181 Ga0496110_0004181_5709_6782 342
202 3300049569 Ga0501032_0006046 Ga0501032_0006046_3197_4282 342
203 3300049569 Ga0501032_0175631 Ga0501032_0175631_191_1276 342
204 3300049570 Ga0501033_0014181 Ga0501033_0014181_1862_2947 342
205 3300049570 Ga0501033_0054056 Ga0501033_0054056_1249_2337 342
206 3300049571 Ga0501034_0006581 Ga0501034_0006581_4034_5119 342
207 3300049571 Ga0501034_0183218 Ga0501034_0183218_280_1365 342
208 3300049572 Ga0501036_0011150 Ga0501036_0011150_1152_2237 342
209 3300049573 Ga0501037_0006073 Ga0501037_0006073_2936_4021 342
210 3300049574 Ga0501038_0206002 Ga0501038_0206002_155_1240 342
211 3300049575 Ga0501039_0173481 Ga0501039_0173481_440_1525 342
212 3300049580 Ga0501046_0006444 Ga0501046_0006444_6293_7378 342
213 3300049580 Ga0501046_0055571 Ga0501046_0055571_565_1650 342
214 3300049581 Ga0501047_0022965 Ga0501047_0022965_1041_2126 342
215 3300049582 Ga0501048_0009602 Ga0501048_0009602_3894_4979 342
216 3300049582 Ga0501048_0011448 Ga0501048_0011448_293_1378 342
217 3300049586 Ga0501070_0000545 Ga0501070_0000545_28555_29640 342
218 3300049589 Ga0501073_0042005 Ga0501073_0042005_2107_3192 342
219 3300049590 Ga0501074_0036770 Ga0501074_0036770_1628_2713 342
220 3300049591 Ga0501075_0091578 Ga0501075_0091578_970_2055 342
221 3300049592 Ga0501076_0006752 Ga0501076_0006752_6710_7795 342
222 3300049593 Ga0501077_0010215 Ga0501077_0010215_4635_5720 342
223 3300049741 Ga0501079_0202523 Ga0501079_0202523_339_1424 342
224 3300049743 Ga0501081_0017097 Ga0501081_0017097_292_1377 342
225 3300049822 Ga0501035_0020032 Ga0501035_0020032_3906_4991 342
226 3300049823 Ga0501044_0008986 Ga0501044_0008986_7608_8693 342
227 3300049824 Ga0501045_0000424 Ga0501045_0000424_11241_12326 342
228 3300006038 Ga0075365_10001308 Ga0075365_100013088 343
229 3300006186 Ga0075369_10055197 Ga0075369_100551972 343
230 3300009148 Ga0105243_10218493 Ga0105243_102184931 343
231 3300025294 Ga0209025_1033669 Ga0209025_10336692 343
232 3300025935 Ga0207709_10320099 Ga0207709_103200991 343
233 3300033179 Ga0307507_10062572 Ga0307507_100625724 343
234 3300041411 Ga0439466_0008352 Ga0439466_0008352_1684_2769 343
235 3300041411 Ga0439466_0017501 Ga0439466_0017501_766_1854 343
236 3300041413 Ga0439465_0009387 Ga0439465_0009387_1941_3026 343
237 3300041413 Ga0439465_0013447 Ga0439465_0013447_280_1368 343
238 3300041997 Ga0439431_0001900 Ga0439431_0001900_1415_2500 343
239 3300041997 Ga0439431_0013019 Ga0439431_0013019_410_1498 343
240 3300044683 Ga0466965_0003350 Ga0466965_0003350_2924_4012 343
241 3300044735 Ga0466968_0067733 Ga0466968_0067733_210_1328 343
242 3300044901 Ga0466960_0001306 Ga0466960_0001306_1648_2760 343
243 3300046460 Ga0495638_0042428 Ga0495638_0042428_147_1232 343
244 3300049577 Ga0501041_0033840 Ga0501041_0033840_1577_2662 343
245 3300050516 nmdc:mga0sz30_8675_c1 nmdc:mga0sz30_8675_c1_371_1459 343
246 3300053151 Ga0500604_0061358 Ga0500604_0061358_17_1102 343
247 3300002459 JGI24751J29686_10005886 JGI24751J29686_100058863 344
248 3300005335 Ga0070666_10073811 Ga0070666_100738112 344
249 3300005355 Ga0070671_100005606 Ga0070671_1000056063 344
250 3300005367 Ga0070667_100002627 Ga0070667_1000026276 344
251 3300005367 Ga0070667_100186014 Ga0070667_1001860142 344
252 3300005435 Ga0070714_100208201 Ga0070714_1002082012 344
253 3300005841 Ga0068863_100009027 Ga0068863_1000090272 344
254 3300005842 Ga0068858_100136816 Ga0068858_1001368163 344
255 3300005937 Ga0081455_10154307 Ga0081455_101543072 344
256 3300006038 Ga0075365_10000659 Ga0075365_100006594 344
257 3300006038 Ga0075365_10002646 Ga0075365_100026468 344
258 3300006042 Ga0075368_10030599 Ga0075368_100305992 344
259 3300006048 Ga0075363_100001702 Ga0075363_1000017026 344
260 3300006048 Ga0075363_100029127 Ga0075363_1000291272 344
261 3300006051 Ga0075364_10001283 Ga0075364_1000128311 344
262 3300006178 Ga0075367_10023310 Ga0075367_100233102 344
263 3300006186 Ga0075369_10001022 Ga0075369_100010225 344
264 3300006186 Ga0075369_10065463 Ga0075369_100654632 344
265 3300006353 Ga0075370_10005701 Ga0075370_100057016 344
266 3300006353 Ga0075370_10073271 Ga0075370_100732712 344
267 3300009545 Ga0105237_10021898 Ga0105237_100218983 344
268 3300009553 Ga0105249_10105252 Ga0105249_101052523 344
269 3300010375 Ga0105239_10100856 Ga0105239_101008563 344
270 3300014325 Ga0163163_10047811 Ga0163163_100478113 344
271 3300021384 Ga0213876_10019281 Ga0213876_100192814 344
272 3300025914 Ga0207671_10011881 Ga0207671_100118814 344
273 3300025916 Ga0207663_10062061 Ga0207663_100620611 344
274 3300025929 Ga0207664_10085348 Ga0207664_100853482 344
275 3300025931 Ga0207644_10002286 Ga0207644_1000228613 344
276 3300025981 Ga0207640_10138911 Ga0207640_101389112 344
277 3300025986 Ga0207658_10005374 Ga0207658_100053746 344
278 3300026035 Ga0207703_10112284 Ga0207703_101122842 344
279 3300026088 Ga0207641_10003083 Ga0207641_100030832 344
280 3300028379 Ga0268266_10030514 Ga0268266_100305143 344
281 3300028794 Ga0307515_10059172 Ga0307515_100591725 344
282 3300031911 Ga0307412_10206466 Ga0307412_102064662 344
283 3300039437 Ga0436365_0967944 Ga0436365_0967944_21723_22808 344
284 3300041411 Ga0439466_0029435 Ga0439466_0029435_746_1834 344
285 3300041413 Ga0439465_0005793 Ga0439465_0005793_1251_2339 344
286 3300042004 Ga0439445_0035815 Ga0439445_0035815_14_1102 344
287 3300042438 Ga0439459_0016704 Ga0439459_0016704_108_1193 344
288 3300044658 Ga0466972_0004743 Ga0466972_0004743_322_1407 344
289 3300044684 Ga0466966_0025427 Ga0466966_0025427_1035_2120 344
290 3300044719 Ga0466971_0059298 Ga0466971_0059298_32_1117 344
291 3300044765 Ga0466970_0004702 Ga0466970_0004702_3873_4958 344
292 3300044765 Ga0466970_0034871 Ga0466970_0034871_290_1378 344
293 3300044842 Ga0466957_0038929 Ga0466957_0038929_1035_2120 344
294 3300045049 Ga0466959_0062948 Ga0466959_0062948_444_1532 344
295 3300045976 Ga0466967_0016168 Ga0466967_0016168_2672_3757 344
296 3300045976 Ga0466967_0016363 Ga0466967_0016363_1454_2539 344
297 3300046616 Ga0495668_0029479 Ga0495668_0029479_721_1806 344
298 3300046692 Ga0495671_0055975 Ga0495671_0055975_303_1388 344
299 3300047320 Ga0495672_0093185 Ga0495672_0093185_81_1169 344
300 3300047469 Ga0495673_0000941 Ga0495673_0000941_18935_20020 344
301 3300048903 Ga0496100_0000053 Ga0496100_0000053_9251_10336 344
302 3300048903 Ga0496100_0024885 Ga0496100_0024885_1688_2773 344
303 3300048904 Ga0496101_0000056 Ga0496101_0000056_44517_45602 344
304 3300048904 Ga0496101_0000057 Ga0496101_0000057_18220_19305 344
305 3300048905 Ga0496102_0000177 Ga0496102_0000177_44741_45826 344
306 3300048905 Ga0496102_0025685 Ga0496102_0025685_387_1472 344
307 3300048905 Ga0496102_0059491 Ga0496102_0059491_2194_3282 344
308 3300048906 Ga0496103_0000003 Ga0496103_0000003_40899_41984 344
309 3300048907 Ga0496104_0018629 Ga0496104_0018629_5028_6116 344
310 3300048908 Ga0496105_0016579 Ga0496105_0016579_2801_3889 344
311 3300048910 Ga0496107_0000167 Ga0496107_0000167_23574_24659 344
312 3300048911 Ga0496108_0209616 Ga0496108_0209616_343_1428 344
313 3300048912 Ga0496109_0000144 Ga0496109_0000144_9105_10190 344
314 3300048912 Ga0496109_0157025 Ga0496109_0157025_58_1146 344
315 3300048912 Ga0496109_0197435 Ga0496109_0197435_716_1801 344
316 3300048913 Ga0496110_0043249 Ga0496110_0043249_1735_2820 344
317 3300048914 Ga0496111_0042099 Ga0496111_0042099_1823_2908 344
318 3300048914 Ga0496111_0270507 Ga0496111_0270507_66_1154 344
319 3300048916 Ga0496113_0038302 Ga0496113_0038302_112_1197 344
320 3300048917 Ga0496114_0003438 Ga0496114_0003438_6509_7594 344
321 3300048918 Ga0496115_0021772 Ga0496115_0021772_3722_4807 344
322 3300048919 Ga0496116_0000013 Ga0496116_0000013_562010_563095 344
323 3300048919 Ga0496116_0002742 Ga0496116_0002742_9251_10336 344
324 3300048920 Ga0496117_0000013 Ga0496117_0000013_40899_41984 344
325 3300048921 Ga0496118_0000011 Ga0496118_0000011_562012_563097 344
326 3300048923 Ga0496120_0021133 Ga0496120_0021133_90_1175 344
327 3300048924 Ga0496121_0000060 Ga0496121_0000060_185619_186704 344
328 3300048924 Ga0496121_0000068 Ga0496121_0000068_213285_214370 344
329 3300048925 Ga0496122_0000085 Ga0496122_0000085_100450_101535 344
330 3300048927 Ga0496124_0000065 Ga0496124_0000065_9225_10310 344
331 3300048928 Ga0496125_0000008 Ga0496125_0000008_490308_491393 344
332 3300048929 Ga0496126_0000062 Ga0496126_0000062_213285_214370 344
333 3300048929 Ga0496126_0012696 Ga0496126_0012696_5420_6505 344
334 3300048929 Ga0496126_0037170 Ga0496126_0037170_2100_3185 344
335 3300049569 Ga0501032_0023150 Ga0501032_0023150_1499_2584 344
336 3300049571 Ga0501034_0055411 Ga0501034_0055411_1496_2581 344
337 3300049572 Ga0501036_0154847 Ga0501036_0154847_426_1511 344
338 3300049579 Ga0501043_0053426 Ga0501043_0053426_343_1428 344
339 3300049579 Ga0501043_0152801 Ga0501043_0152801_435_1520 344
340 3300049580 Ga0501046_0003598 Ga0501046_0003598_1714_2799 344
341 3300049580 Ga0501046_0143886 Ga0501046_0143886_466_1551 344
342 3300049581 Ga0501047_0024286 Ga0501047_0024286_1930_3015 344
343 3300049581 Ga0501047_0080758 Ga0501047_0080758_1127_2212 344
344 3300049582 Ga0501048_0020414 Ga0501048_0020414_2033_3118 344
345 3300049583 Ga0501067_0029600 Ga0501067_0029600_1439_2539 344
346 3300049586 Ga0501070_0015717 Ga0501070_0015717_3291_4376 344
347 3300049588 Ga0501072_0159443 Ga0501072_0159443_563_1648 344
348 3300049822 Ga0501035_0001215 Ga0501035_0001215_12587_13672 344
349 3300049822 Ga0501035_0028571 Ga0501035_0028571_2266_3351 344
350 3300049823 Ga0501044_0004709 Ga0501044_0004709_1337_2422 344
351 3300049823 Ga0501044_0007806 Ga0501044_0007806_8945_10030 344
352 3300050490 nmdc:mga03n38_5425_c1 nmdc:mga03n38_5425_c1_1306_2391 344
353 3300050491 nmdc:mga00v17_151559_c1 nmdc:mga00v17_151559_c1_182_1267 344
354 3300050491 nmdc:mga00v17_2428_c1 nmdc:mga00v17_2428_c1_5210_6295 344
355 3300050492 nmdc:mga0yw44_18593_c1 nmdc:mga0yw44_18593_c1_1762_2847 344
356 3300050492 nmdc:mga0yw44_4222_c1 nmdc:mga0yw44_4222_c1_1565_2650 344
357 3300050496 nmdc:mga07m45_105225_c1 nmdc:mga07m45_105225_c1_465_1550 344
358 3300050496 nmdc:mga07m45_6192_c1 nmdc:mga07m45_6192_c1_3373_4458 344
359 3300050496 nmdc:mga07m45_7450_c1 nmdc:mga07m45_7450_c1_1787_2872 344
360 3300050516 nmdc:mga0sz30_88316_c1 nmdc:mga0sz30_88316_c1_201_1286 344
361 3300053087 Ga0500643_001717 Ga0500643_001717_10266_11351 344
362 3300053087 Ga0500643_016514 Ga0500643_016514_1227_2312 344
363 3300053158 Ga0500627_0015515 Ga0500627_0015515_159_1244 344
364 3300061719 Ga0466962_0027202 Ga0466962_0027202_452_1537 344
365 3300031852 Ga0307410_10279282 Ga0307410_102792821 345
366 3300035207 Ga0373942_0024478 Ga0373942_0024478_313_1410 345
367 3300041512 Ga0451853_0541938 Ga0451853_0541938_5920_7008 345
368 3300045976 Ga0466967_0159873 Ga0466967_0159873_303_1400 345
369 3300046514 Ga0495618_0029051 Ga0495618_0029051_711_1796 346
370 3300046516 Ga0495628_0009680 Ga0495628_0009680_1544_2629 346
371 3300048905 Ga0496102_0043506 Ga0496102_0043506_1609_2697 346
372 3300048908 Ga0496105_0004900 Ga0496105_0004900_8417_9505 346
373 3300048918 Ga0496115_0001472 Ga0496115_0001472_9673_10761 346
374 3300053077 Ga0495601_0015329 Ga0495601_0015329_2042_3127 346
375 3300044901 Ga0466960_0001280 Ga0466960_0001280_2698_3843 347
376 3300046462 Ga0495651_0038183 Ga0495651_0038183_2308_3393 347
377 3300046529 Ga0495652_0019766 Ga0495652_0019766_3591_4676 347
378 3300046809 Ga0495600_0007742 Ga0495600_0007742_2794_3879 347
379 3300047317 Ga0495604_0106833 Ga0495604_0106833_432_1517 347
380 3300048911 Ga0496108_0012895 Ga0496108_0012895_728_1813 347
381 3300005548 Ga0070665_100051956 Ga0070665_1000519563 348
382 3300005563 Ga0068855_100022328 Ga0068855_1000223282 348
383 3300009093 Ga0105240_10152936 Ga0105240_101529362 348
384 3300009174 Ga0105241_10000752 Ga0105241_1000075210 348
385 3300009545 Ga0105237_10201774 Ga0105237_102017742 348
386 3300009551 Ga0105238_10110895 Ga0105238_101108952 348
387 3300010375 Ga0105239_10164051 Ga0105239_101640512 348
388 3300025913 Ga0207695_10000994 Ga0207695_1000099429 348
389 3300025914 Ga0207671_10000748 Ga0207671_1000074842 348
390 3300025924 Ga0207694_10058904 Ga0207694_100589042 348
391 3300025949 Ga0207667_10149787 Ga0207667_101497872 348
392 3300026121 Ga0207683_10088104 Ga0207683_100881042 348
393 3300026142 Ga0207698_10073095 Ga0207698_100730952 348
394 3300039062 Ga0400483_012695 Ga0400483_012695_266_1330 348
395 3300044658 Ga0466972_0023072 Ga0466972_0023072_1346_2449 348
396 3300044683 Ga0466965_0039860 Ga0466965_0039860_134_1237 348
397 3300044693 Ga0466961_0100599 Ga0466961_0100599_54_1157 348
398 3300044842 Ga0466957_0049687 Ga0466957_0049687_787_1890 348
399 3300045976 Ga0466967_0075917 Ga0466967_0075917_894_1997 348
400 3300049570 Ga0501033_0185908 Ga0501033_0185908_166_1251 348
401 3300049572 Ga0501036_0318333 Ga0501036_0318333_49_1134 348
402 3300049583 Ga0501067_0008339 Ga0501067_0008339_3183_4268 348
403 3300049590 Ga0501074_0013440 Ga0501074_0013440_3368_4453 348
404 3300049593 Ga0501077_0144259 Ga0501077_0144259_51_1136 348
405 3300049742 Ga0501080_0248399 Ga0501080_0248399_514_1599 348
406 3300060353 Ga0501082_0196789 Ga0501082_0196789_290_1375 348
407 3300005438 Ga0070701_10172094 Ga0070701_101720941 349
408 3300044684 Ga0466966_0088999 Ga0466966_0088999_428_1531 349
409 3300049585 Ga0501069_0006522 Ga0501069_0006522_2956_4041 349
410 iso_pu_bacteria 2897561785 2897563574 350
411 3300044694 Ga0466963_0203533 Ga0466963_0203533_180_1292 351
412 3300044719 Ga0466971_0051425 Ga0466971_0051425_574_1686 351
413 3300044901 Ga0466960_0048628 Ga0466960_0048628_448_1560 351
414 iso_pu_bacteria 2643221561 2643824167 351
415 iso_pu_bacteria 2643221567 2643851580 351
416 iso_pu_bacteria 2643221624 2644137830 351
417 iso_pu_bacteria 2643221696 2644533473 351
418 iso_pu_bacteria 2816332139 2816509790 351
419 iso_pu_bacteria 2866612099 2866613047 351
420 iso_pu_bacteria 2954691527 2954692064 351
421 iso_pu_bacteria 2954701450 2954707131 351
422 iso_pu_bacteria 3006493962 3006494958 351
423 iso_pu_bacteria 8048127548 8048137320 351
424 iso_pu_bacteria 8054609563 8054610431 351
425 iso_pu_bacteria 8057568493 8057568799 351
426 iso_pu_bacteria 2565956761 2566993955 352
427 iso_pu_bacteria 2643221615 2644091577 352
428 iso_pu_bacteria 2643221657 2644321380 352
429 iso_pu_bacteria 2643221715 2644638552 352
430 iso_pu_bacteria 2738541308 2738889160 352
431 iso_pu_bacteria 2738543005 2739202413 352
432 iso_pu_bacteria 2738543011 2739239660 352
433 iso_pu_bacteria 2738543034 2739362014 352
434 iso_pu_bacteria 2738543034 2739363365 352
435 iso_pu_bacteria 2808606439 2809193801 352
436 iso_pu_bacteria 2842888712 2842890370 352
437 iso_pu_bacteria 2887443736 2887446204 352
438 iso_pu_bacteria 2889300758 2889304663 352
439 iso_pu_bacteria 2899370129 2899371586 352
440 iso_pu_bacteria 2902810491 2902812540 352
441 iso_pu_bacteria 2904535858 2904537003 352
442 iso_pu_bacteria 2904765812 2904770244 352
443 iso_pu_bacteria 2908811453 2908815613 352
444 iso_pu_bacteria 2908811453 2908816356 352
445 iso_pu_bacteria 2908811453 2908816433 352
446 iso_pu_bacteria 2919420072 2919421633 352
447 iso_pu_bacteria 2919432681 2919434809 352
448 iso_pu_bacteria 2922554459 2922559624 352
449 iso_pu_bacteria 2928142448 2928143374 352
450 iso_pu_bacteria 2932398195 2932398871 352
451 iso_pu_bacteria 2939582691 2939584432 352
452 iso_pu_bacteria 2939743619 2939744951 352
453 iso_pu_bacteria 2956939328 2956941773 352
454 iso_pu_bacteria 3001119090 3001119133 352
455 3300005334 Ga0068869_100052604 Ga0068869_1000526042 353
456 3300005336 Ga0070680_100094379 Ga0070680_1000943792 353
457 3300005339 Ga0070660_100223257 Ga0070660_1002232572 353
458 3300005364 Ga0070673_100218806 Ga0070673_1002188062 353
459 3300005458 Ga0070681_10069638 Ga0070681_100696382 353
460 3300005459 Ga0068867_100140733 Ga0068867_1001407332 353
461 3300005530 Ga0070679_100017913 Ga0070679_1000179136 353
462 3300005719 Ga0068861_100044974 Ga0068861_1000449743 353
463 3300005834 Ga0068851_10068449 Ga0068851_100684492 353
464 3300005843 Ga0068860_100298525 Ga0068860_1002985252 353
465 3300005981 Ga0081538_10078148 Ga0081538_100781482 353
466 3300009988 Ga0105035_101219 Ga0105035_1012192 353
467 3300013296 Ga0157374_10155123 Ga0157374_101551233 353
468 3300013306 Ga0163162_10138478 Ga0163162_101384781 353
469 3300017792 Ga0163161_10046687 Ga0163161_100466872 353
470 3300025901 Ga0207688_10010961 Ga0207688_100109616 353
471 3300025901 Ga0207688_10035646 Ga0207688_100356463 353
472 3300025907 Ga0207645_10009258 Ga0207645_100092585 353
473 3300025909 Ga0207705_10060292 Ga0207705_100602924 353
474 3300025917 Ga0207660_10071919 Ga0207660_100719192 353
475 3300025919 Ga0207657_10178659 Ga0207657_101786591 353
476 3300025931 Ga0207644_10097546 Ga0207644_100975463 353
477 3300025937 Ga0207669_10016078 Ga0207669_100160785 353
478 3300025940 Ga0207691_10037078 Ga0207691_100370786 353
479 3300025941 Ga0207711_10325974 Ga0207711_103259742 353
480 3300025942 Ga0207689_10007513 Ga0207689_100075138 353
481 3300026067 Ga0207678_10048580 Ga0207678_100485805 353
482 3300026089 Ga0207648_10146157 Ga0207648_101461572 353
483 3300026116 Ga0207674_10111368 Ga0207674_101113682 353
484 3300026118 Ga0207675_100117645 Ga0207675_1001176451 353
485 3300026121 Ga0207683_10092432 Ga0207683_100924324 353
486 3300026142 Ga0207698_10017391 Ga0207698_100173916 353
487 3300031616 Ga0307508_10021893 Ga0307508_100218933 353
488 3300031824 Ga0307413_10000126 Ga0307413_1000012613 353
489 3300032002 Ga0307416_100148697 Ga0307416_1001486972 353
490 3300037853 Ga0436364_1519819 Ga0436364_1519819_11494_12639 353
491 3300038735 Ga0400485_18483 Ga0400485_18483_1543_2628 353
492 3300044693 Ga0466961_0038074 Ga0466961_0038074_591_1676 353
493 3300044694 Ga0466963_0062109 Ga0466963_0062109_318_1403 353
494 3300044719 Ga0466971_0014851 Ga0466971_0014851_821_1906 353
495 3300044765 Ga0466970_0028789 Ga0466970_0028789_982_2082 353
496 3300044901 Ga0466960_0007000 Ga0466960_0007000_85_1167 353
497 3300045049 Ga0466959_0036002 Ga0466959_0036002_2068_3153 353
498 3300046454 Ga0495592_0006810 Ga0495592_0006810_593_1678 353
499 3300046455 Ga0495603_0012208 Ga0495603_0012208_1224_2309 353
500 3300046459 Ga0495629_0004434 Ga0495629_0004434_5149_6234 353
501 3300046462 Ga0495651_0004389 Ga0495651_0004389_4901_5986 353
502 3300046463 Ga0495653_0001578 Ga0495653_0001578_15601_16686 353
503 3300046472 Ga0495580_0021072 Ga0495580_0021072_58_1143 353
504 3300046476 Ga0495662_0000347 Ga0495662_0000347_16438_17523 353
505 3300046477 Ga0495664_0000303 Ga0495664_0000303_5950_7035 353
506 3300046492 Ga0495585_0047115 Ga0495585_0047115_315_1400 353
507 3300046499 Ga0495594_0002274 Ga0495594_0002274_3022_4107 353
508 3300046511 Ga0495608_0000841 Ga0495608_0000841_1804_2889 353
509 3300046515 Ga0495620_0025476 Ga0495620_0025476_346_1431 353
510 3300046516 Ga0495628_0001628 Ga0495628_0001628_9475_10560 353
511 3300046517 Ga0495630_0025647 Ga0495630_0025647_2224_3309 353
512 3300046526 Ga0495666_0001587 Ga0495666_0001587_1714_2799 353
513 3300046526 Ga0495666_0002305 Ga0495666_0002305_5190_6275 353
514 3300046529 Ga0495652_0024632 Ga0495652_0024632_1238_2323 353
515 3300046535 Ga0495586_0006495 Ga0495586_0006495_2800_3885 353
516 3300046536 Ga0495587_0046167 Ga0495587_0046167_1345_2430 353
517 3300046543 Ga0495645_0003244 Ga0495645_0003244_3842_4927 353
518 3300046557 Ga0495622_0001218 Ga0495622_0001218_9186_10271 353
519 3300046559 Ga0495667_0009494 Ga0495667_0009494_3002_4087 353
520 3300046642 Ga0495634_0090889 Ga0495634_0090889_503_1588 353
521 3300046663 Ga0495635_0007609 Ga0495635_0007609_5128_6213 353
522 3300046674 Ga0495588_0014711 Ga0495588_0014711_868_2022 353
523 3300046678 Ga0495599_0009966 Ga0495599_0009966_1110_2195 353
524 3300046679 Ga0495623_0013299 Ga0495623_0013299_3623_4708 353
525 3300046680 Ga0495646_0007078 Ga0495646_0007078_3840_4925 353
526 3300046689 Ga0495613_0001143 Ga0495613_0001143_13357_14442 353
527 3300046690 Ga0495624_0002611 Ga0495624_0002611_3132_4217 353
528 3300046794 Ga0495589_0011588 Ga0495589_0011588_418_1503 353
529 3300046809 Ga0495600_0091640 Ga0495600_0091640_503_1588 353
530 3300046810 Ga0495660_0114230 Ga0495660_0114230_32_1117 353
531 3300047317 Ga0495604_0003188 Ga0495604_0003188_3842_4927 353
532 3300047319 Ga0495674_0005877 Ga0495674_0005877_8809_9894 353
533 3300047321 Ga0495676_0011711 Ga0495676_0011711_5474_6559 353
534 3300047444 Ga0495675_0009417 Ga0495675_0009417_1370_2455 353
535 3300048089 Ga0495614_0016363 Ga0495614_0016363_1576_2661 353
536 3300048089 Ga0495614_0056341 Ga0495614_0056341_351_1475 353
537 3300048911 Ga0496108_0096397 Ga0496108_0096397_124_1209 353
538 3300048913 Ga0496110_0159956 Ga0496110_0159956_41_1138 353
539 3300053077 Ga0495601_0006119 Ga0495601_0006119_3112_4197 353
540 3300053078 Ga0495612_0069122 Ga0495612_0069122_299_1384 353
541 3300001977 JGI24746J21847_1002752 JGI24746J21847_10027522 354
542 3300002077 JGI24744J21845_10002772 JGI24744J21845_100027722 354
543 3300005937 Ga0081455_10000123 Ga0081455_100001239 354
544 3300006038 Ga0075365_10008080 Ga0075365_100080804 354
545 3300006844 Ga0075428_100016876 Ga0075428_1000168769 354
546 3300009148 Ga0105243_10000943 Ga0105243_1000094316 354
547 3300025935 Ga0207709_10001543 Ga0207709_1000154312 354
548 3300026067 Ga0207678_10200312 Ga0207678_102003122 354
549 3300031838 Ga0307518_10005276 Ga0307518_100052762 354
550 3300044684 Ga0466966_0014101 Ga0466966_0014101_3451_4539 354
551 3300046473 Ga0495582_0106358 Ga0495582_0106358_42_1136 354
552 3300046616 Ga0495668_0000161 Ga0495668_0000161_35642_36730 354
553 3300048928 Ga0496125_0006840 Ga0496125_0006840_7625_8713 354
554 3300049569 Ga0501032_0038617 Ga0501032_0038617_1998_3089 354
555 3300049571 Ga0501034_0002539 Ga0501034_0002539_9908_10999 354
556 3300049573 Ga0501037_0006561 Ga0501037_0006561_4021_5112 354
557 3300049574 Ga0501038_0023272 Ga0501038_0023272_4310_5401 354
558 3300049575 Ga0501039_0004016 Ga0501039_0004016_1089_2180 354
559 3300049579 Ga0501043_0002178 Ga0501043_0002178_11031_12122 354
560 3300049586 Ga0501070_0000482 Ga0501070_0000482_19174_20265 354
561 3300049589 Ga0501073_0023699 Ga0501073_0023699_2482_3573 354
562 3300049823 Ga0501044_0015695 Ga0501044_0015695_3871_4962 354
563 3300061719 Ga0466962_0061638 Ga0466962_0061638_685_1773 354
564 3300031548 Ga0307408_100075340 Ga0307408_1000753403 355
565 3300032002 Ga0307416_100346188 Ga0307416_1003461882 355
566 iso_pu_bacteria 2643221641 2644229232 356
567 iso_pu_bacteria 2739367898 2740167168 356
568 iso_pu_bacteria 2855386786 2855390289 356
569 3300000549 LJQas_1001482 LJQas_10014823 360
570 3300005435 Ga0070714_100003328 Ga0070714_10000332810 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

215

348

0.94

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

56

178

0.93

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

246

384

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tnx-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria 0.9289 2 360
1ju9-assembly1.cif.gz_B horse liver alcohol dehydrogenase val292ser mutant 0.9279 2 360
1agn-assembly1.cif.gz_A x-ray structure of human sigma alcohol dehydrogenase 0.9253 2 360
1htb-assembly1.cif.gz_B crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c 0.925 2 360
1a72-assembly1.cif.gz_A-2 an active-site double mutant (phe93->trp, val203->ala) of horse liver alcohol dehydrogenase in complex with the isosteric nad analog cpad 0.9242 2 360
ID Description Score Start End Superfamily
af_O53533_167_304_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9748 170 303 3.90.180.10
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9428 178 296 3.40.50.720
5tnxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9409 170 302 3.40.50.720
af_O53533_167_304_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9401 170 303 3.90.180.10
af_A1L4Y2_14_383_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9326 8 354 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A4Q3IJT7-F1-model_v4 deleted 0.9853 144 360
AF-A0A6B3HDC4-F1-model_v4 Zinc-binding dehydrogenase 0.9803 183 330
AF-Q9ZNB1-F1-model_v4 Alcohol dehydrogenase 0.974 2 252 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A0Q9N0K0-F1-model_v4 S-(Hydroxymethyl)mycothiol dehydrogenase 0.9675 2 360 GO:0008270
GO:0016491
AF-A0A0Q9N0K0-F1-model_v4 S-(Hydroxymethyl)mycothiol dehydrogenase 0.9622 2 360 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map