F464815
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 337 | 523 | 350 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10152936|Ga0105240_101529362 |
| Length | 385 |
| Sequence | VWRGSRVIDQSISSLTITAILSGVTRRSAMQQVKAVIARAKGAPVEIVTINVPEPGPGEAVVRVQACRVCHTDLHYREGGINDEFPFLLGHEASGIVEAVGPGVTEVEPGDFVILNWRAVCGQCRACKRGEPWYCFATHNAKQKMTLEDGTELSPALGIGAFAEKTLVAAGQCTKVDPSARPAAVGLLGCGVMAGIGAAVNTGGVTRGKSVAGXXVAAIAGSALAGANPIIAVDIDAKKLATATRLGATHTVDSSSADPVAAIQELTGGFGADVVIEAVGRPDTWKQAFYARDLAGTVVLVGVPTPEMKVPDLPLIDVFGRGGSLKSSWYGDCLPSRDFPMLVDLYRRGKLDLDAFVSEEIALTDIEAAFERMHRGEVLRSVVIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 2 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 3 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 4 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 5 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 6 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 7 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 8 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 9 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 10 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 11 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 12 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 13 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 14 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 15 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 16 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 17 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 18 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 19 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 20 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 21 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 22 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 23 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 24 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 25 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 26 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 27 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 28 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 29 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 30 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 31 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 32 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 33 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 34 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 35 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 36 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 37 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 38 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 39 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 40 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 41 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 42 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 43 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 44 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 45 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 46 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 173 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 180 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 183 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 184 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 185 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 190 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 191 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 192 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 195 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 269 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 270 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 271 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 272 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 310 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 323 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 325 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 326 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 327 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 328 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 335 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 336 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 337 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.4 |
| Metatranscriptomes | 0.35 |
| Isolates | 8.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.77 |
| Nodule | 0.18 |
| Rhizoplane | 9.47 |
| Rhizosphere | 71.05 |
| Stem | 0 |
| Stem Tuber | 0.18 |
| Unclassified | 10.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001482 | 3300000549 | Bacteria | 3496 |
| 2 | JGI24746J21847_1002752 | 3300001977 | Bacteria | 2771 |
| 3 | JGI24739J22299_10032835 | 3300001989 | Bacteria | 1782 |
| 4 | JGI24744J21845_10002772 | 3300002077 | Bacteria | 3579 |
| 5 | JGI24751J29686_10005886 | 3300002459 | Bacteria | 2500 |
| 6 | Ga0055540_1009061 | 3300003792 | Bacteria | 3495 |
| 7 | Ga0070658_10205050 | 3300005327 | Bacteria | 1665 |
| 8 | Ga0070683_100050182 | 3300005329 | Bacteria | 3861 |
| 9 | Ga0068869_100052604 | 3300005334 | Bacteria | 2957 |
| 10 | Ga0070666_10073811 | 3300005335 | Bacteria | 2324 |
| 11 | Ga0070680_100094379 | 3300005336 | Bacteria | 2480 |
| 12 | Ga0070660_100223257 | 3300005339 | Bacteria | 1531 |
| 13 | Ga0070661_100108340 | 3300005344 | Bacteria | 2073 |
| 14 | Ga0070668_100155585 | 3300005347 | Bacteria | 1852 |
| 15 | Ga0070671_100005606 | 3300005355 | Bacteria | 9996 |
| 16 | Ga0070674_100137104 | 3300005356 | Bacteria | 1832 |
| 17 | Ga0070673_100218806 | 3300005364 | Bacteria | 1647 |
| 18 | Ga0070667_100002627 | 3300005367 | Bacteria | 15564 |
| 19 | Ga0070667_100186014 | 3300005367 | Bacteria | 1838 |
| 20 | Ga0070714_100003328 | 3300005435 | Bacteria | 11980 |
| 21 | Ga0070714_100208201 | 3300005435 | Bacteria | 1792 |
| 22 | Ga0070701_10172094 | 3300005438 | Bacteria | 1262 |
| 23 | Ga0070681_10069638 | 3300005458 | Bacteria | 3484 |
| 24 | Ga0068867_100140733 | 3300005459 | Bacteria | 1885 |
| 25 | Ga0070679_100013856 | 3300005530 | Bacteria | 7726 |
| 26 | Ga0070679_100017913 | 3300005530 | Bacteria | 6861 |
| 27 | Ga0070679_100104164 | 3300005530 | Bacteria | 2824 |
| 28 | Ga0070684_100022378 | 3300005535 | Bacteria | 5271 |
| 29 | Ga0070684_100243353 | 3300005535 | Bacteria | 1644 |
| 30 | Ga0070684_100300113 | 3300005535 | Bacteria | 1474 |
| 31 | Ga0070665_100051956 | 3300005548 | Bacteria | 4111 |
| 32 | Ga0068855_100022328 | 3300005563 | Bacteria | 7582 |
| 33 | Ga0068857_100070152 | 3300005577 | Bacteria | 3121 |
| 34 | Ga0068859_100003059 | 3300005617 | Bacteria | 16971 |
| 35 | Ga0068861_100044974 | 3300005719 | Bacteria | 3322 |
| 36 | Ga0068851_10068449 | 3300005834 | Bacteria | 1832 |
| 37 | Ga0068863_100009027 | 3300005841 | Bacteria | 9737 |
| 38 | Ga0068858_100136816 | 3300005842 | Bacteria | 2299 |
| 39 | Ga0068860_100003236 | 3300005843 | Bacteria | 16797 |
| 40 | Ga0068860_100298525 | 3300005843 | Bacteria | 1578 |
| 41 | Ga0081455_10000123 | 3300005937 | Bacteria | 89254 |
| 42 | Ga0081455_10002627 | 3300005937 | Bacteria | 21291 |
| 43 | Ga0081455_10154307 | 3300005937 | Bacteria | 1767 |
| 44 | Ga0081538_10000729 | 3300005981 | Bacteria | 35897 |
| 45 | Ga0081538_10064579 | 3300005981 | Bacteria | 2069 |
| 46 | Ga0081538_10078148 | 3300005981 | Bacteria | 1778 |
| 47 | Ga0075365_10000659 | 3300006038 | Bacteria | 13789 |
| 48 | Ga0075365_10001308 | 3300006038 | Bacteria | 11113 |
| 49 | Ga0075365_10002646 | 3300006038 | Bacteria | 8887 |
| 50 | Ga0075365_10008080 | 3300006038 | Bacteria | 5942 |
| 51 | Ga0075365_10010956 | 3300006038 | Bacteria | 5311 |
| 52 | Ga0075368_10030599 | 3300006042 | Bacteria | 2085 |
| 53 | Ga0075363_100001702 | 3300006048 | Bacteria | 8542 |
| 54 | Ga0075363_100029127 | 3300006048 | Bacteria | 2847 |
| 55 | Ga0075364_10001283 | 3300006051 | Bacteria | 13531 |
| 56 | Ga0075364_10056460 | 3300006051 | Bacteria | 2571 |
| 57 | Ga0075367_10023310 | 3300006178 | Bacteria | 3482 |
| 58 | Ga0075369_10001022 | 3300006186 | Bacteria | 9338 |
| 59 | Ga0075369_10012010 | 3300006186 | Bacteria | 3416 |
| 60 | Ga0075369_10055197 | 3300006186 | Bacteria | 1726 |
| 61 | Ga0075369_10065463 | 3300006186 | Bacteria | 1593 |
| 62 | Ga0075370_10005701 | 3300006353 | Bacteria | 6213 |
| 63 | Ga0075370_10073271 | 3300006353 | Bacteria | 1961 |
| 64 | Ga0068871_100170732 | 3300006358 | Bacteria | 1864 |
| 65 | Ga0075428_100001173 | 3300006844 | Bacteria | 28048 |
| 66 | Ga0075428_100016876 | 3300006844 | Bacteria | 8063 |
| 67 | Ga0075430_100001837 | 3300006846 | Bacteria | 17380 |
| 68 | Ga0075431_100000320 | 3300006847 | Bacteria | 37830 |
| 69 | Ga0075431_100002225 | 3300006847 | Bacteria | 18576 |
| 70 | Ga0075429_100015793 | 3300006880 | Bacteria | 6539 |
| 71 | Ga0097620_100003059 | 3300006931 | Bacteria | 16971 |
| 72 | Ga0105240_10152936 | 3300009093 | Bacteria | 2746 |
| 73 | Ga0111539_10015766 | 3300009094 | Bacteria | 9388 |
| 74 | Ga0105245_10082246 | 3300009098 | Bacteria | 2946 |
| 75 | Ga0105247_10002270 | 3300009101 | Bacteria | 13205 |
| 76 | Ga0114129_10008242 | 3300009147 | Bacteria | 14861 |
| 77 | Ga0105243_10000943 | 3300009148 | Bacteria | 27256 |
| 78 | Ga0105243_10218493 | 3300009148 | Bacteria | 1683 |
| 79 | Ga0105243_10219185 | 3300009148 | Bacteria | 1681 |
| 80 | Ga0105241_10000752 | 3300009174 | Bacteria | 24686 |
| 81 | Ga0105248_10058454 | 3300009177 | Bacteria | 4331 |
| 82 | Ga0105237_10021898 | 3300009545 | Bacteria | 6564 |
| 83 | Ga0105237_10201774 | 3300009545 | Bacteria | 1989 |
| 84 | Ga0105238_10110895 | 3300009551 | Bacteria | 2724 |
| 85 | Ga0105249_10105252 | 3300009553 | Bacteria | 2660 |
| 86 | Ga0105035_101219 | 3300009988 | Bacteria | 1739 |
| 87 | Ga0105239_10028303 | 3300010375 | Bacteria | 6165 |
| 88 | Ga0105239_10100856 | 3300010375 | Bacteria | 3194 |
| 89 | Ga0105239_10164051 | 3300010375 | Bacteria | 2484 |
| 90 | Ga0105246_10113365 | 3300011119 | Bacteria | 1996 |
| 91 | Ga0157374_10155123 | 3300013296 | Bacteria | 2228 |
| 92 | Ga0163162_10138478 | 3300013306 | Bacteria | 2545 |
| 93 | Ga0157375_10277237 | 3300013308 | Bacteria | 1839 |
| 94 | Ga0163163_10047811 | 3300014325 | Bacteria | 4205 |
| 95 | Ga0163163_10196109 | 3300014325 | Bacteria | 2067 |
| 96 | Ga0157380_10165405 | 3300014326 | Bacteria | 1927 |
| 97 | Ga0157380_10408624 | 3300014326 | Bacteria | 1290 |
| 98 | Ga0163161_10046687 | 3300017792 | Bacteria | 3125 |
| 99 | Ga0206354_10337988 | 3300020081 | Bacteria | 1946 |
| 100 | Ga0206353_10313555 | 3300020082 | Bacteria | 6094 |
| 101 | Ga0213876_10019281 | 3300021384 | Bacteria | 3602 |
| 102 | Ga0209025_1033669 | 3300025294 | Bacteria | 2361 |
| 103 | Ga0209051_1000959 | 3300025303 | Bacteria | 28324 |
| 104 | Ga0209051_1002561 | 3300025303 | Bacteria | 12838 |
| 105 | Ga0209051_1003092 | 3300025303 | Bacteria | 11227 |
| 106 | Ga0207710_10003350 | 3300025900 | Bacteria | 7162 |
| 107 | Ga0207688_10010961 | 3300025901 | Bacteria | 4933 |
| 108 | Ga0207688_10035646 | 3300025901 | Bacteria | 2757 |
| 109 | Ga0207647_10022335 | 3300025904 | Bacteria | 4204 |
| 110 | Ga0207645_10009258 | 3300025907 | Bacteria | 6823 |
| 111 | Ga0207705_10060292 | 3300025909 | Bacteria | 2740 |
| 112 | Ga0207695_10000994 | 3300025913 | Bacteria | 50163 |
| 113 | Ga0207671_10000748 | 3300025914 | Bacteria | 41241 |
| 114 | Ga0207671_10011881 | 3300025914 | Bacteria | 7044 |
| 115 | Ga0207671_10183533 | 3300025914 | Bacteria | 1629 |
| 116 | Ga0207663_10062061 | 3300025916 | Bacteria | 2374 |
| 117 | Ga0207660_10071919 | 3300025917 | Bacteria | 2518 |
| 118 | Ga0207657_10055365 | 3300025919 | Bacteria | 3426 |
| 119 | Ga0207657_10178659 | 3300025919 | Bacteria | 1716 |
| 120 | Ga0207649_10060025 | 3300025920 | Bacteria | 2388 |
| 121 | Ga0207652_10055313 | 3300025921 | Bacteria | 3412 |
| 122 | Ga0207652_10161373 | 3300025921 | Bacteria | 2010 |
| 123 | Ga0207694_10058904 | 3300025924 | Bacteria | 2987 |
| 124 | Ga0207650_10263868 | 3300025925 | Bacteria | 1398 |
| 125 | Ga0207664_10085348 | 3300025929 | Bacteria | 2576 |
| 126 | Ga0207644_10002286 | 3300025931 | Bacteria | 12435 |
| 127 | Ga0207644_10097546 | 3300025931 | Bacteria | 2202 |
| 128 | Ga0207690_10007171 | 3300025932 | Bacteria | 6622 |
| 129 | Ga0207686_10193755 | 3300025934 | Bacteria | 1451 |
| 130 | Ga0207709_10001543 | 3300025935 | Bacteria | 15820 |
| 131 | Ga0207709_10320099 | 3300025935 | Bacteria | 1160 |
| 132 | Ga0207669_10016078 | 3300025937 | Bacteria | 3792 |
| 133 | Ga0207669_10096564 | 3300025937 | Bacteria | 1940 |
| 134 | Ga0207691_10037078 | 3300025940 | Bacteria | 4515 |
| 135 | Ga0207711_10016788 | 3300025941 | Bacteria | 6080 |
| 136 | Ga0207711_10325974 | 3300025941 | Bacteria | 1420 |
| 137 | Ga0207689_10007513 | 3300025942 | Bacteria | 9557 |
| 138 | Ga0207661_10021401 | 3300025944 | Bacteria | 4844 |
| 139 | Ga0207661_10156891 | 3300025944 | Bacteria | 1972 |
| 140 | Ga0207667_10149787 | 3300025949 | Bacteria | 2402 |
| 141 | Ga0207668_10143529 | 3300025972 | Bacteria | 1839 |
| 142 | Ga0207640_10138911 | 3300025981 | Bacteria | 1768 |
| 143 | Ga0207658_10005374 | 3300025986 | Bacteria | 8795 |
| 144 | Ga0207703_10112284 | 3300026035 | Bacteria | 2328 |
| 145 | Ga0207703_10181347 | 3300026035 | Bacteria | 1858 |
| 146 | Ga0207639_10039169 | 3300026041 | Bacteria | 3530 |
| 147 | Ga0207678_10048580 | 3300026067 | Bacteria | 3667 |
| 148 | Ga0207678_10200312 | 3300026067 | Bacteria | 1707 |
| 149 | Ga0207641_10003083 | 3300026088 | Bacteria | 15021 |
| 150 | Ga0207648_10146157 | 3300026089 | Bacteria | 2085 |
| 151 | Ga0207674_10066814 | 3300026116 | Bacteria | 3621 |
| 152 | Ga0207674_10111368 | 3300026116 | Bacteria | 2711 |
| 153 | Ga0207675_100117645 | 3300026118 | Bacteria | 2513 |
| 154 | Ga0207683_10069615 | 3300026121 | Bacteria | 3108 |
| 155 | Ga0207683_10088104 | 3300026121 | Bacteria | 2761 |
| 156 | Ga0207683_10092432 | 3300026121 | Bacteria | 2696 |
| 157 | Ga0207698_10017391 | 3300026142 | Bacteria | 4876 |
| 158 | Ga0207698_10073095 | 3300026142 | Bacteria | 2729 |
| 159 | Ga0207698_10099075 | 3300026142 | Bacteria | 2410 |
| 160 | Ga0207428_10013908 | 3300027907 | Bacteria | 7009 |
| 161 | Ga0268266_10030514 | 3300028379 | Bacteria | 4580 |
| 162 | Ga0268264_10000716 | 3300028381 | Bacteria | 38128 |
| 163 | Ga0268264_10187928 | 3300028381 | Bacteria | 1881 |
| 164 | Ga0307515_10059172 | 3300028794 | Bacteria | 5497 |
| 165 | Ga0265338_10031430 | 3300028800 | Bacteria | 5206 |
| 166 | Ga0265325_10001703 | 3300031241 | Bacteria | 15285 |
| 167 | Ga0265340_10000864 | 3300031247 | Bacteria | 17200 |
| 168 | Ga0265340_10002267 | 3300031247 | Bacteria | 10990 |
| 169 | Ga0265339_10004725 | 3300031249 | Bacteria | 9230 |
| 170 | Ga0265316_10035911 | 3300031344 | Bacteria | 4011 |
| 171 | Ga0307513_10004144 | 3300031456 | Bacteria | 19417 |
| 172 | Ga0307513_10021746 | 3300031456 | Bacteria | 7567 |
| 173 | Ga0307408_100075340 | 3300031548 | Bacteria | 2507 |
| 174 | Ga0307508_10021893 | 3300031616 | Bacteria | 5816 |
| 175 | Ga0265314_10010299 | 3300031711 | Bacteria | 7810 |
| 176 | Ga0265342_10053228 | 3300031712 | Bacteria | 2410 |
| 177 | Ga0307413_10000126 | 3300031824 | Bacteria | 19849 |
| 178 | Ga0307518_10005276 | 3300031838 | Bacteria | 9234 |
| 179 | Ga0307410_10014641 | 3300031852 | Bacteria | 4623 |
| 180 | Ga0307410_10279282 | 3300031852 | Bacteria | 1310 |
| 181 | Ga0307412_10206466 | 3300031911 | Bacteria | 1496 |
| 182 | Ga0307409_100009467 | 3300031995 | Bacteria | 5987 |
| 183 | Ga0307416_100148697 | 3300032002 | Bacteria | 2144 |
| 184 | Ga0307416_100346188 | 3300032002 | Bacteria | 1502 |
| 185 | Ga0307415_100048596 | 3300032126 | Bacteria | 2864 |
| 186 | Ga0307415_100068322 | 3300032126 | Bacteria | 2487 |
| 187 | Ga0307507_10062572 | 3300033179 | Bacteria | 3455 |
| 188 | Ga0373942_0024478 | 3300035207 | Bacteria | 1548 |
| 189 | Ga0373937_0502016 | 3300036401 | Bacteria | 1152 |
| 190 | Ga0395900_0008055 | 3300037418 | Bacteria | 10847 |
| 191 | Ga0395900_0508515 | 3300037418 | Bacteria | 1154 |
| 192 | Ga0395898_0129853 | 3300037466 | Bacteria | 2414 |
| 193 | Ga0436364_1519819 | 3300037853 | Bacteria | 16812 |
| 194 | Ga0395901_0020711 | 3300038443 | Bacteria | 6732 |
| 195 | Ga0395901_0084502 | 3300038443 | Bacteria | 3317 |
| 196 | Ga0400485_18483 | 3300038735 | Bacteria | 4148 |
| 197 | Ga0400483_012695 | 3300039062 | Bacteria | 10466 |
| 198 | Ga0436365_0967944 | 3300039437 | Bacteria | 29438 |
| 199 | Ga0439436_0010993 | 3300041404 | Bacteria | 2753 |
| 200 | Ga0439466_0008352 | 3300041411 | Bacteria | 3903 |
| 201 | Ga0439466_0017501 | 3300041411 | Bacteria | 2582 |
| 202 | Ga0439466_0029435 | 3300041411 | Bacteria | 1889 |
| 203 | Ga0439465_0005793 | 3300041413 | Bacteria | 3933 |
| 204 | Ga0439465_0009387 | 3300041413 | Bacteria | 3081 |
| 205 | Ga0439465_0013447 | 3300041413 | Bacteria | 2551 |
| 206 | Ga0451797_0406099 | 3300041453 | Bacteria | 1641 |
| 207 | Ga0451795_1026876 | 3300041456 | Bacteria | 2445 |
| 208 | Ga0451833_0141132 | 3300041491 | Bacteria | 2314 |
| 209 | Ga0451853_0541938 | 3300041512 | Bacteria | 7574 |
| 210 | Ga0439431_0001900 | 3300041997 | Bacteria | 4631 |
| 211 | Ga0439431_0013019 | 3300041997 | Bacteria | 1916 |
| 212 | Ga0439445_0035815 | 3300042004 | Bacteria | 1304 |
| 213 | Ga0450907_008529 | 3300042146 | Bacteria | 1700 |
| 214 | Ga0439459_0016704 | 3300042438 | Bacteria | 1359 |
| 215 | Ga0466969_0000861 | 3300044656 | Bacteria | 16459 |
| 216 | Ga0466972_0004743 | 3300044658 | Bacteria | 6806 |
| 217 | Ga0466972_0021125 | 3300044658 | Bacteria | 3249 |
| 218 | Ga0466972_0023072 | 3300044658 | Bacteria | 3097 |
| 219 | Ga0466972_0023900 | 3300044658 | Bacteria | 3037 |
| 220 | Ga0466965_0003350 | 3300044683 | Bacteria | 7023 |
| 221 | Ga0466965_0006758 | 3300044683 | Bacteria | 5234 |
| 222 | Ga0466965_0039860 | 3300044683 | Bacteria | 2310 |
| 223 | Ga0466965_0042330 | 3300044683 | Bacteria | 2246 |
| 224 | Ga0466966_0007637 | 3300044684 | Bacteria | 7166 |
| 225 | Ga0466966_0014101 | 3300044684 | Bacteria | 5291 |
| 226 | Ga0466966_0025427 | 3300044684 | Bacteria | 3867 |
| 227 | Ga0466966_0088999 | 3300044684 | Bacteria | 1918 |
| 228 | Ga0466966_0137619 | 3300044684 | Bacteria | 1493 |
| 229 | Ga0466961_0001501 | 3300044693 | Bacteria | 14476 |
| 230 | Ga0466961_0038074 | 3300044693 | Bacteria | 3085 |
| 231 | Ga0466961_0044756 | 3300044693 | Bacteria | 2832 |
| 232 | Ga0466961_0100599 | 3300044693 | Bacteria | 1821 |
| 233 | Ga0466961_0222484 | 3300044693 | Bacteria | 1163 |
| 234 | Ga0466963_0062109 | 3300044694 | Bacteria | 2499 |
| 235 | Ga0466963_0203533 | 3300044694 | Bacteria | 1385 |
| 236 | Ga0466971_0001550 | 3300044719 | Bacteria | 9689 |
| 237 | Ga0466971_0014851 | 3300044719 | Bacteria | 3427 |
| 238 | Ga0466971_0051425 | 3300044719 | Bacteria | 1855 |
| 239 | Ga0466971_0059298 | 3300044719 | Bacteria | 1728 |
| 240 | Ga0466968_0067733 | 3300044735 | Bacteria | 1549 |
| 241 | Ga0466970_0004702 | 3300044765 | Bacteria | 6743 |
| 242 | Ga0466970_0028789 | 3300044765 | Bacteria | 2921 |
| 243 | Ga0466970_0034871 | 3300044765 | Bacteria | 2665 |
| 244 | Ga0466970_0159862 | 3300044765 | Bacteria | 1246 |
| 245 | Ga0466957_0034514 | 3300044842 | Bacteria | 3034 |
| 246 | Ga0466957_0038929 | 3300044842 | Bacteria | 2867 |
| 247 | Ga0466957_0049687 | 3300044842 | Bacteria | 2550 |
| 248 | Ga0466960_0001280 | 3300044901 | Bacteria | 9119 |
| 249 | Ga0466960_0001306 | 3300044901 | Bacteria | 9037 |
| 250 | Ga0466960_0007000 | 3300044901 | Bacteria | 4555 |
| 251 | Ga0466960_0048628 | 3300044901 | Bacteria | 2038 |
| 252 | Ga0466959_0000764 | 3300045049 | Bacteria | 18820 |
| 253 | Ga0466959_0036002 | 3300045049 | Bacteria | 3657 |
| 254 | Ga0466959_0062948 | 3300045049 | Bacteria | 2695 |
| 255 | Ga0466959_0108013 | 3300045049 | Bacteria | 1988 |
| 256 | Ga0466958_0022989 | 3300045836 | Bacteria | 3656 |
| 257 | Ga0466958_0024486 | 3300045836 | Bacteria | 3552 |
| 258 | Ga0466967_0016168 | 3300045976 | Bacteria | 5874 |
| 259 | Ga0466967_0016363 | 3300045976 | Bacteria | 5847 |
| 260 | Ga0466967_0075917 | 3300045976 | Bacteria | 3021 |
| 261 | Ga0466967_0159873 | 3300045976 | Bacteria | 2114 |
| 262 | Ga0466967_0258817 | 3300045976 | Bacteria | 1665 |
| 263 | Ga0495592_0006810 | 3300046454 | Bacteria | 8530 |
| 264 | Ga0495603_0012208 | 3300046455 | Bacteria | 5202 |
| 265 | Ga0495629_0004434 | 3300046459 | Bacteria | 10518 |
| 266 | Ga0495638_0042428 | 3300046460 | Bacteria | 2873 |
| 267 | Ga0495651_0004389 | 3300046462 | Bacteria | 10799 |
| 268 | Ga0495651_0038183 | 3300046462 | Bacteria | 3739 |
| 269 | Ga0495653_0001578 | 3300046463 | Bacteria | 17865 |
| 270 | Ga0495580_0021072 | 3300046472 | Bacteria | 4813 |
| 271 | Ga0495582_0080910 | 3300046473 | Bacteria | 1804 |
| 272 | Ga0495582_0106358 | 3300046473 | Bacteria | 1574 |
| 273 | Ga0495662_0000347 | 3300046476 | Bacteria | 20264 |
| 274 | Ga0495664_0000303 | 3300046477 | Bacteria | 23601 |
| 275 | Ga0495585_0047115 | 3300046492 | Bacteria | 2401 |
| 276 | Ga0495594_0002274 | 3300046499 | Bacteria | 10008 |
| 277 | Ga0495607_0016069 | 3300046501 | Bacteria | 4836 |
| 278 | Ga0495608_0000841 | 3300046511 | Bacteria | 21466 |
| 279 | Ga0495618_0029051 | 3300046514 | Bacteria | 3448 |
| 280 | Ga0495620_0025476 | 3300046515 | Bacteria | 2797 |
| 281 | Ga0495628_0001628 | 3300046516 | Bacteria | 20538 |
| 282 | Ga0495628_0009680 | 3300046516 | Bacteria | 8222 |
| 283 | Ga0495630_0025647 | 3300046517 | Bacteria | 4360 |
| 284 | Ga0495666_0001587 | 3300046526 | Bacteria | 11187 |
| 285 | Ga0495666_0002305 | 3300046526 | Bacteria | 9517 |
| 286 | Ga0495652_0019766 | 3300046529 | Bacteria | 5992 |
| 287 | Ga0495652_0024632 | 3300046529 | Bacteria | 5324 |
| 288 | Ga0495586_0006495 | 3300046535 | Bacteria | 6243 |
| 289 | Ga0495587_0046167 | 3300046536 | Bacteria | 2586 |
| 290 | Ga0495645_0003244 | 3300046543 | Bacteria | 11037 |
| 291 | Ga0495622_0001218 | 3300046557 | Bacteria | 13213 |
| 292 | Ga0495667_0009494 | 3300046559 | Bacteria | 6591 |
| 293 | Ga0495668_0000161 | 3300046616 | Bacteria | 101410 |
| 294 | Ga0495668_0029479 | 3300046616 | Bacteria | 3100 |
| 295 | Ga0495634_0090889 | 3300046642 | Bacteria | 1982 |
| 296 | Ga0495635_0007609 | 3300046663 | Bacteria | 7557 |
| 297 | Ga0495588_0014711 | 3300046674 | Bacteria | 3751 |
| 298 | Ga0495599_0009966 | 3300046678 | Bacteria | 5817 |
| 299 | Ga0495623_0013299 | 3300046679 | Bacteria | 5338 |
| 300 | Ga0495646_0007078 | 3300046680 | Bacteria | 7124 |
| 301 | Ga0495613_0001143 | 3300046689 | Bacteria | 20228 |
| 302 | Ga0495624_0002611 | 3300046690 | Bacteria | 13602 |
| 303 | Ga0495671_0055975 | 3300046692 | Bacteria | 1953 |
| 304 | Ga0495589_0011588 | 3300046794 | Bacteria | 4578 |
| 305 | Ga0495600_0007742 | 3300046809 | Bacteria | 6579 |
| 306 | Ga0495600_0091640 | 3300046809 | Bacteria | 1982 |
| 307 | Ga0495660_0114230 | 3300046810 | Bacteria | 1374 |
| 308 | Ga0495604_0003188 | 3300047317 | Bacteria | 13105 |
| 309 | Ga0495604_0106833 | 3300047317 | Bacteria | 2047 |
| 310 | Ga0495674_0005877 | 3300047319 | Bacteria | 11773 |
| 311 | Ga0495672_0093185 | 3300047320 | Bacteria | 1650 |
| 312 | Ga0495676_0011711 | 3300047321 | Bacteria | 7908 |
| 313 | Ga0495683_0000797 | 3300047323 | Bacteria | 22423 |
| 314 | Ga0495675_0009417 | 3300047444 | Bacteria | 6077 |
| 315 | Ga0495675_0022760 | 3300047444 | Bacteria | 3996 |
| 316 | Ga0495675_0091437 | 3300047444 | Bacteria | 1910 |
| 317 | Ga0495673_0000941 | 3300047469 | Bacteria | 26398 |
| 318 | Ga0495614_0016363 | 3300048089 | Bacteria | 3228 |
| 319 | Ga0495614_0056341 | 3300048089 | Bacteria | 1687 |
| 320 | Ga0496100_0000053 | 3300048903 | Bacteria | 70913 |
| 321 | Ga0496100_0000393 | 3300048903 | Bacteria | 21163 |
| 322 | Ga0496100_0024885 | 3300048903 | Bacteria | 3657 |
| 323 | Ga0496101_0000056 | 3300048904 | Bacteria | 135446 |
| 324 | Ga0496101_0000057 | 3300048904 | Bacteria | 134204 |
| 325 | Ga0496101_0001380 | 3300048904 | Bacteria | 14541 |
| 326 | Ga0496101_0135045 | 3300048904 | Bacteria | 1876 |
| 327 | Ga0496102_0000059 | 3300048905 | Bacteria | 168633 |
| 328 | Ga0496102_0000177 | 3300048905 | Bacteria | 86724 |
| 329 | Ga0496102_0025685 | 3300048905 | Bacteria | 5246 |
| 330 | Ga0496102_0043506 | 3300048905 | Bacteria | 4073 |
| 331 | Ga0496102_0059491 | 3300048905 | Bacteria | 3494 |
| 332 | Ga0496102_0110446 | 3300048905 | Bacteria | 2563 |
| 333 | Ga0496102_0347977 | 3300048905 | Bacteria | 1395 |
| 334 | Ga0496103_0000003 | 3300048906 | Bacteria | 603967 |
| 335 | Ga0496103_0000063 | 3300048906 | Bacteria | 128503 |
| 336 | Ga0496104_0018629 | 3300048907 | Bacteria | 6337 |
| 337 | Ga0496104_0076775 | 3300048907 | Bacteria | 3182 |
| 338 | Ga0496104_0235625 | 3300048907 | Bacteria | 1742 |
| 339 | Ga0496104_0273399 | 3300048907 | Bacteria | 1602 |
| 340 | Ga0496105_0004900 | 3300048908 | Bacteria | 10120 |
| 341 | Ga0496105_0016579 | 3300048908 | Bacteria | 5883 |
| 342 | Ga0496106_0039599 | 3300048909 | Bacteria | 3530 |
| 343 | Ga0496106_0373774 | 3300048909 | Bacteria | 1145 |
| 344 | Ga0496107_0000167 | 3300048910 | Bacteria | 33889 |
| 345 | Ga0496107_0165239 | 3300048910 | Bacteria | 1641 |
| 346 | Ga0496108_0012895 | 3300048911 | Bacteria | 6810 |
| 347 | Ga0496108_0023986 | 3300048911 | Bacteria | 5022 |
| 348 | Ga0496108_0096397 | 3300048911 | Bacteria | 2519 |
| 349 | Ga0496108_0209616 | 3300048911 | Bacteria | 1691 |
| 350 | Ga0496108_0335157 | 3300048911 | Bacteria | 1319 |
| 351 | Ga0496109_0000144 | 3300048912 | Bacteria | 71522 |
| 352 | Ga0496109_0061039 | 3300048912 | Bacteria | 3446 |
| 353 | Ga0496109_0157025 | 3300048912 | Bacteria | 2131 |
| 354 | Ga0496109_0197435 | 3300048912 | Bacteria | 1892 |
| 355 | Ga0496109_0226213 | 3300048912 | Bacteria | 1760 |
| 356 | Ga0496110_0004181 | 3300048913 | Bacteria | 11149 |
| 357 | Ga0496110_0012688 | 3300048913 | Bacteria | 6935 |
| 358 | Ga0496110_0043249 | 3300048913 | Bacteria | 3933 |
| 359 | Ga0496110_0159956 | 3300048913 | Bacteria | 2041 |
| 360 | Ga0496111_0042099 | 3300048914 | Bacteria | 3279 |
| 361 | Ga0496111_0042598 | 3300048914 | Bacteria | 3261 |
| 362 | Ga0496111_0058221 | 3300048914 | Bacteria | 2797 |
| 363 | Ga0496111_0270507 | 3300048914 | Bacteria | 1261 |
| 364 | Ga0496113_0038302 | 3300048916 | Bacteria | 3525 |
| 365 | Ga0496113_0424217 | 3300048916 | Bacteria | 1068 |
| 366 | Ga0496114_0003438 | 3300048917 | Bacteria | 12146 |
| 367 | Ga0496114_0004833 | 3300048917 | Bacteria | 10496 |
| 368 | Ga0496115_0001472 | 3300048918 | Bacteria | 16914 |
| 369 | Ga0496115_0021772 | 3300048918 | Bacteria | 4956 |
| 370 | Ga0496115_0028898 | 3300048918 | Bacteria | 4349 |
| 371 | Ga0496115_0172373 | 3300048918 | Bacteria | 1789 |
| 372 | Ga0496116_0000013 | 3300048919 | Bacteria | 603993 |
| 373 | Ga0496116_0002742 | 3300048919 | Bacteria | 18096 |
| 374 | Ga0496117_0000013 | 3300048920 | Bacteria | 603995 |
| 375 | Ga0496118_0000011 | 3300048921 | Bacteria | 603995 |
| 376 | Ga0496119_0048377 | 3300048922 | Bacteria | 2637 |
| 377 | Ga0496120_0021133 | 3300048923 | Bacteria | 4118 |
| 378 | Ga0496121_0000060 | 3300048924 | Bacteria | 276682 |
| 379 | Ga0496121_0000068 | 3300048924 | Bacteria | 259210 |
| 380 | Ga0496121_0089971 | 3300048924 | Bacteria | 2401 |
| 381 | Ga0496122_0000085 | 3300048925 | Bacteria | 208310 |
| 382 | Ga0496124_0000065 | 3300048927 | Bacteria | 223594 |
| 383 | Ga0496125_0000008 | 3300048928 | Bacteria | 704677 |
| 384 | Ga0496125_0006840 | 3300048928 | Bacteria | 12229 |
| 385 | Ga0496125_0143220 | 3300048928 | Bacteria | 1658 |
| 386 | Ga0496126_0000062 | 3300048929 | Bacteria | 259210 |
| 387 | Ga0496126_0012696 | 3300048929 | Bacteria | 8618 |
| 388 | Ga0496126_0037170 | 3300048929 | Bacteria | 4546 |
| 389 | Ga0496126_0221712 | 3300048929 | Bacteria | 1588 |
| 390 | Ga0501031_0008726 | 3300049568 | Bacteria | 6592 |
| 391 | Ga0501032_0006046 | 3300049569 | Bacteria | 8926 |
| 392 | Ga0501032_0023150 | 3300049569 | Bacteria | 4299 |
| 393 | Ga0501032_0038617 | 3300049569 | Bacteria | 3250 |
| 394 | Ga0501032_0146327 | 3300049569 | Bacteria | 1555 |
| 395 | Ga0501032_0175631 | 3300049569 | Bacteria | 1403 |
| 396 | Ga0501033_0014181 | 3300049570 | Bacteria | 6060 |
| 397 | Ga0501033_0026555 | 3300049570 | Bacteria | 4358 |
| 398 | Ga0501033_0054056 | 3300049570 | Bacteria | 2972 |
| 399 | Ga0501033_0185908 | 3300049570 | Bacteria | 1488 |
| 400 | Ga0501034_0002539 | 3300049571 | Bacteria | 21826 |
| 401 | Ga0501034_0006581 | 3300049571 | Bacteria | 12464 |
| 402 | Ga0501034_0007104 | 3300049571 | Bacteria | 11949 |
| 403 | Ga0501034_0055411 | 3300049571 | Bacteria | 3990 |
| 404 | Ga0501034_0183218 | 3300049571 | Bacteria | 2059 |
| 405 | Ga0501036_0011150 | 3300049572 | Bacteria | 7436 |
| 406 | Ga0501036_0027797 | 3300049572 | Bacteria | 4781 |
| 407 | Ga0501036_0154847 | 3300049572 | Bacteria | 1933 |
| 408 | Ga0501036_0196029 | 3300049572 | Bacteria | 1699 |
| 409 | Ga0501036_0318333 | 3300049572 | Bacteria | 1300 |
| 410 | Ga0501037_0006073 | 3300049573 | Bacteria | 8823 |
| 411 | Ga0501037_0006561 | 3300049573 | Bacteria | 8515 |
| 412 | Ga0501037_0009150 | 3300049573 | Bacteria | 7255 |
| 413 | Ga0501037_0095109 | 3300049573 | Bacteria | 2154 |
| 414 | Ga0501038_0002083 | 3300049574 | Bacteria | 18540 |
| 415 | Ga0501038_0012225 | 3300049574 | Bacteria | 7839 |
| 416 | Ga0501038_0023272 | 3300049574 | Bacteria | 5540 |
| 417 | Ga0501038_0206002 | 3300049574 | Bacteria | 1576 |
| 418 | Ga0501039_0004016 | 3300049575 | Bacteria | 11054 |
| 419 | Ga0501039_0025599 | 3300049575 | Bacteria | 4535 |
| 420 | Ga0501039_0097967 | 3300049575 | Bacteria | 2287 |
| 421 | Ga0501039_0173481 | 3300049575 | Bacteria | 1695 |
| 422 | Ga0501040_0207738 | 3300049576 | Bacteria | 1391 |
| 423 | Ga0501041_0033840 | 3300049577 | Bacteria | 3093 |
| 424 | Ga0501041_0103610 | 3300049577 | Bacteria | 1762 |
| 425 | Ga0501042_0167440 | 3300049578 | Bacteria | 1585 |
| 426 | Ga0501043_0002178 | 3300049579 | Bacteria | 16718 |
| 427 | Ga0501043_0053426 | 3300049579 | Bacteria | 3173 |
| 428 | Ga0501043_0060602 | 3300049579 | Bacteria | 2971 |
| 429 | Ga0501043_0152801 | 3300049579 | Bacteria | 1806 |
| 430 | Ga0501046_0000879 | 3300049580 | Bacteria | 29216 |
| 431 | Ga0501046_0003598 | 3300049580 | Bacteria | 14198 |
| 432 | Ga0501046_0006444 | 3300049580 | Bacteria | 10393 |
| 433 | Ga0501046_0055571 | 3300049580 | Bacteria | 3110 |
| 434 | Ga0501046_0143886 | 3300049580 | Bacteria | 1802 |
| 435 | Ga0501047_0006214 | 3300049581 | Bacteria | 11226 |
| 436 | Ga0501047_0022965 | 3300049581 | Bacteria | 5987 |
| 437 | Ga0501047_0024286 | 3300049581 | Bacteria | 5819 |
| 438 | Ga0501047_0048096 | 3300049581 | Bacteria | 4120 |
| 439 | Ga0501047_0080758 | 3300049581 | Bacteria | 3125 |
| 440 | Ga0501048_0009602 | 3300049582 | Bacteria | 7260 |
| 441 | Ga0501048_0011448 | 3300049582 | Bacteria | 6618 |
| 442 | Ga0501048_0020414 | 3300049582 | Bacteria | 4855 |
| 443 | Ga0501048_0050636 | 3300049582 | Bacteria | 2957 |
| 444 | Ga0501067_0008339 | 3300049583 | Bacteria | 5753 |
| 445 | Ga0501067_0029600 | 3300049583 | Bacteria | 3035 |
| 446 | Ga0501069_0006522 | 3300049585 | Bacteria | 6101 |
| 447 | Ga0501070_0000482 | 3300049586 | Bacteria | 36204 |
| 448 | Ga0501070_0000545 | 3300049586 | Bacteria | 34467 |
| 449 | Ga0501070_0015717 | 3300049586 | Bacteria | 6365 |
| 450 | Ga0501071_0035037 | 3300049587 | Bacteria | 3574 |
| 451 | Ga0501072_0018612 | 3300049588 | Bacteria | 5352 |
| 452 | Ga0501072_0159443 | 3300049588 | Bacteria | 1800 |
| 453 | Ga0501073_0023699 | 3300049589 | Bacteria | 4406 |
| 454 | Ga0501073_0042005 | 3300049589 | Bacteria | 3229 |
| 455 | Ga0501074_0013440 | 3300049590 | Bacteria | 5951 |
| 456 | Ga0501074_0036770 | 3300049590 | Bacteria | 3547 |
| 457 | Ga0501075_0091578 | 3300049591 | Bacteria | 2307 |
| 458 | Ga0501076_0006752 | 3300049592 | Bacteria | 8328 |
| 459 | Ga0501077_0010215 | 3300049593 | Bacteria | 5846 |
| 460 | Ga0501077_0144259 | 3300049593 | Bacteria | 1510 |
| 461 | Ga0501079_0202523 | 3300049741 | Bacteria | 1550 |
| 462 | Ga0501080_0211759 | 3300049742 | Bacteria | 1776 |
| 463 | Ga0501080_0248399 | 3300049742 | Bacteria | 1622 |
| 464 | Ga0501081_0017097 | 3300049743 | Bacteria | 4797 |
| 465 | Ga0501081_0123774 | 3300049743 | Bacteria | 1844 |
| 466 | Ga0501035_0001148 | 3300049822 | Bacteria | 27666 |
| 467 | Ga0501035_0001215 | 3300049822 | Bacteria | 26839 |
| 468 | Ga0501035_0020032 | 3300049822 | Bacteria | 6144 |
| 469 | Ga0501035_0028571 | 3300049822 | Bacteria | 5091 |
| 470 | Ga0501035_0057098 | 3300049822 | Bacteria | 3481 |
| 471 | Ga0501035_0067768 | 3300049822 | Bacteria | 3166 |
| 472 | Ga0501035_0166021 | 3300049822 | Bacteria | 1909 |
| 473 | Ga0501044_0003581 | 3300049823 | Bacteria | 17477 |
| 474 | Ga0501044_0004709 | 3300049823 | Bacteria | 15252 |
| 475 | Ga0501044_0007806 | 3300049823 | Bacteria | 11761 |
| 476 | Ga0501044_0008986 | 3300049823 | Bacteria | 10925 |
| 477 | Ga0501044_0015695 | 3300049823 | Bacteria | 8156 |
| 478 | Ga0501044_0073875 | 3300049823 | Bacteria | 3465 |
| 479 | Ga0501045_0000424 | 3300049824 | Bacteria | 25806 |
| 480 | nmdc:mga03n38_142993_c1 | 3300050490 | Bacteria | 1197 |
| 481 | nmdc:mga03n38_146867_c1 | 3300050490 | Bacteria | 1183 |
| 482 | nmdc:mga03n38_5425_c1 | 3300050490 | Bacteria | 4343 |
| 483 | nmdc:mga00v17_151559_c1 | 3300050491 | Bacteria | 1490 |
| 484 | nmdc:mga00v17_2428_c1 | 3300050491 | Bacteria | 9527 |
| 485 | nmdc:mga0yw44_15186_c1 | 3300050492 | Bacteria | 4115 |
| 486 | nmdc:mga0yw44_18593_c1 | 3300050492 | Bacteria | 3811 |
| 487 | nmdc:mga0yw44_4222_c1 | 3300050492 | Bacteria | 6543 |
| 488 | nmdc:mga0yw44_4450_c1 | 3300050492 | Bacteria | 6427 |
| 489 | nmdc:mga0yw44_7629_c1 | 3300050492 | Bacteria | 5334 |
| 490 | nmdc:mga07m45_105225_c1 | 3300050496 | Bacteria | 1623 |
| 491 | nmdc:mga07m45_6192_c1 | 3300050496 | Bacteria | 6036 |
| 492 | nmdc:mga07m45_7450_c1 | 3300050496 | Bacteria | 5594 |
| 493 | nmdc:mga05p37_2234_c1 | 3300050507 | Bacteria | 22561 |
| 494 | nmdc:mga09592_261_c1 | 3300050508 | Bacteria | 38455 |
| 495 | nmdc:mga0qj67_7414_c1 | 3300050509 | Bacteria | 8109 |
| 496 | nmdc:mga06r32_13005_c1 | 3300050510 | Bacteria | 7530 |
| 497 | nmdc:mga06r32_7443_c1 | 3300050510 | Bacteria | 9853 |
| 498 | nmdc:mga08y16_103424_c1 | 3300050511 | Bacteria | 2965 |
| 499 | nmdc:mga08y16_16168_c1 | 3300050511 | Bacteria | 7844 |
| 500 | nmdc:mga0sz30_1905_c1 | 3300050516 | Bacteria | 7447 |
| 501 | nmdc:mga0sz30_8675_c1 | 3300050516 | Bacteria | 1660 |
| 502 | nmdc:mga0sz30_88316_c1 | 3300050516 | Bacteria | 1347 |
| 503 | Ga0495601_0006119 | 3300053077 | Bacteria | 7023 |
| 504 | Ga0495601_0015329 | 3300053077 | Bacteria | 4632 |
| 505 | Ga0495612_0069122 | 3300053078 | Bacteria | 1471 |
| 506 | Ga0495619_0024537 | 3300053085 | Bacteria | 3868 |
| 507 | Ga0500643_001717 | 3300053087 | Bacteria | 12170 |
| 508 | Ga0500643_016514 | 3300053087 | Bacteria | 2497 |
| 509 | Ga0500644_0000667 | 3300053088 | Bacteria | 12577 |
| 510 | Ga0500556_0000762 | 3300053104 | Bacteria | 19126 |
| 511 | Ga0500593_008726 | 3300053117 | Bacteria | 4176 |
| 512 | Ga0500573_0167861 | 3300053140 | Bacteria | 1189 |
| 513 | Ga0500588_0041527 | 3300053146 | Bacteria | 1389 |
| 514 | Ga0500604_0061358 | 3300053151 | Bacteria | 1182 |
| 515 | Ga0500616_0000060 | 3300053153 | Bacteria | 252252 |
| 516 | Ga0500616_0021260 | 3300053153 | Bacteria | 3641 |
| 517 | Ga0500616_0021763 | 3300053153 | Bacteria | 3587 |
| 518 | Ga0500627_0015515 | 3300053158 | Bacteria | 2947 |
| 519 | Ga0501084_0108493 | 3300054114 | Bacteria | 2332 |
| 520 | Ga0501082_0196789 | 3300060353 | Bacteria | 1753 |
| 521 | Ga0466962_0001313 | 3300061719 | Bacteria | 11468 |
| 522 | Ga0466962_0027202 | 3300061719 | Bacteria | 2746 |
| 523 | Ga0466962_0061638 | 3300061719 | Bacteria | 1790 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050490 | nmdc:mga03n38_146867_c1 | nmdc:mga03n38_146867_c1_204_1157 | 301 |
| 2 | 3300050511 | nmdc:mga08y16_103424_c1 | nmdc:mga08y16_103424_c1_639_1724 | 301 |
| 3 | 3300044693 | Ga0466961_0222484 | Ga0466961_0222484_13_1008 | 308 |
| 4 | 3300048918 | Ga0496115_0028898 | Ga0496115_0028898_23_988 | 310 |
| 5 | 3300037418 | Ga0395900_0008055 | Ga0395900_0008055_7197_8297 | 311 |
| 6 | 3300037466 | Ga0395898_0129853 | Ga0395898_0129853_360_1460 | 311 |
| 7 | 3300042146 | Ga0450907_008529 | Ga0450907_008529_378_1511 | 311 |
| 8 | 3300053088 | Ga0500644_0000667 | Ga0500644_0000667_7475_8560 | 314 |
| 9 | 3300045976 | Ga0466967_0258817 | Ga0466967_0258817_15_986 | 315 |
| 10 | 3300048905 | Ga0496102_0347977 | Ga0496102_0347977_378_1367 | 315 |
| 11 | 3300048916 | Ga0496113_0424217 | Ga0496113_0424217_50_1039 | 315 |
| 12 | iso_pu_bacteria | 8025478263 | 8025480684 | 315 |
| 13 | 3300047444 | Ga0495675_0022760 | Ga0495675_0022760_337_1422 | 316 |
| 14 | 3300048911 | Ga0496108_0335157 | Ga0496108_0335157_336_1304 | 316 |
| 15 | 3300050492 | nmdc:mga0yw44_15186_c1 | nmdc:mga0yw44_15186_c1_1516_2601 | 317 |
| 16 | 3300006051 | Ga0075364_10056460 | Ga0075364_100564603 | 320 |
| 17 | 3300005617 | Ga0068859_100003059 | Ga0068859_1000030597 | 323 |
| 18 | 3300006931 | Ga0097620_100003059 | Ga0097620_1000030597 | 323 |
| 19 | 3300009101 | Ga0105247_10002270 | Ga0105247_100022707 | 323 |
| 20 | 3300025900 | Ga0207710_10003350 | Ga0207710_100033507 | 323 |
| 21 | 3300036401 | Ga0373937_0502016 | Ga0373937_0502016_140_1126 | 323 |
| 22 | 3300048905 | Ga0496102_0000059 | Ga0496102_0000059_131378_132463 | 323 |
| 23 | 3300048906 | Ga0496103_0000063 | Ga0496103_0000063_46482_47567 | 323 |
| 24 | 3300048922 | Ga0496119_0048377 | Ga0496119_0048377_578_1663 | 323 |
| 25 | 3300048924 | Ga0496121_0089971 | Ga0496121_0089971_447_1532 | 323 |
| 26 | 3300005843 | Ga0068860_100003236 | Ga0068860_10000323612 | 324 |
| 27 | 3300006038 | Ga0075365_10010956 | Ga0075365_100109564 | 324 |
| 28 | 3300028381 | Ga0268264_10000716 | Ga0268264_100007169 | 324 |
| 29 | 3300050492 | nmdc:mga0yw44_7629_c1 | nmdc:mga0yw44_7629_c1_1999_3096 | 324 |
| 30 | 3300005329 | Ga0070683_100050182 | Ga0070683_1000501822 | 325 |
| 31 | 3300005344 | Ga0070661_100108340 | Ga0070661_1001083402 | 325 |
| 32 | 3300005530 | Ga0070679_100013856 | Ga0070679_1000138562 | 325 |
| 33 | 3300005535 | Ga0070684_100022378 | Ga0070684_1000223786 | 325 |
| 34 | 3300020081 | Ga0206354_10337988 | Ga0206354_103379882 | 325 |
| 35 | 3300025920 | Ga0207649_10060025 | Ga0207649_100600252 | 325 |
| 36 | 3300025921 | Ga0207652_10055313 | Ga0207652_100553132 | 325 |
| 37 | 3300025932 | Ga0207690_10007171 | Ga0207690_100071711 | 325 |
| 38 | 3300025944 | Ga0207661_10021401 | Ga0207661_100214012 | 325 |
| 39 | 3300044658 | Ga0466972_0023900 | Ga0466972_0023900_1512_2546 | 326 |
| 40 | 3300020082 | Ga0206353_10313555 | Ga0206353_103135552 | 327 |
| 41 | 3300048907 | Ga0496104_0076775 | Ga0496104_0076775_130_1227 | 327 |
| 42 | 3300005327 | Ga0070658_10205050 | Ga0070658_102050503 | 328 |
| 43 | 3300010375 | Ga0105239_10028303 | Ga0105239_100283034 | 328 |
| 44 | 3300025914 | Ga0207671_10183533 | Ga0207671_101835332 | 328 |
| 45 | 3300048909 | Ga0496106_0373774 | Ga0496106_0373774_102_1133 | 328 |
| 46 | 3300053146 | Ga0500588_0041527 | Ga0500588_0041527_342_1373 | 328 |
| 47 | 3300006844 | Ga0075428_100001173 | Ga0075428_1000011736 | 329 |
| 48 | 3300006846 | Ga0075430_100001837 | Ga0075430_1000018372 | 329 |
| 49 | 3300006847 | Ga0075431_100002225 | Ga0075431_10000222512 | 329 |
| 50 | 3300006880 | Ga0075429_100015793 | Ga0075429_1000157933 | 329 |
| 51 | 3300009147 | Ga0114129_10008242 | Ga0114129_1000824212 | 329 |
| 52 | 3300011119 | Ga0105246_10113365 | Ga0105246_101133653 | 329 |
| 53 | 3300014326 | Ga0157380_10408624 | Ga0157380_104086241 | 329 |
| 54 | 3300027907 | Ga0207428_10013908 | Ga0207428_100139083 | 329 |
| 55 | 3300050492 | nmdc:mga0yw44_4450_c1 | nmdc:mga0yw44_4450_c1_1634_2719 | 329 |
| 56 | 3300050507 | nmdc:mga05p37_2234_c1 | nmdc:mga05p37_2234_c1_16069_17157 | 329 |
| 57 | 3300050508 | nmdc:mga09592_261_c1 | nmdc:mga09592_261_c1_14923_16011 | 329 |
| 58 | 3300050509 | nmdc:mga0qj67_7414_c1 | nmdc:mga0qj67_7414_c1_843_1931 | 329 |
| 59 | 3300050510 | nmdc:mga06r32_7443_c1 | nmdc:mga06r32_7443_c1_2195_3283 | 329 |
| 60 | 3300050511 | nmdc:mga08y16_16168_c1 | nmdc:mga08y16_16168_c1_4916_6004 | 329 |
| 61 | 3300049581 | Ga0501047_0006214 | Ga0501047_0006214_5331_6416 | 331 |
| 62 | 3300049823 | Ga0501044_0073875 | Ga0501044_0073875_1676_2761 | 331 |
| 63 | 3300053140 | Ga0500573_0167861 | Ga0500573_0167861_90_1175 | 331 |
| 64 | 3300053153 | Ga0500616_0021763 | Ga0500616_0021763_930_1991 | 331 |
| 65 | 3300031456 | Ga0307513_10004144 | Ga0307513_1000414422 | 332 |
| 66 | 3300048914 | Ga0496111_0042598 | Ga0496111_0042598_1819_2868 | 332 |
| 67 | 3300005356 | Ga0070674_100137104 | Ga0070674_1001371042 | 333 |
| 68 | 3300005530 | Ga0070679_100104164 | Ga0070679_1001041642 | 333 |
| 69 | 3300006358 | Ga0068871_100170732 | Ga0068871_1001707323 | 333 |
| 70 | 3300025921 | Ga0207652_10161373 | Ga0207652_101613732 | 333 |
| 71 | 3300025937 | Ga0207669_10096564 | Ga0207669_100965642 | 333 |
| 72 | 3300025941 | Ga0207711_10016788 | Ga0207711_100167885 | 333 |
| 73 | 3300026035 | Ga0207703_10181347 | Ga0207703_101813472 | 333 |
| 74 | 3300037418 | Ga0395900_0508515 | Ga0395900_0508515_32_1105 | 333 |
| 75 | 3300048903 | Ga0496100_0000393 | Ga0496100_0000393_14031_15116 | 333 |
| 76 | 3300048904 | Ga0496101_0001380 | Ga0496101_0001380_7652_8737 | 333 |
| 77 | 3300048911 | Ga0496108_0023986 | Ga0496108_0023986_3763_4848 | 333 |
| 78 | 3300048912 | Ga0496109_0061039 | Ga0496109_0061039_2205_3290 | 333 |
| 79 | 3300048917 | Ga0496114_0004833 | Ga0496114_0004833_2776_3861 | 333 |
| 80 | 3300048918 | Ga0496115_0172373 | Ga0496115_0172373_334_1419 | 333 |
| 81 | iso_pu_bacteria | 2866552031 | 2866553571 | 333 |
| 82 | 3300001989 | JGI24739J22299_10032835 | JGI24739J22299_100328352 | 334 |
| 83 | 3300005347 | Ga0070668_100155585 | Ga0070668_1001555851 | 334 |
| 84 | 3300005577 | Ga0068857_100070152 | Ga0068857_1000701523 | 334 |
| 85 | 3300009094 | Ga0111539_10015766 | Ga0111539_1001576611 | 334 |
| 86 | 3300009148 | Ga0105243_10219185 | Ga0105243_102191851 | 334 |
| 87 | 3300009177 | Ga0105248_10058454 | Ga0105248_100584541 | 334 |
| 88 | 3300014325 | Ga0163163_10196109 | Ga0163163_101961092 | 334 |
| 89 | 3300014326 | Ga0157380_10165405 | Ga0157380_101654052 | 334 |
| 90 | 3300025919 | Ga0207657_10055365 | Ga0207657_100553651 | 334 |
| 91 | 3300025925 | Ga0207650_10263868 | Ga0207650_102638682 | 334 |
| 92 | 3300025934 | Ga0207686_10193755 | Ga0207686_101937552 | 334 |
| 93 | 3300025972 | Ga0207668_10143529 | Ga0207668_101435292 | 334 |
| 94 | 3300026116 | Ga0207674_10066814 | Ga0207674_100668143 | 334 |
| 95 | 3300028381 | Ga0268264_10187928 | Ga0268264_101879282 | 334 |
| 96 | 3300032126 | Ga0307415_100068322 | Ga0307415_1000683223 | 334 |
| 97 | 3300041404 | Ga0439436_0010993 | Ga0439436_0010993_1529_2626 | 334 |
| 98 | 3300046473 | Ga0495582_0080910 | Ga0495582_0080910_406_1491 | 334 |
| 99 | 3300049569 | Ga0501032_0146327 | Ga0501032_0146327_100_1185 | 334 |
| 100 | 3300049572 | Ga0501036_0196029 | Ga0501036_0196029_170_1255 | 334 |
| 101 | 3300049575 | Ga0501039_0025599 | Ga0501039_0025599_2263_3348 | 334 |
| 102 | 3300049576 | Ga0501040_0207738 | Ga0501040_0207738_93_1178 | 334 |
| 103 | 3300049588 | Ga0501072_0018612 | Ga0501072_0018612_2935_4020 | 334 |
| 104 | 3300053085 | Ga0495619_0024537 | Ga0495619_0024537_2096_3184 | 334 |
| 105 | 3300053104 | Ga0500556_0000762 | Ga0500556_0000762_15565_16665 | 334 |
| 106 | 3300053153 | Ga0500616_0021260 | Ga0500616_0021260_854_1939 | 334 |
| 107 | 3300013308 | Ga0157375_10277237 | Ga0157375_102772373 | 335 |
| 108 | 3300026041 | Ga0207639_10039169 | Ga0207639_100391692 | 335 |
| 109 | 3300044658 | Ga0466972_0021125 | Ga0466972_0021125_1726_2811 | 335 |
| 110 | 3300048907 | Ga0496104_0235625 | Ga0496104_0235625_302_1435 | 335 |
| 111 | 3300005981 | Ga0081538_10000729 | Ga0081538_1000072915 | 336 |
| 112 | 3300026121 | Ga0207683_10069615 | Ga0207683_100696152 | 336 |
| 113 | 3300028800 | Ga0265338_10031430 | Ga0265338_100314305 | 336 |
| 114 | 3300031241 | Ga0265325_10001703 | Ga0265325_1000170310 | 336 |
| 115 | 3300031247 | Ga0265340_10000864 | Ga0265340_100008648 | 336 |
| 116 | 3300031249 | Ga0265339_10004725 | Ga0265339_100047254 | 336 |
| 117 | 3300031344 | Ga0265316_10035911 | Ga0265316_100359112 | 336 |
| 118 | 3300031711 | Ga0265314_10010299 | Ga0265314_100102993 | 336 |
| 119 | 3300031712 | Ga0265342_10053228 | Ga0265342_100532282 | 336 |
| 120 | 3300038443 | Ga0395901_0084502 | Ga0395901_0084502_821_1909 | 336 |
| 121 | 3300041456 | Ga0451795_1026876 | Ga0451795_1026876_986_2071 | 336 |
| 122 | 3300047444 | Ga0495675_0091437 | Ga0495675_0091437_462_1547 | 336 |
| 123 | 3300048905 | Ga0496102_0110446 | Ga0496102_0110446_229_1314 | 336 |
| 124 | 3300048909 | Ga0496106_0039599 | Ga0496106_0039599_890_1975 | 336 |
| 125 | 3300048910 | Ga0496107_0165239 | Ga0496107_0165239_357_1442 | 336 |
| 126 | 3300005937 | Ga0081455_10002627 | Ga0081455_100026273 | 337 |
| 127 | 3300006847 | Ga0075431_100000320 | Ga0075431_10000032011 | 337 |
| 128 | 3300041453 | Ga0451797_0406099 | Ga0451797_0406099_75_1160 | 337 |
| 129 | 3300048907 | Ga0496104_0273399 | Ga0496104_0273399_404_1504 | 337 |
| 130 | 3300048913 | Ga0496110_0012688 | Ga0496110_0012688_1892_2992 | 337 |
| 131 | 3300048928 | Ga0496125_0143220 | Ga0496125_0143220_434_1534 | 337 |
| 132 | 3300048929 | Ga0496126_0221712 | Ga0496126_0221712_446_1546 | 337 |
| 133 | 3300049581 | Ga0501047_0048096 | Ga0501047_0048096_708_1823 | 337 |
| 134 | 3300049822 | Ga0501035_0067768 | Ga0501035_0067768_2014_3129 | 337 |
| 135 | 3300050510 | nmdc:mga06r32_13005_c1 | nmdc:mga06r32_13005_c1_505_1593 | 337 |
| 136 | 3300053153 | Ga0500616_0000060 | Ga0500616_0000060_245635_246720 | 337 |
| 137 | 3300005981 | Ga0081538_10064579 | Ga0081538_100645792 | 338 |
| 138 | 3300031852 | Ga0307410_10014641 | Ga0307410_100146413 | 338 |
| 139 | 3300031995 | Ga0307409_100009467 | Ga0307409_1000094674 | 338 |
| 140 | 3300032126 | Ga0307415_100048596 | Ga0307415_1000485962 | 338 |
| 141 | 3300046501 | Ga0495607_0016069 | Ga0495607_0016069_336_1418 | 338 |
| 142 | 3300047323 | Ga0495683_0000797 | Ga0495683_0000797_4255_5337 | 338 |
| 143 | 3300049580 | Ga0501046_0000879 | Ga0501046_0000879_27981_29066 | 338 |
| 144 | 3300005535 | Ga0070684_100300113 | Ga0070684_1003001132 | 339 |
| 145 | 3300009098 | Ga0105245_10082246 | Ga0105245_100822462 | 339 |
| 146 | 3300025904 | Ga0207647_10022335 | Ga0207647_100223351 | 339 |
| 147 | 3300026142 | Ga0207698_10099075 | Ga0207698_100990753 | 339 |
| 148 | 3300044684 | Ga0466966_0137619 | Ga0466966_0137619_237_1334 | 339 |
| 149 | 3300044693 | Ga0466961_0044756 | Ga0466961_0044756_554_1651 | 339 |
| 150 | 3300045049 | Ga0466959_0108013 | Ga0466959_0108013_541_1638 | 339 |
| 151 | 3300048912 | Ga0496109_0226213 | Ga0496109_0226213_641_1726 | 339 |
| 152 | 3300049571 | Ga0501034_0007104 | Ga0501034_0007104_10752_11864 | 339 |
| 153 | 3300049573 | Ga0501037_0009150 | Ga0501037_0009150_1697_2809 | 339 |
| 154 | 3300049574 | Ga0501038_0002083 | Ga0501038_0002083_13139_14251 | 339 |
| 155 | 3300049822 | Ga0501035_0001148 | Ga0501035_0001148_10751_11863 | 339 |
| 156 | 3300049823 | Ga0501044_0003581 | Ga0501044_0003581_12737_13849 | 339 |
| 157 | 3300050490 | nmdc:mga03n38_142993_c1 | nmdc:mga03n38_142993_c1_18_1082 | 339 |
| 158 | 3300053117 | Ga0500593_008726 | Ga0500593_008726_733_1878 | 339 |
| 159 | 3300003792 | Ga0055540_1009061 | Ga0055540_10090614 | 340 |
| 160 | 3300006186 | Ga0075369_10012010 | Ga0075369_100120102 | 340 |
| 161 | 3300025303 | Ga0209051_1000959 | Ga0209051_100095923 | 340 |
| 162 | 3300025303 | Ga0209051_1002561 | Ga0209051_10025612 | 340 |
| 163 | 3300025303 | Ga0209051_1003092 | Ga0209051_10030928 | 340 |
| 164 | 3300031247 | Ga0265340_10002267 | Ga0265340_100022676 | 340 |
| 165 | 3300031456 | Ga0307513_10021746 | Ga0307513_100217463 | 340 |
| 166 | 3300041491 | Ga0451833_0141132 | Ga0451833_0141132_1177_2262 | 340 |
| 167 | 3300044842 | Ga0466957_0034514 | Ga0466957_0034514_695_1762 | 340 |
| 168 | 3300048904 | Ga0496101_0135045 | Ga0496101_0135045_66_1190 | 340 |
| 169 | 3300049568 | Ga0501031_0008726 | Ga0501031_0008726_684_1781 | 340 |
| 170 | 3300049572 | Ga0501036_0027797 | Ga0501036_0027797_853_1950 | 340 |
| 171 | 3300049573 | Ga0501037_0095109 | Ga0501037_0095109_987_2084 | 340 |
| 172 | 3300049574 | Ga0501038_0012225 | Ga0501038_0012225_4606_5703 | 340 |
| 173 | 3300049575 | Ga0501039_0097967 | Ga0501039_0097967_149_1246 | 340 |
| 174 | 3300049577 | Ga0501041_0103610 | Ga0501041_0103610_436_1533 | 340 |
| 175 | 3300049578 | Ga0501042_0167440 | Ga0501042_0167440_243_1340 | 340 |
| 176 | 3300049579 | Ga0501043_0060602 | Ga0501043_0060602_93_1190 | 340 |
| 177 | 3300049582 | Ga0501048_0050636 | Ga0501048_0050636_1033_2130 | 340 |
| 178 | 3300049587 | Ga0501071_0035037 | Ga0501071_0035037_2314_3411 | 340 |
| 179 | 3300049742 | Ga0501080_0211759 | Ga0501080_0211759_97_1194 | 340 |
| 180 | 3300049743 | Ga0501081_0123774 | Ga0501081_0123774_467_1564 | 340 |
| 181 | 3300049822 | Ga0501035_0057098 | Ga0501035_0057098_2307_3404 | 340 |
| 182 | 3300050516 | nmdc:mga0sz30_1905_c1 | nmdc:mga0sz30_1905_c1_5536_6624 | 340 |
| 183 | 3300054114 | Ga0501084_0108493 | Ga0501084_0108493_284_1381 | 340 |
| 184 | 3300025944 | Ga0207661_10156891 | Ga0207661_101568912 | 341 |
| 185 | 3300044656 | Ga0466969_0000861 | Ga0466969_0000861_3921_5006 | 341 |
| 186 | 3300044684 | Ga0466966_0007637 | Ga0466966_0007637_3211_4296 | 341 |
| 187 | 3300044693 | Ga0466961_0001501 | Ga0466961_0001501_4468_5553 | 341 |
| 188 | 3300044719 | Ga0466971_0001550 | Ga0466971_0001550_7869_8954 | 341 |
| 189 | 3300044765 | Ga0466970_0159862 | Ga0466970_0159862_90_1175 | 341 |
| 190 | 3300045049 | Ga0466959_0000764 | Ga0466959_0000764_13815_14900 | 341 |
| 191 | 3300045836 | Ga0466958_0024486 | Ga0466958_0024486_1880_2965 | 341 |
| 192 | 3300048914 | Ga0496111_0058221 | Ga0496111_0058221_659_1744 | 341 |
| 193 | 3300049570 | Ga0501033_0026555 | Ga0501033_0026555_77_1195 | 341 |
| 194 | 3300049822 | Ga0501035_0166021 | Ga0501035_0166021_172_1290 | 341 |
| 195 | 3300061719 | Ga0466962_0001313 | Ga0466962_0001313_3152_4237 | 341 |
| 196 | 3300005535 | Ga0070684_100243353 | Ga0070684_1002433531 | 342 |
| 197 | 3300038443 | Ga0395901_0020711 | Ga0395901_0020711_4559_5698 | 342 |
| 198 | 3300044683 | Ga0466965_0006758 | Ga0466965_0006758_2182_3270 | 342 |
| 199 | 3300044683 | Ga0466965_0042330 | Ga0466965_0042330_86_1174 | 342 |
| 200 | 3300045836 | Ga0466958_0022989 | Ga0466958_0022989_50_1165 | 342 |
| 201 | 3300048913 | Ga0496110_0004181 | Ga0496110_0004181_5709_6782 | 342 |
| 202 | 3300049569 | Ga0501032_0006046 | Ga0501032_0006046_3197_4282 | 342 |
| 203 | 3300049569 | Ga0501032_0175631 | Ga0501032_0175631_191_1276 | 342 |
| 204 | 3300049570 | Ga0501033_0014181 | Ga0501033_0014181_1862_2947 | 342 |
| 205 | 3300049570 | Ga0501033_0054056 | Ga0501033_0054056_1249_2337 | 342 |
| 206 | 3300049571 | Ga0501034_0006581 | Ga0501034_0006581_4034_5119 | 342 |
| 207 | 3300049571 | Ga0501034_0183218 | Ga0501034_0183218_280_1365 | 342 |
| 208 | 3300049572 | Ga0501036_0011150 | Ga0501036_0011150_1152_2237 | 342 |
| 209 | 3300049573 | Ga0501037_0006073 | Ga0501037_0006073_2936_4021 | 342 |
| 210 | 3300049574 | Ga0501038_0206002 | Ga0501038_0206002_155_1240 | 342 |
| 211 | 3300049575 | Ga0501039_0173481 | Ga0501039_0173481_440_1525 | 342 |
| 212 | 3300049580 | Ga0501046_0006444 | Ga0501046_0006444_6293_7378 | 342 |
| 213 | 3300049580 | Ga0501046_0055571 | Ga0501046_0055571_565_1650 | 342 |
| 214 | 3300049581 | Ga0501047_0022965 | Ga0501047_0022965_1041_2126 | 342 |
| 215 | 3300049582 | Ga0501048_0009602 | Ga0501048_0009602_3894_4979 | 342 |
| 216 | 3300049582 | Ga0501048_0011448 | Ga0501048_0011448_293_1378 | 342 |
| 217 | 3300049586 | Ga0501070_0000545 | Ga0501070_0000545_28555_29640 | 342 |
| 218 | 3300049589 | Ga0501073_0042005 | Ga0501073_0042005_2107_3192 | 342 |
| 219 | 3300049590 | Ga0501074_0036770 | Ga0501074_0036770_1628_2713 | 342 |
| 220 | 3300049591 | Ga0501075_0091578 | Ga0501075_0091578_970_2055 | 342 |
| 221 | 3300049592 | Ga0501076_0006752 | Ga0501076_0006752_6710_7795 | 342 |
| 222 | 3300049593 | Ga0501077_0010215 | Ga0501077_0010215_4635_5720 | 342 |
| 223 | 3300049741 | Ga0501079_0202523 | Ga0501079_0202523_339_1424 | 342 |
| 224 | 3300049743 | Ga0501081_0017097 | Ga0501081_0017097_292_1377 | 342 |
| 225 | 3300049822 | Ga0501035_0020032 | Ga0501035_0020032_3906_4991 | 342 |
| 226 | 3300049823 | Ga0501044_0008986 | Ga0501044_0008986_7608_8693 | 342 |
| 227 | 3300049824 | Ga0501045_0000424 | Ga0501045_0000424_11241_12326 | 342 |
| 228 | 3300006038 | Ga0075365_10001308 | Ga0075365_100013088 | 343 |
| 229 | 3300006186 | Ga0075369_10055197 | Ga0075369_100551972 | 343 |
| 230 | 3300009148 | Ga0105243_10218493 | Ga0105243_102184931 | 343 |
| 231 | 3300025294 | Ga0209025_1033669 | Ga0209025_10336692 | 343 |
| 232 | 3300025935 | Ga0207709_10320099 | Ga0207709_103200991 | 343 |
| 233 | 3300033179 | Ga0307507_10062572 | Ga0307507_100625724 | 343 |
| 234 | 3300041411 | Ga0439466_0008352 | Ga0439466_0008352_1684_2769 | 343 |
| 235 | 3300041411 | Ga0439466_0017501 | Ga0439466_0017501_766_1854 | 343 |
| 236 | 3300041413 | Ga0439465_0009387 | Ga0439465_0009387_1941_3026 | 343 |
| 237 | 3300041413 | Ga0439465_0013447 | Ga0439465_0013447_280_1368 | 343 |
| 238 | 3300041997 | Ga0439431_0001900 | Ga0439431_0001900_1415_2500 | 343 |
| 239 | 3300041997 | Ga0439431_0013019 | Ga0439431_0013019_410_1498 | 343 |
| 240 | 3300044683 | Ga0466965_0003350 | Ga0466965_0003350_2924_4012 | 343 |
| 241 | 3300044735 | Ga0466968_0067733 | Ga0466968_0067733_210_1328 | 343 |
| 242 | 3300044901 | Ga0466960_0001306 | Ga0466960_0001306_1648_2760 | 343 |
| 243 | 3300046460 | Ga0495638_0042428 | Ga0495638_0042428_147_1232 | 343 |
| 244 | 3300049577 | Ga0501041_0033840 | Ga0501041_0033840_1577_2662 | 343 |
| 245 | 3300050516 | nmdc:mga0sz30_8675_c1 | nmdc:mga0sz30_8675_c1_371_1459 | 343 |
| 246 | 3300053151 | Ga0500604_0061358 | Ga0500604_0061358_17_1102 | 343 |
| 247 | 3300002459 | JGI24751J29686_10005886 | JGI24751J29686_100058863 | 344 |
| 248 | 3300005335 | Ga0070666_10073811 | Ga0070666_100738112 | 344 |
| 249 | 3300005355 | Ga0070671_100005606 | Ga0070671_1000056063 | 344 |
| 250 | 3300005367 | Ga0070667_100002627 | Ga0070667_1000026276 | 344 |
| 251 | 3300005367 | Ga0070667_100186014 | Ga0070667_1001860142 | 344 |
| 252 | 3300005435 | Ga0070714_100208201 | Ga0070714_1002082012 | 344 |
| 253 | 3300005841 | Ga0068863_100009027 | Ga0068863_1000090272 | 344 |
| 254 | 3300005842 | Ga0068858_100136816 | Ga0068858_1001368163 | 344 |
| 255 | 3300005937 | Ga0081455_10154307 | Ga0081455_101543072 | 344 |
| 256 | 3300006038 | Ga0075365_10000659 | Ga0075365_100006594 | 344 |
| 257 | 3300006038 | Ga0075365_10002646 | Ga0075365_100026468 | 344 |
| 258 | 3300006042 | Ga0075368_10030599 | Ga0075368_100305992 | 344 |
| 259 | 3300006048 | Ga0075363_100001702 | Ga0075363_1000017026 | 344 |
| 260 | 3300006048 | Ga0075363_100029127 | Ga0075363_1000291272 | 344 |
| 261 | 3300006051 | Ga0075364_10001283 | Ga0075364_1000128311 | 344 |
| 262 | 3300006178 | Ga0075367_10023310 | Ga0075367_100233102 | 344 |
| 263 | 3300006186 | Ga0075369_10001022 | Ga0075369_100010225 | 344 |
| 264 | 3300006186 | Ga0075369_10065463 | Ga0075369_100654632 | 344 |
| 265 | 3300006353 | Ga0075370_10005701 | Ga0075370_100057016 | 344 |
| 266 | 3300006353 | Ga0075370_10073271 | Ga0075370_100732712 | 344 |
| 267 | 3300009545 | Ga0105237_10021898 | Ga0105237_100218983 | 344 |
| 268 | 3300009553 | Ga0105249_10105252 | Ga0105249_101052523 | 344 |
| 269 | 3300010375 | Ga0105239_10100856 | Ga0105239_101008563 | 344 |
| 270 | 3300014325 | Ga0163163_10047811 | Ga0163163_100478113 | 344 |
| 271 | 3300021384 | Ga0213876_10019281 | Ga0213876_100192814 | 344 |
| 272 | 3300025914 | Ga0207671_10011881 | Ga0207671_100118814 | 344 |
| 273 | 3300025916 | Ga0207663_10062061 | Ga0207663_100620611 | 344 |
| 274 | 3300025929 | Ga0207664_10085348 | Ga0207664_100853482 | 344 |
| 275 | 3300025931 | Ga0207644_10002286 | Ga0207644_1000228613 | 344 |
| 276 | 3300025981 | Ga0207640_10138911 | Ga0207640_101389112 | 344 |
| 277 | 3300025986 | Ga0207658_10005374 | Ga0207658_100053746 | 344 |
| 278 | 3300026035 | Ga0207703_10112284 | Ga0207703_101122842 | 344 |
| 279 | 3300026088 | Ga0207641_10003083 | Ga0207641_100030832 | 344 |
| 280 | 3300028379 | Ga0268266_10030514 | Ga0268266_100305143 | 344 |
| 281 | 3300028794 | Ga0307515_10059172 | Ga0307515_100591725 | 344 |
| 282 | 3300031911 | Ga0307412_10206466 | Ga0307412_102064662 | 344 |
| 283 | 3300039437 | Ga0436365_0967944 | Ga0436365_0967944_21723_22808 | 344 |
| 284 | 3300041411 | Ga0439466_0029435 | Ga0439466_0029435_746_1834 | 344 |
| 285 | 3300041413 | Ga0439465_0005793 | Ga0439465_0005793_1251_2339 | 344 |
| 286 | 3300042004 | Ga0439445_0035815 | Ga0439445_0035815_14_1102 | 344 |
| 287 | 3300042438 | Ga0439459_0016704 | Ga0439459_0016704_108_1193 | 344 |
| 288 | 3300044658 | Ga0466972_0004743 | Ga0466972_0004743_322_1407 | 344 |
| 289 | 3300044684 | Ga0466966_0025427 | Ga0466966_0025427_1035_2120 | 344 |
| 290 | 3300044719 | Ga0466971_0059298 | Ga0466971_0059298_32_1117 | 344 |
| 291 | 3300044765 | Ga0466970_0004702 | Ga0466970_0004702_3873_4958 | 344 |
| 292 | 3300044765 | Ga0466970_0034871 | Ga0466970_0034871_290_1378 | 344 |
| 293 | 3300044842 | Ga0466957_0038929 | Ga0466957_0038929_1035_2120 | 344 |
| 294 | 3300045049 | Ga0466959_0062948 | Ga0466959_0062948_444_1532 | 344 |
| 295 | 3300045976 | Ga0466967_0016168 | Ga0466967_0016168_2672_3757 | 344 |
| 296 | 3300045976 | Ga0466967_0016363 | Ga0466967_0016363_1454_2539 | 344 |
| 297 | 3300046616 | Ga0495668_0029479 | Ga0495668_0029479_721_1806 | 344 |
| 298 | 3300046692 | Ga0495671_0055975 | Ga0495671_0055975_303_1388 | 344 |
| 299 | 3300047320 | Ga0495672_0093185 | Ga0495672_0093185_81_1169 | 344 |
| 300 | 3300047469 | Ga0495673_0000941 | Ga0495673_0000941_18935_20020 | 344 |
| 301 | 3300048903 | Ga0496100_0000053 | Ga0496100_0000053_9251_10336 | 344 |
| 302 | 3300048903 | Ga0496100_0024885 | Ga0496100_0024885_1688_2773 | 344 |
| 303 | 3300048904 | Ga0496101_0000056 | Ga0496101_0000056_44517_45602 | 344 |
| 304 | 3300048904 | Ga0496101_0000057 | Ga0496101_0000057_18220_19305 | 344 |
| 305 | 3300048905 | Ga0496102_0000177 | Ga0496102_0000177_44741_45826 | 344 |
| 306 | 3300048905 | Ga0496102_0025685 | Ga0496102_0025685_387_1472 | 344 |
| 307 | 3300048905 | Ga0496102_0059491 | Ga0496102_0059491_2194_3282 | 344 |
| 308 | 3300048906 | Ga0496103_0000003 | Ga0496103_0000003_40899_41984 | 344 |
| 309 | 3300048907 | Ga0496104_0018629 | Ga0496104_0018629_5028_6116 | 344 |
| 310 | 3300048908 | Ga0496105_0016579 | Ga0496105_0016579_2801_3889 | 344 |
| 311 | 3300048910 | Ga0496107_0000167 | Ga0496107_0000167_23574_24659 | 344 |
| 312 | 3300048911 | Ga0496108_0209616 | Ga0496108_0209616_343_1428 | 344 |
| 313 | 3300048912 | Ga0496109_0000144 | Ga0496109_0000144_9105_10190 | 344 |
| 314 | 3300048912 | Ga0496109_0157025 | Ga0496109_0157025_58_1146 | 344 |
| 315 | 3300048912 | Ga0496109_0197435 | Ga0496109_0197435_716_1801 | 344 |
| 316 | 3300048913 | Ga0496110_0043249 | Ga0496110_0043249_1735_2820 | 344 |
| 317 | 3300048914 | Ga0496111_0042099 | Ga0496111_0042099_1823_2908 | 344 |
| 318 | 3300048914 | Ga0496111_0270507 | Ga0496111_0270507_66_1154 | 344 |
| 319 | 3300048916 | Ga0496113_0038302 | Ga0496113_0038302_112_1197 | 344 |
| 320 | 3300048917 | Ga0496114_0003438 | Ga0496114_0003438_6509_7594 | 344 |
| 321 | 3300048918 | Ga0496115_0021772 | Ga0496115_0021772_3722_4807 | 344 |
| 322 | 3300048919 | Ga0496116_0000013 | Ga0496116_0000013_562010_563095 | 344 |
| 323 | 3300048919 | Ga0496116_0002742 | Ga0496116_0002742_9251_10336 | 344 |
| 324 | 3300048920 | Ga0496117_0000013 | Ga0496117_0000013_40899_41984 | 344 |
| 325 | 3300048921 | Ga0496118_0000011 | Ga0496118_0000011_562012_563097 | 344 |
| 326 | 3300048923 | Ga0496120_0021133 | Ga0496120_0021133_90_1175 | 344 |
| 327 | 3300048924 | Ga0496121_0000060 | Ga0496121_0000060_185619_186704 | 344 |
| 328 | 3300048924 | Ga0496121_0000068 | Ga0496121_0000068_213285_214370 | 344 |
| 329 | 3300048925 | Ga0496122_0000085 | Ga0496122_0000085_100450_101535 | 344 |
| 330 | 3300048927 | Ga0496124_0000065 | Ga0496124_0000065_9225_10310 | 344 |
| 331 | 3300048928 | Ga0496125_0000008 | Ga0496125_0000008_490308_491393 | 344 |
| 332 | 3300048929 | Ga0496126_0000062 | Ga0496126_0000062_213285_214370 | 344 |
| 333 | 3300048929 | Ga0496126_0012696 | Ga0496126_0012696_5420_6505 | 344 |
| 334 | 3300048929 | Ga0496126_0037170 | Ga0496126_0037170_2100_3185 | 344 |
| 335 | 3300049569 | Ga0501032_0023150 | Ga0501032_0023150_1499_2584 | 344 |
| 336 | 3300049571 | Ga0501034_0055411 | Ga0501034_0055411_1496_2581 | 344 |
| 337 | 3300049572 | Ga0501036_0154847 | Ga0501036_0154847_426_1511 | 344 |
| 338 | 3300049579 | Ga0501043_0053426 | Ga0501043_0053426_343_1428 | 344 |
| 339 | 3300049579 | Ga0501043_0152801 | Ga0501043_0152801_435_1520 | 344 |
| 340 | 3300049580 | Ga0501046_0003598 | Ga0501046_0003598_1714_2799 | 344 |
| 341 | 3300049580 | Ga0501046_0143886 | Ga0501046_0143886_466_1551 | 344 |
| 342 | 3300049581 | Ga0501047_0024286 | Ga0501047_0024286_1930_3015 | 344 |
| 343 | 3300049581 | Ga0501047_0080758 | Ga0501047_0080758_1127_2212 | 344 |
| 344 | 3300049582 | Ga0501048_0020414 | Ga0501048_0020414_2033_3118 | 344 |
| 345 | 3300049583 | Ga0501067_0029600 | Ga0501067_0029600_1439_2539 | 344 |
| 346 | 3300049586 | Ga0501070_0015717 | Ga0501070_0015717_3291_4376 | 344 |
| 347 | 3300049588 | Ga0501072_0159443 | Ga0501072_0159443_563_1648 | 344 |
| 348 | 3300049822 | Ga0501035_0001215 | Ga0501035_0001215_12587_13672 | 344 |
| 349 | 3300049822 | Ga0501035_0028571 | Ga0501035_0028571_2266_3351 | 344 |
| 350 | 3300049823 | Ga0501044_0004709 | Ga0501044_0004709_1337_2422 | 344 |
| 351 | 3300049823 | Ga0501044_0007806 | Ga0501044_0007806_8945_10030 | 344 |
| 352 | 3300050490 | nmdc:mga03n38_5425_c1 | nmdc:mga03n38_5425_c1_1306_2391 | 344 |
| 353 | 3300050491 | nmdc:mga00v17_151559_c1 | nmdc:mga00v17_151559_c1_182_1267 | 344 |
| 354 | 3300050491 | nmdc:mga00v17_2428_c1 | nmdc:mga00v17_2428_c1_5210_6295 | 344 |
| 355 | 3300050492 | nmdc:mga0yw44_18593_c1 | nmdc:mga0yw44_18593_c1_1762_2847 | 344 |
| 356 | 3300050492 | nmdc:mga0yw44_4222_c1 | nmdc:mga0yw44_4222_c1_1565_2650 | 344 |
| 357 | 3300050496 | nmdc:mga07m45_105225_c1 | nmdc:mga07m45_105225_c1_465_1550 | 344 |
| 358 | 3300050496 | nmdc:mga07m45_6192_c1 | nmdc:mga07m45_6192_c1_3373_4458 | 344 |
| 359 | 3300050496 | nmdc:mga07m45_7450_c1 | nmdc:mga07m45_7450_c1_1787_2872 | 344 |
| 360 | 3300050516 | nmdc:mga0sz30_88316_c1 | nmdc:mga0sz30_88316_c1_201_1286 | 344 |
| 361 | 3300053087 | Ga0500643_001717 | Ga0500643_001717_10266_11351 | 344 |
| 362 | 3300053087 | Ga0500643_016514 | Ga0500643_016514_1227_2312 | 344 |
| 363 | 3300053158 | Ga0500627_0015515 | Ga0500627_0015515_159_1244 | 344 |
| 364 | 3300061719 | Ga0466962_0027202 | Ga0466962_0027202_452_1537 | 344 |
| 365 | 3300031852 | Ga0307410_10279282 | Ga0307410_102792821 | 345 |
| 366 | 3300035207 | Ga0373942_0024478 | Ga0373942_0024478_313_1410 | 345 |
| 367 | 3300041512 | Ga0451853_0541938 | Ga0451853_0541938_5920_7008 | 345 |
| 368 | 3300045976 | Ga0466967_0159873 | Ga0466967_0159873_303_1400 | 345 |
| 369 | 3300046514 | Ga0495618_0029051 | Ga0495618_0029051_711_1796 | 346 |
| 370 | 3300046516 | Ga0495628_0009680 | Ga0495628_0009680_1544_2629 | 346 |
| 371 | 3300048905 | Ga0496102_0043506 | Ga0496102_0043506_1609_2697 | 346 |
| 372 | 3300048908 | Ga0496105_0004900 | Ga0496105_0004900_8417_9505 | 346 |
| 373 | 3300048918 | Ga0496115_0001472 | Ga0496115_0001472_9673_10761 | 346 |
| 374 | 3300053077 | Ga0495601_0015329 | Ga0495601_0015329_2042_3127 | 346 |
| 375 | 3300044901 | Ga0466960_0001280 | Ga0466960_0001280_2698_3843 | 347 |
| 376 | 3300046462 | Ga0495651_0038183 | Ga0495651_0038183_2308_3393 | 347 |
| 377 | 3300046529 | Ga0495652_0019766 | Ga0495652_0019766_3591_4676 | 347 |
| 378 | 3300046809 | Ga0495600_0007742 | Ga0495600_0007742_2794_3879 | 347 |
| 379 | 3300047317 | Ga0495604_0106833 | Ga0495604_0106833_432_1517 | 347 |
| 380 | 3300048911 | Ga0496108_0012895 | Ga0496108_0012895_728_1813 | 347 |
| 381 | 3300005548 | Ga0070665_100051956 | Ga0070665_1000519563 | 348 |
| 382 | 3300005563 | Ga0068855_100022328 | Ga0068855_1000223282 | 348 |
| 383 | 3300009093 | Ga0105240_10152936 | Ga0105240_101529362 | 348 |
| 384 | 3300009174 | Ga0105241_10000752 | Ga0105241_1000075210 | 348 |
| 385 | 3300009545 | Ga0105237_10201774 | Ga0105237_102017742 | 348 |
| 386 | 3300009551 | Ga0105238_10110895 | Ga0105238_101108952 | 348 |
| 387 | 3300010375 | Ga0105239_10164051 | Ga0105239_101640512 | 348 |
| 388 | 3300025913 | Ga0207695_10000994 | Ga0207695_1000099429 | 348 |
| 389 | 3300025914 | Ga0207671_10000748 | Ga0207671_1000074842 | 348 |
| 390 | 3300025924 | Ga0207694_10058904 | Ga0207694_100589042 | 348 |
| 391 | 3300025949 | Ga0207667_10149787 | Ga0207667_101497872 | 348 |
| 392 | 3300026121 | Ga0207683_10088104 | Ga0207683_100881042 | 348 |
| 393 | 3300026142 | Ga0207698_10073095 | Ga0207698_100730952 | 348 |
| 394 | 3300039062 | Ga0400483_012695 | Ga0400483_012695_266_1330 | 348 |
| 395 | 3300044658 | Ga0466972_0023072 | Ga0466972_0023072_1346_2449 | 348 |
| 396 | 3300044683 | Ga0466965_0039860 | Ga0466965_0039860_134_1237 | 348 |
| 397 | 3300044693 | Ga0466961_0100599 | Ga0466961_0100599_54_1157 | 348 |
| 398 | 3300044842 | Ga0466957_0049687 | Ga0466957_0049687_787_1890 | 348 |
| 399 | 3300045976 | Ga0466967_0075917 | Ga0466967_0075917_894_1997 | 348 |
| 400 | 3300049570 | Ga0501033_0185908 | Ga0501033_0185908_166_1251 | 348 |
| 401 | 3300049572 | Ga0501036_0318333 | Ga0501036_0318333_49_1134 | 348 |
| 402 | 3300049583 | Ga0501067_0008339 | Ga0501067_0008339_3183_4268 | 348 |
| 403 | 3300049590 | Ga0501074_0013440 | Ga0501074_0013440_3368_4453 | 348 |
| 404 | 3300049593 | Ga0501077_0144259 | Ga0501077_0144259_51_1136 | 348 |
| 405 | 3300049742 | Ga0501080_0248399 | Ga0501080_0248399_514_1599 | 348 |
| 406 | 3300060353 | Ga0501082_0196789 | Ga0501082_0196789_290_1375 | 348 |
| 407 | 3300005438 | Ga0070701_10172094 | Ga0070701_101720941 | 349 |
| 408 | 3300044684 | Ga0466966_0088999 | Ga0466966_0088999_428_1531 | 349 |
| 409 | 3300049585 | Ga0501069_0006522 | Ga0501069_0006522_2956_4041 | 349 |
| 410 | iso_pu_bacteria | 2897561785 | 2897563574 | 350 |
| 411 | 3300044694 | Ga0466963_0203533 | Ga0466963_0203533_180_1292 | 351 |
| 412 | 3300044719 | Ga0466971_0051425 | Ga0466971_0051425_574_1686 | 351 |
| 413 | 3300044901 | Ga0466960_0048628 | Ga0466960_0048628_448_1560 | 351 |
| 414 | iso_pu_bacteria | 2643221561 | 2643824167 | 351 |
| 415 | iso_pu_bacteria | 2643221567 | 2643851580 | 351 |
| 416 | iso_pu_bacteria | 2643221624 | 2644137830 | 351 |
| 417 | iso_pu_bacteria | 2643221696 | 2644533473 | 351 |
| 418 | iso_pu_bacteria | 2816332139 | 2816509790 | 351 |
| 419 | iso_pu_bacteria | 2866612099 | 2866613047 | 351 |
| 420 | iso_pu_bacteria | 2954691527 | 2954692064 | 351 |
| 421 | iso_pu_bacteria | 2954701450 | 2954707131 | 351 |
| 422 | iso_pu_bacteria | 3006493962 | 3006494958 | 351 |
| 423 | iso_pu_bacteria | 8048127548 | 8048137320 | 351 |
| 424 | iso_pu_bacteria | 8054609563 | 8054610431 | 351 |
| 425 | iso_pu_bacteria | 8057568493 | 8057568799 | 351 |
| 426 | iso_pu_bacteria | 2565956761 | 2566993955 | 352 |
| 427 | iso_pu_bacteria | 2643221615 | 2644091577 | 352 |
| 428 | iso_pu_bacteria | 2643221657 | 2644321380 | 352 |
| 429 | iso_pu_bacteria | 2643221715 | 2644638552 | 352 |
| 430 | iso_pu_bacteria | 2738541308 | 2738889160 | 352 |
| 431 | iso_pu_bacteria | 2738543005 | 2739202413 | 352 |
| 432 | iso_pu_bacteria | 2738543011 | 2739239660 | 352 |
| 433 | iso_pu_bacteria | 2738543034 | 2739362014 | 352 |
| 434 | iso_pu_bacteria | 2738543034 | 2739363365 | 352 |
| 435 | iso_pu_bacteria | 2808606439 | 2809193801 | 352 |
| 436 | iso_pu_bacteria | 2842888712 | 2842890370 | 352 |
| 437 | iso_pu_bacteria | 2887443736 | 2887446204 | 352 |
| 438 | iso_pu_bacteria | 2889300758 | 2889304663 | 352 |
| 439 | iso_pu_bacteria | 2899370129 | 2899371586 | 352 |
| 440 | iso_pu_bacteria | 2902810491 | 2902812540 | 352 |
| 441 | iso_pu_bacteria | 2904535858 | 2904537003 | 352 |
| 442 | iso_pu_bacteria | 2904765812 | 2904770244 | 352 |
| 443 | iso_pu_bacteria | 2908811453 | 2908815613 | 352 |
| 444 | iso_pu_bacteria | 2908811453 | 2908816356 | 352 |
| 445 | iso_pu_bacteria | 2908811453 | 2908816433 | 352 |
| 446 | iso_pu_bacteria | 2919420072 | 2919421633 | 352 |
| 447 | iso_pu_bacteria | 2919432681 | 2919434809 | 352 |
| 448 | iso_pu_bacteria | 2922554459 | 2922559624 | 352 |
| 449 | iso_pu_bacteria | 2928142448 | 2928143374 | 352 |
| 450 | iso_pu_bacteria | 2932398195 | 2932398871 | 352 |
| 451 | iso_pu_bacteria | 2939582691 | 2939584432 | 352 |
| 452 | iso_pu_bacteria | 2939743619 | 2939744951 | 352 |
| 453 | iso_pu_bacteria | 2956939328 | 2956941773 | 352 |
| 454 | iso_pu_bacteria | 3001119090 | 3001119133 | 352 |
| 455 | 3300005334 | Ga0068869_100052604 | Ga0068869_1000526042 | 353 |
| 456 | 3300005336 | Ga0070680_100094379 | Ga0070680_1000943792 | 353 |
| 457 | 3300005339 | Ga0070660_100223257 | Ga0070660_1002232572 | 353 |
| 458 | 3300005364 | Ga0070673_100218806 | Ga0070673_1002188062 | 353 |
| 459 | 3300005458 | Ga0070681_10069638 | Ga0070681_100696382 | 353 |
| 460 | 3300005459 | Ga0068867_100140733 | Ga0068867_1001407332 | 353 |
| 461 | 3300005530 | Ga0070679_100017913 | Ga0070679_1000179136 | 353 |
| 462 | 3300005719 | Ga0068861_100044974 | Ga0068861_1000449743 | 353 |
| 463 | 3300005834 | Ga0068851_10068449 | Ga0068851_100684492 | 353 |
| 464 | 3300005843 | Ga0068860_100298525 | Ga0068860_1002985252 | 353 |
| 465 | 3300005981 | Ga0081538_10078148 | Ga0081538_100781482 | 353 |
| 466 | 3300009988 | Ga0105035_101219 | Ga0105035_1012192 | 353 |
| 467 | 3300013296 | Ga0157374_10155123 | Ga0157374_101551233 | 353 |
| 468 | 3300013306 | Ga0163162_10138478 | Ga0163162_101384781 | 353 |
| 469 | 3300017792 | Ga0163161_10046687 | Ga0163161_100466872 | 353 |
| 470 | 3300025901 | Ga0207688_10010961 | Ga0207688_100109616 | 353 |
| 471 | 3300025901 | Ga0207688_10035646 | Ga0207688_100356463 | 353 |
| 472 | 3300025907 | Ga0207645_10009258 | Ga0207645_100092585 | 353 |
| 473 | 3300025909 | Ga0207705_10060292 | Ga0207705_100602924 | 353 |
| 474 | 3300025917 | Ga0207660_10071919 | Ga0207660_100719192 | 353 |
| 475 | 3300025919 | Ga0207657_10178659 | Ga0207657_101786591 | 353 |
| 476 | 3300025931 | Ga0207644_10097546 | Ga0207644_100975463 | 353 |
| 477 | 3300025937 | Ga0207669_10016078 | Ga0207669_100160785 | 353 |
| 478 | 3300025940 | Ga0207691_10037078 | Ga0207691_100370786 | 353 |
| 479 | 3300025941 | Ga0207711_10325974 | Ga0207711_103259742 | 353 |
| 480 | 3300025942 | Ga0207689_10007513 | Ga0207689_100075138 | 353 |
| 481 | 3300026067 | Ga0207678_10048580 | Ga0207678_100485805 | 353 |
| 482 | 3300026089 | Ga0207648_10146157 | Ga0207648_101461572 | 353 |
| 483 | 3300026116 | Ga0207674_10111368 | Ga0207674_101113682 | 353 |
| 484 | 3300026118 | Ga0207675_100117645 | Ga0207675_1001176451 | 353 |
| 485 | 3300026121 | Ga0207683_10092432 | Ga0207683_100924324 | 353 |
| 486 | 3300026142 | Ga0207698_10017391 | Ga0207698_100173916 | 353 |
| 487 | 3300031616 | Ga0307508_10021893 | Ga0307508_100218933 | 353 |
| 488 | 3300031824 | Ga0307413_10000126 | Ga0307413_1000012613 | 353 |
| 489 | 3300032002 | Ga0307416_100148697 | Ga0307416_1001486972 | 353 |
| 490 | 3300037853 | Ga0436364_1519819 | Ga0436364_1519819_11494_12639 | 353 |
| 491 | 3300038735 | Ga0400485_18483 | Ga0400485_18483_1543_2628 | 353 |
| 492 | 3300044693 | Ga0466961_0038074 | Ga0466961_0038074_591_1676 | 353 |
| 493 | 3300044694 | Ga0466963_0062109 | Ga0466963_0062109_318_1403 | 353 |
| 494 | 3300044719 | Ga0466971_0014851 | Ga0466971_0014851_821_1906 | 353 |
| 495 | 3300044765 | Ga0466970_0028789 | Ga0466970_0028789_982_2082 | 353 |
| 496 | 3300044901 | Ga0466960_0007000 | Ga0466960_0007000_85_1167 | 353 |
| 497 | 3300045049 | Ga0466959_0036002 | Ga0466959_0036002_2068_3153 | 353 |
| 498 | 3300046454 | Ga0495592_0006810 | Ga0495592_0006810_593_1678 | 353 |
| 499 | 3300046455 | Ga0495603_0012208 | Ga0495603_0012208_1224_2309 | 353 |
| 500 | 3300046459 | Ga0495629_0004434 | Ga0495629_0004434_5149_6234 | 353 |
| 501 | 3300046462 | Ga0495651_0004389 | Ga0495651_0004389_4901_5986 | 353 |
| 502 | 3300046463 | Ga0495653_0001578 | Ga0495653_0001578_15601_16686 | 353 |
| 503 | 3300046472 | Ga0495580_0021072 | Ga0495580_0021072_58_1143 | 353 |
| 504 | 3300046476 | Ga0495662_0000347 | Ga0495662_0000347_16438_17523 | 353 |
| 505 | 3300046477 | Ga0495664_0000303 | Ga0495664_0000303_5950_7035 | 353 |
| 506 | 3300046492 | Ga0495585_0047115 | Ga0495585_0047115_315_1400 | 353 |
| 507 | 3300046499 | Ga0495594_0002274 | Ga0495594_0002274_3022_4107 | 353 |
| 508 | 3300046511 | Ga0495608_0000841 | Ga0495608_0000841_1804_2889 | 353 |
| 509 | 3300046515 | Ga0495620_0025476 | Ga0495620_0025476_346_1431 | 353 |
| 510 | 3300046516 | Ga0495628_0001628 | Ga0495628_0001628_9475_10560 | 353 |
| 511 | 3300046517 | Ga0495630_0025647 | Ga0495630_0025647_2224_3309 | 353 |
| 512 | 3300046526 | Ga0495666_0001587 | Ga0495666_0001587_1714_2799 | 353 |
| 513 | 3300046526 | Ga0495666_0002305 | Ga0495666_0002305_5190_6275 | 353 |
| 514 | 3300046529 | Ga0495652_0024632 | Ga0495652_0024632_1238_2323 | 353 |
| 515 | 3300046535 | Ga0495586_0006495 | Ga0495586_0006495_2800_3885 | 353 |
| 516 | 3300046536 | Ga0495587_0046167 | Ga0495587_0046167_1345_2430 | 353 |
| 517 | 3300046543 | Ga0495645_0003244 | Ga0495645_0003244_3842_4927 | 353 |
| 518 | 3300046557 | Ga0495622_0001218 | Ga0495622_0001218_9186_10271 | 353 |
| 519 | 3300046559 | Ga0495667_0009494 | Ga0495667_0009494_3002_4087 | 353 |
| 520 | 3300046642 | Ga0495634_0090889 | Ga0495634_0090889_503_1588 | 353 |
| 521 | 3300046663 | Ga0495635_0007609 | Ga0495635_0007609_5128_6213 | 353 |
| 522 | 3300046674 | Ga0495588_0014711 | Ga0495588_0014711_868_2022 | 353 |
| 523 | 3300046678 | Ga0495599_0009966 | Ga0495599_0009966_1110_2195 | 353 |
| 524 | 3300046679 | Ga0495623_0013299 | Ga0495623_0013299_3623_4708 | 353 |
| 525 | 3300046680 | Ga0495646_0007078 | Ga0495646_0007078_3840_4925 | 353 |
| 526 | 3300046689 | Ga0495613_0001143 | Ga0495613_0001143_13357_14442 | 353 |
| 527 | 3300046690 | Ga0495624_0002611 | Ga0495624_0002611_3132_4217 | 353 |
| 528 | 3300046794 | Ga0495589_0011588 | Ga0495589_0011588_418_1503 | 353 |
| 529 | 3300046809 | Ga0495600_0091640 | Ga0495600_0091640_503_1588 | 353 |
| 530 | 3300046810 | Ga0495660_0114230 | Ga0495660_0114230_32_1117 | 353 |
| 531 | 3300047317 | Ga0495604_0003188 | Ga0495604_0003188_3842_4927 | 353 |
| 532 | 3300047319 | Ga0495674_0005877 | Ga0495674_0005877_8809_9894 | 353 |
| 533 | 3300047321 | Ga0495676_0011711 | Ga0495676_0011711_5474_6559 | 353 |
| 534 | 3300047444 | Ga0495675_0009417 | Ga0495675_0009417_1370_2455 | 353 |
| 535 | 3300048089 | Ga0495614_0016363 | Ga0495614_0016363_1576_2661 | 353 |
| 536 | 3300048089 | Ga0495614_0056341 | Ga0495614_0056341_351_1475 | 353 |
| 537 | 3300048911 | Ga0496108_0096397 | Ga0496108_0096397_124_1209 | 353 |
| 538 | 3300048913 | Ga0496110_0159956 | Ga0496110_0159956_41_1138 | 353 |
| 539 | 3300053077 | Ga0495601_0006119 | Ga0495601_0006119_3112_4197 | 353 |
| 540 | 3300053078 | Ga0495612_0069122 | Ga0495612_0069122_299_1384 | 353 |
| 541 | 3300001977 | JGI24746J21847_1002752 | JGI24746J21847_10027522 | 354 |
| 542 | 3300002077 | JGI24744J21845_10002772 | JGI24744J21845_100027722 | 354 |
| 543 | 3300005937 | Ga0081455_10000123 | Ga0081455_100001239 | 354 |
| 544 | 3300006038 | Ga0075365_10008080 | Ga0075365_100080804 | 354 |
| 545 | 3300006844 | Ga0075428_100016876 | Ga0075428_1000168769 | 354 |
| 546 | 3300009148 | Ga0105243_10000943 | Ga0105243_1000094316 | 354 |
| 547 | 3300025935 | Ga0207709_10001543 | Ga0207709_1000154312 | 354 |
| 548 | 3300026067 | Ga0207678_10200312 | Ga0207678_102003122 | 354 |
| 549 | 3300031838 | Ga0307518_10005276 | Ga0307518_100052762 | 354 |
| 550 | 3300044684 | Ga0466966_0014101 | Ga0466966_0014101_3451_4539 | 354 |
| 551 | 3300046473 | Ga0495582_0106358 | Ga0495582_0106358_42_1136 | 354 |
| 552 | 3300046616 | Ga0495668_0000161 | Ga0495668_0000161_35642_36730 | 354 |
| 553 | 3300048928 | Ga0496125_0006840 | Ga0496125_0006840_7625_8713 | 354 |
| 554 | 3300049569 | Ga0501032_0038617 | Ga0501032_0038617_1998_3089 | 354 |
| 555 | 3300049571 | Ga0501034_0002539 | Ga0501034_0002539_9908_10999 | 354 |
| 556 | 3300049573 | Ga0501037_0006561 | Ga0501037_0006561_4021_5112 | 354 |
| 557 | 3300049574 | Ga0501038_0023272 | Ga0501038_0023272_4310_5401 | 354 |
| 558 | 3300049575 | Ga0501039_0004016 | Ga0501039_0004016_1089_2180 | 354 |
| 559 | 3300049579 | Ga0501043_0002178 | Ga0501043_0002178_11031_12122 | 354 |
| 560 | 3300049586 | Ga0501070_0000482 | Ga0501070_0000482_19174_20265 | 354 |
| 561 | 3300049589 | Ga0501073_0023699 | Ga0501073_0023699_2482_3573 | 354 |
| 562 | 3300049823 | Ga0501044_0015695 | Ga0501044_0015695_3871_4962 | 354 |
| 563 | 3300061719 | Ga0466962_0061638 | Ga0466962_0061638_685_1773 | 354 |
| 564 | 3300031548 | Ga0307408_100075340 | Ga0307408_1000753403 | 355 |
| 565 | 3300032002 | Ga0307416_100346188 | Ga0307416_1003461882 | 355 |
| 566 | iso_pu_bacteria | 2643221641 | 2644229232 | 356 |
| 567 | iso_pu_bacteria | 2739367898 | 2740167168 | 356 |
| 568 | iso_pu_bacteria | 2855386786 | 2855390289 | 356 |
| 569 | 3300000549 | LJQas_1001482 | LJQas_10014823 | 360 |
| 570 | 3300005435 | Ga0070714_100003328 | Ga0070714_10000332810 | 360 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tnx-assembly1.cif.gz_A | crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria | 0.9289 | 2 | 360 |
| 1ju9-assembly1.cif.gz_B | horse liver alcohol dehydrogenase val292ser mutant | 0.9279 | 2 | 360 |
| 1agn-assembly1.cif.gz_A | x-ray structure of human sigma alcohol dehydrogenase | 0.9253 | 2 | 360 |
| 1htb-assembly1.cif.gz_B | crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c | 0.925 | 2 | 360 |
| 1a72-assembly1.cif.gz_A-2 | an active-site double mutant (phe93->trp, val203->ala) of horse liver alcohol dehydrogenase in complex with the isosteric nad analog cpad | 0.9242 | 2 | 360 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53533_167_304_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9748 | 170 | 303 | 3.90.180.10 |
| af_B4G1G0_229_356_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9428 | 178 | 296 | 3.40.50.720 |
| 5tnxA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9409 | 170 | 302 | 3.40.50.720 |
| af_O53533_167_304_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9401 | 170 | 303 | 3.90.180.10 |
| af_A1L4Y2_14_383_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9326 | 8 | 354 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3IJT7-F1-model_v4 | deleted | 0.9853 | 144 | 360 |
|
| AF-A0A6B3HDC4-F1-model_v4 | Zinc-binding dehydrogenase | 0.9803 | 183 | 330 |
|
| AF-Q9ZNB1-F1-model_v4 | Alcohol dehydrogenase | 0.974 | 2 | 252 |
GO:0005829
GO:0008270 GO:0046294 GO:0051903 |
| AF-A0A0Q9N0K0-F1-model_v4 | S-(Hydroxymethyl)mycothiol dehydrogenase | 0.9675 | 2 | 360 |
GO:0008270
GO:0016491 |
| AF-A0A0Q9N0K0-F1-model_v4 | S-(Hydroxymethyl)mycothiol dehydrogenase | 0.9622 | 2 | 360 |
GO:0008270
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar