F464746
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 263 | 569 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300042142|Ga0450905_006481|Ga0450905_006481_564_1517 |
| Length | 317 |
| Sequence | VKVAYWPGCVSRGFTPELHGSMAKVAPLLDIELVELDRACCTGAGVIAEHNQELADTLNARTFALAQQEIANGADLMMNICSTCQGAQSECQERLDANSEYRAHVNETLSTEGLTYEKGIANKHFLWLMVEEIGLDAIRAKVQRPLTDLRVGPFYGCYIVRPTTRLNIDEEHPRDRYLHRLIEALGGTVVDYAGAYKCCGFPIITMNKQASLMQAGTHLGDAADAEADCLVTPCPLCHLNLDLQQPLAEQVVGRPLNMPVLHLPQLVGLAFGLDPKELGLNRHVVKPTSVIDWSTSVVAGVGGSDERAGSHAASGGW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 86 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 149 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 153 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 167 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 168 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 169 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 170 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 171 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 172 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 173 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 174 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 175 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 180 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 181 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 182 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 260 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 263 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0.7 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 12.48 |
| Rhizosphere | 78.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10045758 | 3300001990 | Bacteria | 1336 |
| 2 | JGI25406J46586_10028559 | 3300003203 | Bacteria | 2124 |
| 3 | Ga0070683_100029285 | 3300005329 | Bacteria | 4983 |
| 4 | Ga0070683_100151150 | 3300005329 | Bacteria | 2201 |
| 5 | Ga0070683_100436438 | 3300005329 | Bacteria | 1249 |
| 6 | Ga0070690_100107249 | 3300005330 | Bacteria | 1859 |
| 7 | Ga0070670_100172440 | 3300005331 | Bacteria | 1877 |
| 8 | Ga0070680_100481573 | 3300005336 | Bacteria | 1061 |
| 9 | Ga0068868_100158574 | 3300005338 | Bacteria | 1867 |
| 10 | Ga0070660_100296041 | 3300005339 | Bacteria | 1326 |
| 11 | Ga0070660_100326172 | 3300005339 | Bacteria | 1262 |
| 12 | Ga0070691_10010760 | 3300005341 | Bacteria | 4175 |
| 13 | Ga0070687_100008299 | 3300005343 | Bacteria | 4390 |
| 14 | Ga0070668_100040383 | 3300005347 | Bacteria | 3570 |
| 15 | Ga0070669_100007861 | 3300005353 | Bacteria | 7624 |
| 16 | Ga0070675_100643862 | 3300005354 | Bacteria | 963 |
| 17 | Ga0070671_100367354 | 3300005355 | Bacteria | 1229 |
| 18 | Ga0070659_100000958 | 3300005366 | Bacteria | 21249 |
| 19 | Ga0070659_100165836 | 3300005366 | Bacteria | 1807 |
| 20 | Ga0070709_10284102 | 3300005434 | Bacteria | 1204 |
| 21 | Ga0070714_100001248 | 3300005435 | Bacteria | 18354 |
| 22 | Ga0070714_100045891 | 3300005435 | Bacteria | 3705 |
| 23 | Ga0070714_100133597 | 3300005435 | Bacteria | 2219 |
| 24 | Ga0070714_100281445 | 3300005435 | Bacteria | 1545 |
| 25 | Ga0070714_100303139 | 3300005435 | Bacteria | 1490 |
| 26 | Ga0070713_100107730 | 3300005436 | Bacteria | 2425 |
| 27 | Ga0070710_10000001 | 3300005437 | Bacteria | 552187 |
| 28 | Ga0070710_10004895 | 3300005437 | Bacteria | 6338 |
| 29 | Ga0070701_10070592 | 3300005438 | Bacteria | 1866 |
| 30 | Ga0070711_100000697 | 3300005439 | Bacteria | 17598 |
| 31 | Ga0070705_100001031 | 3300005440 | Bacteria | 15524 |
| 32 | Ga0070700_100023295 | 3300005441 | Bacteria | 3620 |
| 33 | Ga0070700_100033379 | 3300005441 | Bacteria | 3099 |
| 34 | Ga0070694_100146229 | 3300005444 | Bacteria | 1722 |
| 35 | Ga0070663_100134882 | 3300005455 | Bacteria | 1879 |
| 36 | Ga0070678_100150902 | 3300005456 | Bacteria | 1872 |
| 37 | Ga0070678_100276750 | 3300005456 | Bacteria | 1418 |
| 38 | Ga0068867_100064997 | 3300005459 | Bacteria | 2713 |
| 39 | Ga0070685_10168846 | 3300005466 | Bacteria | 1401 |
| 40 | Ga0070707_100322244 | 3300005468 | Bacteria | 1502 |
| 41 | Ga0070684_100108879 | 3300005535 | Bacteria | 2483 |
| 42 | Ga0070684_100124234 | 3300005535 | Bacteria | 2323 |
| 43 | Ga0070684_100144156 | 3300005535 | Bacteria | 2155 |
| 44 | Ga0070672_100118094 | 3300005543 | Bacteria | 2169 |
| 45 | Ga0070686_100068730 | 3300005544 | Bacteria | 2311 |
| 46 | Ga0070665_100005111 | 3300005548 | Bacteria | 13604 |
| 47 | Ga0070665_100099732 | 3300005548 | Bacteria | 2909 |
| 48 | Ga0070664_100020034 | 3300005564 | Bacteria | 5507 |
| 49 | Ga0070664_100052463 | 3300005564 | Bacteria | 3454 |
| 50 | Ga0068857_100143996 | 3300005577 | Bacteria | 2156 |
| 51 | Ga0068857_100165735 | 3300005577 | Bacteria | 2007 |
| 52 | Ga0068857_100412062 | 3300005577 | Bacteria | 1259 |
| 53 | Ga0068857_100414692 | 3300005577 | Bacteria | 1255 |
| 54 | Ga0068857_100503704 | 3300005577 | Bacteria | 1137 |
| 55 | Ga0068854_100075484 | 3300005578 | Bacteria | 2475 |
| 56 | Ga0068856_100031094 | 3300005614 | Bacteria | 5221 |
| 57 | Ga0068856_100089582 | 3300005614 | Bacteria | 3059 |
| 58 | Ga0068856_100235829 | 3300005614 | Bacteria | 1845 |
| 59 | Ga0070702_100012690 | 3300005615 | Bacteria | 4233 |
| 60 | Ga0068852_100181069 | 3300005616 | Bacteria | 1982 |
| 61 | Ga0068859_100316003 | 3300005617 | Bacteria | 1656 |
| 62 | Ga0068864_100008699 | 3300005618 | Bacteria | 8376 |
| 63 | Ga0068861_100022634 | 3300005719 | Bacteria | 4530 |
| 64 | Ga0068861_100090520 | 3300005719 | Bacteria | 2413 |
| 65 | Ga0068861_100109208 | 3300005719 | Bacteria | 2214 |
| 66 | Ga0068861_100177113 | 3300005719 | Bacteria | 1772 |
| 67 | Ga0068851_10106353 | 3300005834 | Bacteria | 1494 |
| 68 | Ga0068870_10090393 | 3300005840 | Bacteria | 1710 |
| 69 | Ga0068870_10129839 | 3300005840 | Bacteria | 1462 |
| 70 | Ga0068858_100446652 | 3300005842 | Bacteria | 1246 |
| 71 | Ga0068860_100259450 | 3300005843 | Bacteria | 1694 |
| 72 | Ga0068862_100224309 | 3300005844 | Bacteria | 1702 |
| 73 | Ga0081455_10040966 | 3300005937 | Bacteria | 4080 |
| 74 | Ga0081455_10082621 | 3300005937 | Bacteria | 2627 |
| 75 | Ga0081455_10139900 | 3300005937 | Bacteria | 1881 |
| 76 | Ga0081455_10179257 | 3300005937 | Bacteria | 1606 |
| 77 | Ga0081538_10023034 | 3300005981 | Bacteria | 4489 |
| 78 | Ga0081538_10035305 | 3300005981 | Bacteria | 3286 |
| 79 | Ga0081540_1003705 | 3300005983 | Bacteria | 11972 |
| 80 | Ga0081540_1024344 | 3300005983 | Bacteria | 3515 |
| 81 | Ga0081540_1043050 | 3300005983 | Bacteria | 2321 |
| 82 | Ga0081539_10003887 | 3300005985 | Bacteria | 17435 |
| 83 | Ga0081539_10010609 | 3300005985 | Bacteria | 7442 |
| 84 | Ga0081539_10024574 | 3300005985 | Bacteria | 3904 |
| 85 | Ga0070717_10000010 | 3300006028 | Bacteria | 283501 |
| 86 | Ga0070717_10079271 | 3300006028 | Bacteria | 2753 |
| 87 | Ga0070717_10090633 | 3300006028 | Bacteria | 2580 |
| 88 | Ga0075365_10139442 | 3300006038 | Bacteria | 1683 |
| 89 | Ga0070715_10044048 | 3300006163 | Bacteria | 1885 |
| 90 | Ga0070712_100000009 | 3300006175 | Bacteria | 143615 |
| 91 | Ga0070712_100018606 | 3300006175 | Bacteria | 4515 |
| 92 | Ga0070712_100236609 | 3300006175 | Bacteria | 1453 |
| 93 | Ga0075428_100114672 | 3300006844 | Bacteria | 2935 |
| 94 | Ga0075428_100146556 | 3300006844 | Bacteria | 2566 |
| 95 | Ga0075430_100020474 | 3300006846 | Bacteria | 5627 |
| 96 | Ga0075433_10024129 | 3300006852 | Bacteria | 5128 |
| 97 | Ga0068865_100053887 | 3300006881 | Bacteria | 2792 |
| 98 | Ga0075436_100083489 | 3300006914 | Bacteria | 2216 |
| 99 | Ga0097620_100316028 | 3300006931 | Bacteria | 1656 |
| 100 | Ga0075435_100087828 | 3300007076 | Bacteria | 2562 |
| 101 | Ga0075435_100241675 | 3300007076 | Bacteria | 1536 |
| 102 | Ga0105251_10088946 | 3300009011 | Bacteria | 1420 |
| 103 | Ga0105240_10015687 | 3300009093 | Bacteria | 10285 |
| 104 | Ga0105240_10052389 | 3300009093 | Bacteria | 5131 |
| 105 | Ga0105240_10465592 | 3300009093 | Bacteria | 1411 |
| 106 | Ga0105240_10731293 | 3300009093 | Bacteria | 1077 |
| 107 | Ga0111539_10170388 | 3300009094 | Bacteria | 2544 |
| 108 | Ga0111539_10341189 | 3300009094 | Bacteria | 1744 |
| 109 | Ga0105245_10039725 | 3300009098 | Bacteria | 4188 |
| 110 | Ga0114129_10929594 | 3300009147 | Unclassified | 1100 |
| 111 | Ga0105243_10074830 | 3300009148 | Bacteria | 2747 |
| 112 | Ga0105243_10089259 | 3300009148 | Bacteria | 2534 |
| 113 | Ga0105243_10110628 | 3300009148 | Bacteria | 2298 |
| 114 | Ga0105248_10648031 | 3300009177 | Bacteria | 1192 |
| 115 | Ga0105237_10004179 | 3300009545 | Bacteria | 16814 |
| 116 | Ga0105249_10028423 | 3300009553 | Bacteria | 5047 |
| 117 | Ga0105249_10066065 | 3300009553 | Bacteria | 3329 |
| 118 | Ga0105249_10301502 | 3300009553 | Bacteria | 1607 |
| 119 | Ga0105239_10032416 | 3300010375 | Bacteria | 5742 |
| 120 | Ga0105239_10073439 | 3300010375 | Bacteria | 3760 |
| 121 | Ga0105239_10080355 | 3300010375 | Bacteria | 3587 |
| 122 | Ga0105246_10061522 | 3300011119 | Bacteria | 2613 |
| 123 | Ga0157374_10004714 | 3300013296 | Bacteria | 11449 |
| 124 | Ga0157378_10057033 | 3300013297 | Bacteria | 3481 |
| 125 | Ga0157372_10063787 | 3300013307 | Bacteria | 4133 |
| 126 | Ga0163163_10264339 | 3300014325 | Bacteria | 1772 |
| 127 | Ga0157380_10147264 | 3300014326 | Bacteria | 2031 |
| 128 | Ga0157380_10156593 | 3300014326 | Bacteria | 1975 |
| 129 | Ga0157377_10000780 | 3300014745 | Bacteria | 13175 |
| 130 | Ga0157377_10137823 | 3300014745 | Bacteria | 1497 |
| 131 | Ga0157379_10015321 | 3300014968 | Bacteria | 6725 |
| 132 | Ga0157379_10298094 | 3300014968 | Bacteria | 1469 |
| 133 | Ga0197907_11455233 | 3300020069 | Bacteria | 1707 |
| 134 | Ga0206356_11093505 | 3300020070 | Bacteria | 1435 |
| 135 | Ga0206351_10148293 | 3300020077 | Bacteria | 1304 |
| 136 | Ga0206350_11110684 | 3300020080 | Bacteria | 1885 |
| 137 | Ga0213873_10008091 | 3300021358 | Bacteria | 2134 |
| 138 | Ga0213874_10004435 | 3300021377 | Bacteria | 3205 |
| 139 | Ga0213876_10009122 | 3300021384 | Bacteria | 5341 |
| 140 | Ga0213876_10009558 | 3300021384 | Bacteria | 5217 |
| 141 | Ga0213876_10016703 | 3300021384 | Bacteria | 3878 |
| 142 | Ga0213876_10026858 | 3300021384 | Bacteria | 3037 |
| 143 | Ga0213876_10033713 | 3300021384 | Bacteria | 2699 |
| 144 | Ga0213876_10060303 | 3300021384 | Bacteria | 2002 |
| 145 | Ga0213876_10094135 | 3300021384 | Bacteria | 1587 |
| 146 | Ga0213875_10007475 | 3300021388 | Bacteria | 5635 |
| 147 | Ga0213875_10008271 | 3300021388 | Bacteria | 5336 |
| 148 | Ga0213875_10082058 | 3300021388 | Bacteria | 1504 |
| 149 | Ga0213875_10091727 | 3300021388 | Bacteria | 1417 |
| 150 | Ga0207692_10000004 | 3300025898 | Bacteria | 413600 |
| 151 | Ga0207692_10029380 | 3300025898 | Bacteria | 2612 |
| 152 | Ga0207692_10142347 | 3300025898 | Bacteria | 1365 |
| 153 | Ga0207688_10027234 | 3300025901 | Bacteria | 3144 |
| 154 | Ga0207647_10080261 | 3300025904 | Bacteria | 1957 |
| 155 | Ga0207643_10060791 | 3300025908 | Bacteria | 2157 |
| 156 | Ga0207695_10025071 | 3300025913 | Bacteria | 6689 |
| 157 | Ga0207695_10052956 | 3300025913 | Bacteria | 4248 |
| 158 | Ga0207671_10007639 | 3300025914 | Bacteria | 9342 |
| 159 | Ga0207693_10000036 | 3300025915 | Bacteria | 109562 |
| 160 | Ga0207693_10016406 | 3300025915 | Bacteria | 5921 |
| 161 | Ga0207693_10031883 | 3300025915 | Bacteria | 4163 |
| 162 | Ga0207693_10058211 | 3300025915 | Bacteria | 3028 |
| 163 | Ga0207693_10059167 | 3300025915 | Bacteria | 3001 |
| 164 | Ga0207663_10000816 | 3300025916 | Bacteria | 14066 |
| 165 | Ga0207663_10199405 | 3300025916 | Bacteria | 1443 |
| 166 | Ga0207662_10054254 | 3300025918 | Bacteria | 2390 |
| 167 | Ga0207657_10002206 | 3300025919 | Bacteria | 21118 |
| 168 | Ga0207657_10046633 | 3300025919 | Bacteria | 3795 |
| 169 | Ga0207657_10093105 | 3300025919 | Bacteria | 2510 |
| 170 | Ga0207652_10023270 | 3300025921 | Bacteria | 5131 |
| 171 | Ga0207646_10135675 | 3300025922 | Bacteria | 2216 |
| 172 | Ga0207681_10006486 | 3300025923 | Bacteria | 7182 |
| 173 | Ga0207650_10207655 | 3300025925 | Bacteria | 1572 |
| 174 | Ga0207659_10108381 | 3300025926 | Bacteria | 2106 |
| 175 | Ga0207687_10059409 | 3300025927 | Bacteria | 2694 |
| 176 | Ga0207687_10067609 | 3300025927 | Bacteria | 2543 |
| 177 | Ga0207700_10013684 | 3300025928 | Bacteria | 5289 |
| 178 | Ga0207700_10146101 | 3300025928 | Bacteria | 1949 |
| 179 | Ga0207664_10000012 | 3300025929 | Bacteria | 278872 |
| 180 | Ga0207664_10004746 | 3300025929 | Bacteria | 9234 |
| 181 | Ga0207664_10017334 | 3300025929 | Bacteria | 5277 |
| 182 | Ga0207664_10032272 | 3300025929 | Bacteria | 4012 |
| 183 | Ga0207664_10081462 | 3300025929 | Bacteria | 2634 |
| 184 | Ga0207690_10000085 | 3300025932 | Bacteria | 78414 |
| 185 | Ga0207690_10155366 | 3300025932 | Bacteria | 1700 |
| 186 | Ga0207690_10156148 | 3300025932 | Bacteria | 1696 |
| 187 | Ga0207706_10018897 | 3300025933 | Bacteria | 6198 |
| 188 | Ga0207706_10066534 | 3300025933 | Bacteria | 3171 |
| 189 | Ga0207709_10044976 | 3300025935 | Bacteria | 2671 |
| 190 | Ga0207669_10032227 | 3300025937 | Bacteria | 2941 |
| 191 | Ga0207704_10368852 | 3300025938 | Bacteria | 1123 |
| 192 | Ga0207691_10169068 | 3300025940 | Bacteria | 1915 |
| 193 | Ga0207689_10128144 | 3300025942 | Bacteria | 2087 |
| 194 | Ga0207689_10313910 | 3300025942 | Bacteria | 1300 |
| 195 | Ga0207689_10330996 | 3300025942 | Bacteria | 1265 |
| 196 | Ga0207661_10074302 | 3300025944 | Bacteria | 2786 |
| 197 | Ga0207661_10129726 | 3300025944 | Bacteria | 2158 |
| 198 | Ga0207661_10575124 | 3300025944 | Bacteria | 1033 |
| 199 | Ga0207679_10035059 | 3300025945 | Bacteria | 3547 |
| 200 | Ga0207679_10059893 | 3300025945 | Bacteria | 2826 |
| 201 | Ga0207679_10492857 | 3300025945 | Bacteria | 1092 |
| 202 | Ga0207668_10062456 | 3300025972 | Bacteria | 2623 |
| 203 | Ga0207677_10078997 | 3300026023 | Bacteria | 2351 |
| 204 | Ga0207703_10180494 | 3300026035 | Bacteria | 1863 |
| 205 | Ga0207678_10094575 | 3300026067 | Bacteria | 2553 |
| 206 | Ga0207678_10125157 | 3300026067 | Bacteria | 2193 |
| 207 | Ga0207708_10000854 | 3300026075 | Bacteria | 22951 |
| 208 | Ga0207708_10021292 | 3300026075 | Bacteria | 4889 |
| 209 | Ga0207708_10040954 | 3300026075 | Bacteria | 3533 |
| 210 | Ga0207702_10052759 | 3300026078 | Bacteria | 3442 |
| 211 | Ga0207648_10059508 | 3300026089 | Bacteria | 3332 |
| 212 | Ga0207676_10099392 | 3300026095 | Bacteria | 2408 |
| 213 | Ga0207676_10206420 | 3300026095 | Bacteria | 1740 |
| 214 | Ga0207676_10311382 | 3300026095 | Bacteria | 1442 |
| 215 | Ga0207674_10168635 | 3300026116 | Bacteria | 2143 |
| 216 | Ga0207674_10269080 | 3300026116 | Bacteria | 1651 |
| 217 | Ga0207675_100137086 | 3300026118 | Bacteria | 2323 |
| 218 | Ga0207675_100211388 | 3300026118 | Bacteria | 1866 |
| 219 | Ga0207675_100428785 | 3300026118 | Bacteria | 1307 |
| 220 | Ga0207675_100739869 | 3300026118 | Bacteria | 994 |
| 221 | Ga0207683_10133770 | 3300026121 | Bacteria | 2231 |
| 222 | Ga0207698_10145120 | 3300026142 | Bacteria | 2051 |
| 223 | Ga0207428_10032618 | 3300027907 | Bacteria | 4282 |
| 224 | Ga0207428_10040274 | 3300027907 | Bacteria | 3791 |
| 225 | Ga0207428_10118155 | 3300027907 | Bacteria | 2035 |
| 226 | Ga0207428_10207666 | 3300027907 | Bacteria | 1472 |
| 227 | Ga0268266_10052399 | 3300028379 | Bacteria | 3504 |
| 228 | Ga0268266_10064248 | 3300028379 | Bacteria | 3170 |
| 229 | Ga0268265_10188150 | 3300028380 | Bacteria | 1780 |
| 230 | Ga0268264_10469780 | 3300028381 | Bacteria | 1222 |
| 231 | Ga0265337_1007606 | 3300028556 | Bacteria | 4038 |
| 232 | Ga0265326_10000008 | 3300028558 | Bacteria | 210923 |
| 233 | Ga0265326_10008029 | 3300028558 | Bacteria | 3200 |
| 234 | Ga0265319_1000816 | 3300028563 | Bacteria | 19901 |
| 235 | Ga0265319_1000856 | 3300028563 | Bacteria | 19350 |
| 236 | Ga0265319_1004830 | 3300028563 | Bacteria | 6597 |
| 237 | Ga0265319_1017766 | 3300028563 | Bacteria | 2697 |
| 238 | Ga0265334_10000152 | 3300028573 | Bacteria | 42908 |
| 239 | Ga0265318_10001043 | 3300028577 | Bacteria | 17581 |
| 240 | Ga0265318_10002031 | 3300028577 | Bacteria | 11174 |
| 241 | Ga0265336_10000001 | 3300028666 | Bacteria | 916179 |
| 242 | Ga0265338_10000004 | 3300028800 | Bacteria | 644793 |
| 243 | Ga0265338_10017274 | 3300028800 | Bacteria | 7787 |
| 244 | Ga0265338_10019858 | 3300028800 | Bacteria | 7101 |
| 245 | Ga0265338_10043518 | 3300028800 | Bacteria | 4163 |
| 246 | Ga0265324_10052840 | 3300029957 | Bacteria | 1395 |
| 247 | Ga0265328_10053168 | 3300031239 | Bacteria | 1486 |
| 248 | Ga0265320_10142844 | 3300031240 | Bacteria | 1083 |
| 249 | Ga0265340_10000002 | 3300031247 | Bacteria | 711693 |
| 250 | Ga0265339_10022692 | 3300031249 | Bacteria | 3633 |
| 251 | Ga0265327_10015298 | 3300031251 | Bacteria | 4963 |
| 252 | Ga0265327_10015845 | 3300031251 | Bacteria | 4834 |
| 253 | Ga0265327_10027841 | 3300031251 | Bacteria | 3245 |
| 254 | Ga0265314_10159195 | 3300031711 | Bacteria | 1376 |
| 255 | Ga0307405_10030746 | 3300031731 | Bacteria | 3152 |
| 256 | Ga0307413_10038954 | 3300031824 | Bacteria | 2759 |
| 257 | Ga0307407_10144307 | 3300031903 | Bacteria | 1539 |
| 258 | Ga0307412_10006995 | 3300031911 | Bacteria | 6404 |
| 259 | Ga0307409_100020634 | 3300031995 | Bacteria | 4496 |
| 260 | Ga0307409_100025208 | 3300031995 | Bacteria | 4166 |
| 261 | Ga0307409_100072662 | 3300031995 | Bacteria | 2740 |
| 262 | Ga0307409_100218092 | 3300031995 | Bacteria | 1720 |
| 263 | Ga0307409_100305740 | 3300031995 | Bacteria | 1482 |
| 264 | Ga0307416_100006253 | 3300032002 | Bacteria | 7437 |
| 265 | Ga0307416_100017076 | 3300032002 | Bacteria | 5065 |
| 266 | Ga0307416_100030625 | 3300032002 | Bacteria | 4039 |
| 267 | Ga0307416_100460268 | 3300032002 | Bacteria | 1327 |
| 268 | Ga0307414_10080139 | 3300032004 | Bacteria | 2386 |
| 269 | Ga0307411_10120148 | 3300032005 | Bacteria | 1899 |
| 270 | Ga0307415_100117781 | 3300032126 | Bacteria | 1984 |
| 271 | Ga0373953_0006042 | 3300035117 | Bacteria | 3968 |
| 272 | Ga0373962_0105461 | 3300035242 | Bacteria | 884 |
| 273 | Ga0373924_0029689 | 3300035410 | Bacteria | 2187 |
| 274 | Ga0373931_0244635 | 3300035691 | Bacteria | 1089 |
| 275 | Ga0373925_0066093 | 3300037068 | Bacteria | 2725 |
| 276 | Ga0373925_0302404 | 3300037068 | Bacteria | 1292 |
| 277 | Ga0395900_0087820 | 3300037418 | Bacteria | 3196 |
| 278 | Ga0395900_0317282 | 3300037418 | Bacteria | 1540 |
| 279 | Ga0395898_0080706 | 3300037466 | Bacteria | 3137 |
| 280 | Ga0436364_0061575 | 3300037853 | Bacteria | 4262 |
| 281 | Ga0436364_0062618 | 3300037853 | Bacteria | 23174 |
| 282 | Ga0436364_0069090 | 3300037853 | Bacteria | 1791 |
| 283 | Ga0436364_0244708 | 3300037853 | Bacteria | 1624 |
| 284 | Ga0436364_0356082 | 3300037853 | Bacteria | 1342 |
| 285 | Ga0436364_0675766 | 3300037853 | Bacteria | 33099 |
| 286 | Ga0436364_0777641 | 3300037853 | Bacteria | 1524 |
| 287 | Ga0436364_0865495 | 3300037853 | Bacteria | 1109 |
| 288 | Ga0436364_1169259 | 3300037853 | Bacteria | 1757 |
| 289 | Ga0436364_1238678 | 3300037853 | Bacteria | 3847 |
| 290 | Ga0436364_1460780 | 3300037853 | Bacteria | 4543 |
| 291 | Ga0436364_1520628 | 3300037853 | Bacteria | 31090 |
| 292 | Ga0395901_0018317 | 3300038443 | Bacteria | 7149 |
| 293 | Ga0395901_0771948 | 3300038443 | Bacteria | 952 |
| 294 | Ga0242420_010926 | 3300038996 | Bacteria | 1516 |
| 295 | Ga0436365_0130921 | 3300039437 | Bacteria | 8552 |
| 296 | Ga0436365_0248531 | 3300039437 | Bacteria | 2181 |
| 297 | Ga0436365_0330823 | 3300039437 | Bacteria | 3863 |
| 298 | Ga0436365_0457137 | 3300039437 | Bacteria | 1582 |
| 299 | Ga0436365_0520637 | 3300039437 | Bacteria | 986 |
| 300 | Ga0436365_0603064 | 3300039437 | Bacteria | 2278 |
| 301 | Ga0436365_0664589 | 3300039437 | Bacteria | 14356 |
| 302 | Ga0436365_0874987 | 3300039437 | Bacteria | 2158 |
| 303 | Ga0436365_0987572 | 3300039437 | Bacteria | 4984 |
| 304 | Ga0436365_1091091 | 3300039437 | Bacteria | 1615 |
| 305 | Ga0436365_1110537 | 3300039437 | Bacteria | 6388 |
| 306 | Ga0436365_1255617 | 3300039437 | Bacteria | 2534 |
| 307 | Ga0436365_1305806 | 3300039437 | Bacteria | 8332 |
| 308 | Ga0436365_1830138 | 3300039437 | Bacteria | 5199 |
| 309 | Ga0436360_0759490 | 3300039438 | Bacteria | 1116 |
| 310 | Ga0436360_1273425 | 3300039438 | Bacteria | 1082 |
| 311 | Ga0436363_0266991 | 3300039450 | Bacteria | 2107 |
| 312 | Ga0436363_0469620 | 3300039450 | Bacteria | 1097 |
| 313 | Ga0436363_0482839 | 3300039450 | Bacteria | 998 |
| 314 | Ga0436363_0611387 | 3300039450 | Bacteria | 2599 |
| 315 | Ga0436363_0697951 | 3300039450 | Bacteria | 7429 |
| 316 | Ga0436363_0884660 | 3300039450 | Bacteria | 26785 |
| 317 | Ga0436363_1360186 | 3300039450 | Bacteria | 3318 |
| 318 | Ga0436363_1586056 | 3300039450 | Bacteria | 2105 |
| 319 | Ga0436362_0701923 | 3300039453 | Bacteria | 2893 |
| 320 | Ga0436362_0983308 | 3300039453 | Bacteria | 2656 |
| 321 | Ga0436362_1244081 | 3300039453 | Bacteria | 3504 |
| 322 | Ga0439453_0032856 | 3300041408 | Bacteria | 990 |
| 323 | Ga0451791_0824279 | 3300041451 | Bacteria | 1642 |
| 324 | Ga0450905_006481 | 3300042142 | Bacteria | 1584 |
| 325 | Ga0466969_0018138 | 3300044656 | Bacteria | 3671 |
| 326 | Ga0466969_0247214 | 3300044656 | Bacteria | 809 |
| 327 | Ga0466965_0020146 | 3300044683 | Bacteria | 3204 |
| 328 | Ga0466966_0033252 | 3300044684 | Bacteria | 3339 |
| 329 | Ga0466966_0067720 | 3300044684 | Bacteria | 2242 |
| 330 | Ga0466966_0068222 | 3300044684 | Bacteria | 2233 |
| 331 | Ga0466966_0091681 | 3300044684 | Bacteria | 1886 |
| 332 | Ga0466966_0114449 | 3300044684 | Bacteria | 1661 |
| 333 | Ga0466966_0304229 | 3300044684 | Bacteria | 958 |
| 334 | Ga0466961_0012150 | 3300044693 | Bacteria | 5505 |
| 335 | Ga0466961_0061511 | 3300044693 | Bacteria | 2386 |
| 336 | Ga0466961_0105142 | 3300044693 | Bacteria | 1777 |
| 337 | Ga0466961_0113024 | 3300044693 | Bacteria | 1708 |
| 338 | Ga0466961_0212161 | 3300044693 | Bacteria | 1195 |
| 339 | Ga0466963_0008216 | 3300044694 | Bacteria | 6255 |
| 340 | Ga0466963_0009536 | 3300044694 | Bacteria | 5846 |
| 341 | Ga0466963_0010915 | 3300044694 | Bacteria | 5517 |
| 342 | Ga0466963_0015424 | 3300044694 | Bacteria | 4731 |
| 343 | Ga0466963_0034009 | 3300044694 | Bacteria | 3314 |
| 344 | Ga0466963_0040891 | 3300044694 | Bacteria | 3039 |
| 345 | Ga0466963_0121658 | 3300044694 | Bacteria | 1797 |
| 346 | Ga0466963_0292869 | 3300044694 | Bacteria | 1144 |
| 347 | Ga0466964_0101556 | 3300044706 | Bacteria | 1269 |
| 348 | Ga0466971_0006889 | 3300044719 | Bacteria | 4940 |
| 349 | Ga0466971_0039599 | 3300044719 | Bacteria | 2115 |
| 350 | Ga0466971_0048661 | 3300044719 | Bacteria | 1906 |
| 351 | Ga0466971_0072537 | 3300044719 | Bacteria | 1564 |
| 352 | Ga0466971_0094100 | 3300044719 | Bacteria | 1373 |
| 353 | Ga0466968_0009848 | 3300044735 | Bacteria | 3689 |
| 354 | Ga0466968_0070569 | 3300044735 | Bacteria | 1520 |
| 355 | Ga0466970_0019493 | 3300044765 | Bacteria | 3517 |
| 356 | Ga0466970_0113984 | 3300044765 | Bacteria | 1477 |
| 357 | Ga0466957_0006639 | 3300044842 | Bacteria | 6542 |
| 358 | Ga0466957_0107606 | 3300044842 | Bacteria | 1765 |
| 359 | Ga0466960_0016276 | 3300044901 | Bacteria | 3222 |
| 360 | Ga0466960_0056356 | 3300044901 | Bacteria | 1913 |
| 361 | Ga0466960_0075659 | 3300044901 | Bacteria | 1685 |
| 362 | Ga0466960_0119221 | 3300044901 | Bacteria | 1380 |
| 363 | Ga0466959_0016730 | 3300045049 | Bacteria | 5365 |
| 364 | Ga0466959_0035105 | 3300045049 | Bacteria | 3710 |
| 365 | Ga0466959_0067457 | 3300045049 | Bacteria | 2594 |
| 366 | Ga0466959_0086239 | 3300045049 | Bacteria | 2259 |
| 367 | Ga0466959_0131798 | 3300045049 | Bacteria | 1771 |
| 368 | Ga0466959_0188234 | 3300045049 | Bacteria | 1441 |
| 369 | Ga0466959_0406524 | 3300045049 | Bacteria | 925 |
| 370 | Ga0466958_0007923 | 3300045836 | Bacteria | 5870 |
| 371 | Ga0466958_0008394 | 3300045836 | Bacteria | 5727 |
| 372 | Ga0466958_0014469 | 3300045836 | Bacteria | 4505 |
| 373 | Ga0466958_0018128 | 3300045836 | Bacteria | 4080 |
| 374 | Ga0466958_0034896 | 3300045836 | Bacteria | 3003 |
| 375 | Ga0466958_0061598 | 3300045836 | Bacteria | 2286 |
| 376 | Ga0466958_0066421 | 3300045836 | Bacteria | 2202 |
| 377 | Ga0466958_0079194 | 3300045836 | Bacteria | 2020 |
| 378 | Ga0466958_0101059 | 3300045836 | Bacteria | 1793 |
| 379 | Ga0466958_0115079 | 3300045836 | Bacteria | 1680 |
| 380 | Ga0466958_0138555 | 3300045836 | Bacteria | 1531 |
| 381 | Ga0466958_0202329 | 3300045836 | Bacteria | 1264 |
| 382 | Ga0466958_0248390 | 3300045836 | Bacteria | 1138 |
| 383 | Ga0466958_0255959 | 3300045836 | Bacteria | 1120 |
| 384 | Ga0466967_0007861 | 3300045976 | Bacteria | 7748 |
| 385 | Ga0466967_0008366 | 3300045976 | Bacteria | 7571 |
| 386 | Ga0466967_0010059 | 3300045976 | Bacteria | 7069 |
| 387 | Ga0466967_0015307 | 3300045976 | Bacteria | 6009 |
| 388 | Ga0466967_0024860 | 3300045976 | Bacteria | 4931 |
| 389 | Ga0466967_0072364 | 3300045976 | Bacteria | 3089 |
| 390 | Ga0466967_0073232 | 3300045976 | Bacteria | 3072 |
| 391 | Ga0466967_0075614 | 3300045976 | Bacteria | 3027 |
| 392 | Ga0466967_0189697 | 3300045976 | Bacteria | 1942 |
| 393 | Ga0466967_0211810 | 3300045976 | Bacteria | 1838 |
| 394 | Ga0466967_0212812 | 3300045976 | Bacteria | 1834 |
| 395 | Ga0466967_0267909 | 3300045976 | Bacteria | 1636 |
| 396 | Ga0466967_0308188 | 3300045976 | Bacteria | 1524 |
| 397 | Ga0466967_0335305 | 3300045976 | Bacteria | 1461 |
| 398 | Ga0466967_0390965 | 3300045976 | Bacteria | 1352 |
| 399 | Ga0466967_0459976 | 3300045976 | Bacteria | 1244 |
| 400 | Ga0495629_0190160 | 3300046459 | Bacteria | 1421 |
| 401 | Ga0495629_0246753 | 3300046459 | Bacteria | 1229 |
| 402 | Ga0495629_0322072 | 3300046459 | Bacteria | 1057 |
| 403 | Ga0495651_0060829 | 3300046462 | Bacteria | 2892 |
| 404 | Ga0495653_0000754 | 3300046463 | Bacteria | 24761 |
| 405 | Ga0495653_0106504 | 3300046463 | Bacteria | 2022 |
| 406 | Ga0495653_0141821 | 3300046463 | Bacteria | 1689 |
| 407 | Ga0495650_0000188 | 3300046471 | Bacteria | 134775 |
| 408 | Ga0495582_0161244 | 3300046473 | Bacteria | 1275 |
| 409 | Ga0495662_0141435 | 3300046476 | Bacteria | 1185 |
| 410 | Ga0495664_0000205 | 3300046477 | Bacteria | 28535 |
| 411 | Ga0495608_0146660 | 3300046511 | Bacteria | 1505 |
| 412 | Ga0495608_0157676 | 3300046511 | Bacteria | 1444 |
| 413 | Ga0495618_0001356 | 3300046514 | Bacteria | 16467 |
| 414 | Ga0495618_0046908 | 3300046514 | Bacteria | 2727 |
| 415 | Ga0495628_0043476 | 3300046516 | Bacteria | 3579 |
| 416 | Ga0495630_0060404 | 3300046517 | Bacteria | 2845 |
| 417 | Ga0495652_0060042 | 3300046529 | Bacteria | 3215 |
| 418 | Ga0495652_0312688 | 3300046529 | Bacteria | 1138 |
| 419 | Ga0495645_0000121 | 3300046543 | Bacteria | 52863 |
| 420 | Ga0495645_0000767 | 3300046543 | Bacteria | 21944 |
| 421 | Ga0495667_0002716 | 3300046559 | Bacteria | 11833 |
| 422 | Ga0495635_0209261 | 3300046663 | Bacteria | 1321 |
| 423 | Ga0495657_0000008 | 3300046675 | Bacteria | 221090 |
| 424 | Ga0495657_0079747 | 3300046675 | Bacteria | 2119 |
| 425 | Ga0495670_0097225 | 3300046691 | Bacteria | 1513 |
| 426 | Ga0495600_0172610 | 3300046809 | Bacteria | 1395 |
| 427 | Ga0495604_0000047 | 3300047317 | Bacteria | 109717 |
| 428 | Ga0495604_0246629 | 3300047317 | Bacteria | 1219 |
| 429 | Ga0495672_0015377 | 3300047320 | Bacteria | 5198 |
| 430 | Ga0495680_0033414 | 3300047322 | Bacteria | 4165 |
| 431 | Ga0495684_0001325 | 3300047471 | Bacteria | 19946 |
| 432 | Ga0496100_0001384 | 3300048903 | Bacteria | 11881 |
| 433 | Ga0496100_0016271 | 3300048903 | Bacteria | 4363 |
| 434 | Ga0496100_0032465 | 3300048903 | Bacteria | 3257 |
| 435 | Ga0496100_0047647 | 3300048903 | Bacteria | 2763 |
| 436 | Ga0496101_0001701 | 3300048904 | Bacteria | 13168 |
| 437 | Ga0496101_0107499 | 3300048904 | Bacteria | 2096 |
| 438 | Ga0496101_0131731 | 3300048904 | Bacteria | 1899 |
| 439 | Ga0496101_0170908 | 3300048904 | Bacteria | 1671 |
| 440 | Ga0496101_0226694 | 3300048904 | Bacteria | 1452 |
| 441 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 442 | Ga0496102_0223535 | 3300048905 | Bacteria | 1775 |
| 443 | Ga0496102_0428472 | 3300048905 | Bacteria | 1242 |
| 444 | Ga0496103_0000046 | 3300048906 | Bacteria | 161981 |
| 445 | Ga0496103_0014780 | 3300048906 | Bacteria | 4640 |
| 446 | Ga0496103_0128039 | 3300048906 | Bacteria | 1620 |
| 447 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 448 | Ga0496104_0015831 | 3300048907 | Bacteria | 6842 |
| 449 | Ga0496104_0049757 | 3300048907 | Bacteria | 3952 |
| 450 | Ga0496104_0074733 | 3300048907 | Bacteria | 3226 |
| 451 | Ga0496104_0082376 | 3300048907 | Bacteria | 3068 |
| 452 | Ga0496104_0290564 | 3300048907 | Bacteria | 1547 |
| 453 | Ga0496105_0001840 | 3300048908 | Bacteria | 15202 |
| 454 | Ga0496105_0067259 | 3300048908 | Bacteria | 2958 |
| 455 | Ga0496105_0081249 | 3300048908 | Bacteria | 2677 |
| 456 | Ga0496105_0117981 | 3300048908 | Bacteria | 2189 |
| 457 | Ga0496105_0132842 | 3300048908 | Bacteria | 2051 |
| 458 | Ga0496105_0220969 | 3300048908 | Bacteria | 1542 |
| 459 | Ga0496106_0014023 | 3300048909 | Bacteria | 5924 |
| 460 | Ga0496106_0034783 | 3300048909 | Bacteria | 3765 |
| 461 | Ga0496106_0077552 | 3300048909 | Bacteria | 2548 |
| 462 | Ga0496107_0013498 | 3300048910 | Bacteria | 5711 |
| 463 | Ga0496107_0014786 | 3300048910 | Bacteria | 5463 |
| 464 | Ga0496107_0162263 | 3300048910 | Bacteria | 1656 |
| 465 | Ga0496107_0465588 | 3300048910 | Bacteria | 938 |
| 466 | Ga0496108_0002384 | 3300048911 | Bacteria | 15028 |
| 467 | Ga0496108_0079290 | 3300048911 | Bacteria | 2780 |
| 468 | Ga0496108_0095481 | 3300048911 | Bacteria | 2531 |
| 469 | Ga0496108_0129569 | 3300048911 | Bacteria | 2168 |
| 470 | Ga0496108_0136321 | 3300048911 | Bacteria | 2112 |
| 471 | Ga0496108_0352226 | 3300048911 | Bacteria | 1285 |
| 472 | Ga0496109_0011604 | 3300048912 | Bacteria | 7577 |
| 473 | Ga0496109_0015699 | 3300048912 | Bacteria | 6606 |
| 474 | Ga0496109_0020518 | 3300048912 | Bacteria | 5836 |
| 475 | Ga0496109_0068350 | 3300048912 | Bacteria | 3257 |
| 476 | Ga0496109_0096014 | 3300048912 | Bacteria | 2745 |
| 477 | Ga0496110_0000153 | 3300048913 | Bacteria | 41540 |
| 478 | Ga0496110_0053952 | 3300048913 | Bacteria | 3535 |
| 479 | Ga0496110_0383660 | 3300048913 | Bacteria | 1280 |
| 480 | Ga0496110_0500910 | 3300048913 | Bacteria | 1106 |
| 481 | Ga0496111_0000110 | 3300048914 | Bacteria | 36104 |
| 482 | Ga0496111_0012209 | 3300048914 | Bacteria | 5809 |
| 483 | Ga0496111_0089931 | 3300048914 | Bacteria | 2249 |
| 484 | Ga0496111_0100777 | 3300048914 | Bacteria | 2121 |
| 485 | Ga0496111_0144979 | 3300048914 | Bacteria | 1760 |
| 486 | Ga0496111_0289368 | 3300048914 | Bacteria | 1215 |
| 487 | Ga0496112_0002728 | 3300048915 | Bacteria | 14297 |
| 488 | Ga0496112_0005516 | 3300048915 | Bacteria | 10955 |
| 489 | Ga0496112_0028226 | 3300048915 | Bacteria | 5415 |
| 490 | Ga0496112_0032700 | 3300048915 | Bacteria | 5051 |
| 491 | Ga0496112_0044985 | 3300048915 | Bacteria | 4326 |
| 492 | Ga0496113_0001822 | 3300048916 | Bacteria | 12120 |
| 493 | Ga0496113_0015189 | 3300048916 | Bacteria | 5282 |
| 494 | Ga0496113_0129097 | 3300048916 | Bacteria | 1982 |
| 495 | Ga0496114_0145902 | 3300048917 | Bacteria | 2051 |
| 496 | Ga0496115_0000034 | 3300048918 | Bacteria | 135380 |
| 497 | Ga0496115_0000240 | 3300048918 | Bacteria | 49737 |
| 498 | Ga0496115_0010151 | 3300048918 | Bacteria | 7026 |
| 499 | Ga0496115_0080129 | 3300048918 | Bacteria | 2658 |
| 500 | Ga0496115_0211338 | 3300048918 | Bacteria | 1602 |
| 501 | Ga0496115_0471565 | 3300048918 | Bacteria | 1012 |
| 502 | Ga0496121_0001001 | 3300048924 | Bacteria | 50528 |
| 503 | Ga0501031_0031849 | 3300049568 | Bacteria | 3439 |
| 504 | Ga0501031_0098518 | 3300049568 | Bacteria | 1907 |
| 505 | Ga0501032_0050192 | 3300049569 | Bacteria | 2813 |
| 506 | Ga0501033_0031861 | 3300049570 | Bacteria | 3958 |
| 507 | Ga0501034_0029954 | 3300049571 | Bacteria | 5532 |
| 508 | Ga0501036_0011262 | 3300049572 | Bacteria | 7400 |
| 509 | Ga0501036_0228375 | 3300049572 | Bacteria | 1562 |
| 510 | Ga0501037_0006906 | 3300049573 | Bacteria | 8290 |
| 511 | Ga0501038_0031222 | 3300049574 | Bacteria | 4709 |
| 512 | Ga0501038_0340625 | 3300049574 | Bacteria | 1169 |
| 513 | Ga0501039_0027769 | 3300049575 | Bacteria | 4352 |
| 514 | Ga0501039_0066296 | 3300049575 | Bacteria | 2802 |
| 515 | Ga0501040_0187913 | 3300049576 | Bacteria | 1466 |
| 516 | Ga0501042_0073316 | 3300049578 | Bacteria | 2449 |
| 517 | Ga0501042_0116872 | 3300049578 | Bacteria | 1920 |
| 518 | Ga0501046_0056661 | 3300049580 | Bacteria | 3075 |
| 519 | Ga0501046_0120283 | 3300049580 | Bacteria | 1998 |
| 520 | Ga0501047_0092447 | 3300049581 | Bacteria | 2903 |
| 521 | Ga0501047_0269751 | 3300049581 | Bacteria | 1548 |
| 522 | Ga0501048_0045010 | 3300049582 | Bacteria | 3153 |
| 523 | Ga0501048_0105644 | 3300049582 | Bacteria | 1987 |
| 524 | Ga0501068_0006809 | 3300049584 | Bacteria | 6320 |
| 525 | Ga0501069_0023208 | 3300049585 | Bacteria | 3381 |
| 526 | Ga0501070_0141021 | 3300049586 | Bacteria | 1990 |
| 527 | Ga0501071_0062921 | 3300049587 | Bacteria | 2689 |
| 528 | Ga0501071_0066498 | 3300049587 | Bacteria | 2620 |
| 529 | Ga0501071_0086580 | 3300049587 | Bacteria | 2298 |
| 530 | Ga0501072_0079595 | 3300049588 | Bacteria | 2595 |
| 531 | Ga0501073_0013163 | 3300049589 | Bacteria | 6030 |
| 532 | Ga0501075_0201632 | 3300049591 | Bacteria | 1517 |
| 533 | Ga0501076_0128876 | 3300049592 | Bacteria | 2051 |
| 534 | Ga0501076_0166234 | 3300049592 | Bacteria | 1798 |
| 535 | Ga0501079_0097194 | 3300049741 | Bacteria | 2283 |
| 536 | Ga0501079_0121179 | 3300049741 | Bacteria | 2034 |
| 537 | Ga0501079_0219848 | 3300049741 | Bacteria | 1484 |
| 538 | Ga0501080_0093952 | 3300049742 | Bacteria | 2785 |
| 539 | Ga0501083_0036142 | 3300049744 | Bacteria | 3370 |
| 540 | Ga0501083_0148709 | 3300049744 | Bacteria | 1534 |
| 541 | Ga0501044_0054925 | 3300049823 | Bacteria | 4091 |
| 542 | Ga0501044_0267310 | 3300049823 | Bacteria | 1647 |
| 543 | Ga0501045_0077302 | 3300049824 | Bacteria | 2452 |
| 544 | Ga0501045_0151863 | 3300049824 | Bacteria | 1723 |
| 545 | Ga0501045_0171713 | 3300049824 | Bacteria | 1615 |
| 546 | nmdc:mga09592_10424_c1 | 3300050508 | Bacteria | 7563 |
| 547 | nmdc:mga0qj67_2514_c1 | 3300050509 | Bacteria | 13094 |
| 548 | nmdc:mga0n895_241878_c1 | 3300050512 | Bacteria | 1832 |
| 549 | nmdc:mga0rr50_284969_c1 | 3300050513 | Bacteria | 1379 |
| 550 | nmdc:mga08x19_271772_c1 | 3300050514 | Bacteria | 1173 |
| 551 | nmdc:mga08x19_78493_c1 | 3300050514 | Bacteria | 2164 |
| 552 | Ga0495601_0020606 | 3300053077 | Bacteria | 4028 |
| 553 | Ga0495612_0000092 | 3300053078 | Bacteria | 39332 |
| 554 | Ga0495619_0076611 | 3300053085 | Bacteria | 2245 |
| 555 | Ga0495619_0102295 | 3300053085 | Bacteria | 1951 |
| 556 | Ga0500616_0001780 | 3300053153 | Bacteria | 19684 |
| 557 | Ga0501084_0036016 | 3300054114 | Bacteria | 4135 |
| 558 | Ga0501084_0147489 | 3300054114 | Bacteria | 1982 |
| 559 | Ga0501084_0353271 | 3300054114 | Bacteria | 1242 |
| 560 | Ga0501084_0368774 | 3300054114 | Bacteria | 1213 |
| 561 | Ga0501082_0019577 | 3300060353 | Bacteria | 5836 |
| 562 | Ga0501082_0054990 | 3300060353 | Bacteria | 3430 |
| 563 | Ga0501082_0066900 | 3300060353 | Bacteria | 3094 |
| 564 | Ga0466962_0001846 | 3300061719 | Bacteria | 9957 |
| 565 | Ga0466962_0014682 | 3300061719 | Bacteria | 3775 |
| 566 | Ga0466962_0031565 | 3300061719 | Bacteria | 2536 |
| 567 | Ga0466962_0094395 | 3300061719 | Bacteria | 1434 |
| 568 | Ga0530510_0085888 | 3300061734 | Bacteria | 2292 |
| 569 | Ga0530510_0281500 | 3300061734 | Bacteria | 1242 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044656 | Ga0466969_0247214 | Ga0466969_0247214_18_779 | 253 |
| 2 | 3300037853 | Ga0436364_1520628 | Ga0436364_1520628_15403_16242 | 268 |
| 3 | 3300039437 | Ga0436365_0603064 | Ga0436365_0603064_1003_1842 | 268 |
| 4 | 3300054114 | Ga0501084_0368774 | Ga0501084_0368774_382_1203 | 273 |
| 5 | 3300049580 | Ga0501046_0120283 | Ga0501046_0120283_1158_1985 | 274 |
| 6 | 3300037068 | Ga0373925_0302404 | Ga0373925_0302404_46_891 | 276 |
| 7 | 3300045976 | Ga0466967_0267909 | Ga0466967_0267909_685_1518 | 277 |
| 8 | 3300038443 | Ga0395901_0771948 | Ga0395901_0771948_89_925 | 278 |
| 9 | 3300044719 | Ga0466971_0072537 | Ga0466971_0072537_687_1523 | 278 |
| 10 | 3300044735 | Ga0466968_0009848 | Ga0466968_0009848_2822_3658 | 278 |
| 11 | 3300048910 | Ga0496107_0465588 | Ga0496107_0465588_81_917 | 278 |
| 12 | 3300037853 | Ga0436364_0865495 | Ga0436364_0865495_207_1058 | 279 |
| 13 | 3300039437 | Ga0436365_1305806 | Ga0436365_1305806_4065_4931 | 279 |
| 14 | 3300039438 | Ga0436360_1273425 | Ga0436360_1273425_224_1063 | 279 |
| 15 | 3300039450 | Ga0436363_0482839 | Ga0436363_0482839_99_953 | 279 |
| 16 | 3300039450 | Ga0436363_0884660 | Ga0436363_0884660_22033_22899 | 279 |
| 17 | 3300044693 | Ga0466961_0212161 | Ga0466961_0212161_228_1067 | 279 |
| 18 | 3300045049 | Ga0466959_0406524 | Ga0466959_0406524_36_875 | 279 |
| 19 | 3300045836 | Ga0466958_0138555 | Ga0466958_0138555_663_1505 | 279 |
| 20 | 3300046463 | Ga0495653_0141821 | Ga0495653_0141821_29_880 | 279 |
| 21 | 3300046511 | Ga0495608_0146660 | Ga0495608_0146660_412_1263 | 279 |
| 22 | 3300046529 | Ga0495652_0312688 | Ga0495652_0312688_91_930 | 279 |
| 23 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_795934_796773 | 279 |
| 24 | 3300048906 | Ga0496103_0000046 | Ga0496103_0000046_16471_17310 | 279 |
| 25 | 3300049823 | Ga0501044_0267310 | Ga0501044_0267310_24_863 | 279 |
| 26 | 3300035242 | Ga0373962_0105461 | Ga0373962_0105461_10_873 | 280 |
| 27 | 3300044901 | Ga0466960_0075659 | Ga0466960_0075659_819_1661 | 280 |
| 28 | 3300044901 | Ga0466960_0119221 | Ga0466960_0119221_71_919 | 280 |
| 29 | 3300048913 | Ga0496110_0383660 | Ga0496110_0383660_28_870 | 280 |
| 30 | 3300044694 | Ga0466963_0008216 | Ga0466963_0008216_4199_5101 | 281 |
| 31 | 3300044719 | Ga0466971_0048661 | Ga0466971_0048661_789_1691 | 281 |
| 32 | 3300044765 | Ga0466970_0019493 | Ga0466970_0019493_1763_2665 | 281 |
| 33 | 3300044842 | Ga0466957_0006639 | Ga0466957_0006639_3050_3952 | 281 |
| 34 | 3300045976 | Ga0466967_0010059 | Ga0466967_0010059_2226_3128 | 281 |
| 35 | 3300061719 | Ga0466962_0094395 | Ga0466962_0094395_186_1088 | 281 |
| 36 | 3300021388 | Ga0213875_10091727 | Ga0213875_100917272 | 287 |
| 37 | 3300037853 | Ga0436364_0061575 | Ga0436364_0061575_2948_3850 | 287 |
| 38 | 3300039437 | Ga0436365_0248531 | Ga0436365_0248531_489_1391 | 287 |
| 39 | 3300045049 | Ga0466959_0131798 | Ga0466959_0131798_130_1029 | 287 |
| 40 | 3300037853 | Ga0436364_1238678 | Ga0436364_1238678_738_1640 | 288 |
| 41 | 3300044719 | Ga0466971_0039599 | Ga0466971_0039599_85_987 | 288 |
| 42 | 3300021384 | Ga0213876_10094135 | Ga0213876_100941352 | 289 |
| 43 | 3300044694 | Ga0466963_0121658 | Ga0466963_0121658_20_901 | 291 |
| 44 | 3300047317 | Ga0495604_0246629 | Ga0495604_0246629_22_897 | 291 |
| 45 | 3300044684 | Ga0466966_0304229 | Ga0466966_0304229_27_935 | 292 |
| 46 | 3300013297 | Ga0157378_10057033 | Ga0157378_100570334 | 294 |
| 47 | 3300009147 | Ga0114129_10929594 | Ga0114129_109295942 | 296 |
| 48 | 3300045976 | Ga0466967_0015307 | Ga0466967_0015307_263_1171 | 296 |
| 49 | 3300005329 | Ga0070683_100029285 | Ga0070683_1000292854 | 297 |
| 50 | 3300005339 | Ga0070660_100296041 | Ga0070660_1002960412 | 297 |
| 51 | 3300005341 | Ga0070691_10010760 | Ga0070691_100107606 | 297 |
| 52 | 3300005441 | Ga0070700_100033379 | Ga0070700_1000333792 | 297 |
| 53 | 3300005456 | Ga0070678_100150902 | Ga0070678_1001509022 | 297 |
| 54 | 3300005466 | Ga0070685_10168846 | Ga0070685_101688462 | 297 |
| 55 | 3300005535 | Ga0070684_100108879 | Ga0070684_1001088792 | 297 |
| 56 | 3300005564 | Ga0070664_100020034 | Ga0070664_1000200342 | 297 |
| 57 | 3300005577 | Ga0068857_100165735 | Ga0068857_1001657353 | 297 |
| 58 | 3300005577 | Ga0068857_100412062 | Ga0068857_1004120622 | 297 |
| 59 | 3300005614 | Ga0068856_100031094 | Ga0068856_1000310944 | 297 |
| 60 | 3300005618 | Ga0068864_100008699 | Ga0068864_1000086993 | 297 |
| 61 | 3300005719 | Ga0068861_100109208 | Ga0068861_1001092083 | 297 |
| 62 | 3300005834 | Ga0068851_10106353 | Ga0068851_101063532 | 297 |
| 63 | 3300006175 | Ga0070712_100236609 | Ga0070712_1002366092 | 297 |
| 64 | 3300006844 | Ga0075428_100146556 | Ga0075428_1001465563 | 297 |
| 65 | 3300006852 | Ga0075433_10024129 | Ga0075433_100241294 | 297 |
| 66 | 3300006914 | Ga0075436_100083489 | Ga0075436_1000834892 | 297 |
| 67 | 3300007076 | Ga0075435_100087828 | Ga0075435_1000878283 | 297 |
| 68 | 3300009094 | Ga0111539_10170388 | Ga0111539_101703882 | 297 |
| 69 | 3300009553 | Ga0105249_10066065 | Ga0105249_100660653 | 297 |
| 70 | 3300010375 | Ga0105239_10032416 | Ga0105239_100324162 | 297 |
| 71 | 3300013296 | Ga0157374_10004714 | Ga0157374_100047145 | 297 |
| 72 | 3300013307 | Ga0157372_10063787 | Ga0157372_100637872 | 297 |
| 73 | 3300014326 | Ga0157380_10147264 | Ga0157380_101472643 | 297 |
| 74 | 3300014745 | Ga0157377_10000780 | Ga0157377_1000078013 | 297 |
| 75 | 3300025915 | Ga0207693_10031883 | Ga0207693_100318836 | 297 |
| 76 | 3300025926 | Ga0207659_10108381 | Ga0207659_101083812 | 297 |
| 77 | 3300025933 | Ga0207706_10018897 | Ga0207706_100188976 | 297 |
| 78 | 3300026067 | Ga0207678_10094575 | Ga0207678_100945753 | 297 |
| 79 | 3300026075 | Ga0207708_10000854 | Ga0207708_100008548 | 297 |
| 80 | 3300026118 | Ga0207675_100211388 | Ga0207675_1002113882 | 297 |
| 81 | 3300027907 | Ga0207428_10040274 | Ga0207428_100402743 | 297 |
| 82 | 3300037418 | Ga0395900_0317282 | Ga0395900_0317282_92_988 | 297 |
| 83 | 3300048903 | Ga0496100_0016271 | Ga0496100_0016271_2237_3133 | 297 |
| 84 | 3300048906 | Ga0496103_0014780 | Ga0496103_0014780_3031_3927 | 297 |
| 85 | 3300048908 | Ga0496105_0067259 | Ga0496105_0067259_804_1700 | 297 |
| 86 | 3300048909 | Ga0496106_0077552 | Ga0496106_0077552_385_1281 | 297 |
| 87 | 3300048910 | Ga0496107_0013498 | Ga0496107_0013498_2752_3648 | 297 |
| 88 | 3300048912 | Ga0496109_0011604 | Ga0496109_0011604_3502_4398 | 297 |
| 89 | 3300048915 | Ga0496112_0044985 | Ga0496112_0044985_1261_2157 | 297 |
| 90 | 3300050512 | nmdc:mga0n895_241878_c1 | nmdc:mga0n895_241878_c1_370_1266 | 297 |
| 91 | 3300050514 | nmdc:mga08x19_78493_c1 | nmdc:mga08x19_78493_c1_1045_1941 | 297 |
| 92 | 3300005468 | Ga0070707_100322244 | Ga0070707_1003222441 | 298 |
| 93 | 3300044656 | Ga0466969_0018138 | Ga0466969_0018138_44_961 | 298 |
| 94 | 3300044684 | Ga0466966_0067720 | Ga0466966_0067720_373_1269 | 298 |
| 95 | 3300044684 | Ga0466966_0091681 | Ga0466966_0091681_828_1724 | 298 |
| 96 | 3300044693 | Ga0466961_0105142 | Ga0466961_0105142_830_1747 | 298 |
| 97 | 3300045836 | Ga0466958_0079194 | Ga0466958_0079194_101_997 | 298 |
| 98 | 3300045836 | Ga0466958_0255959 | Ga0466958_0255959_123_1025 | 298 |
| 99 | 3300054114 | Ga0501084_0353271 | Ga0501084_0353271_40_945 | 298 |
| 100 | 3300003203 | JGI25406J46586_10028559 | JGI25406J46586_100285592 | 299 |
| 101 | 3300005347 | Ga0070668_100040383 | Ga0070668_1000403833 | 299 |
| 102 | 3300005355 | Ga0070671_100367354 | Ga0070671_1003673541 | 299 |
| 103 | 3300005438 | Ga0070701_10070592 | Ga0070701_100705922 | 299 |
| 104 | 3300005456 | Ga0070678_100276750 | Ga0070678_1002767502 | 299 |
| 105 | 3300005543 | Ga0070672_100118094 | Ga0070672_1001180942 | 299 |
| 106 | 3300005577 | Ga0068857_100414692 | Ga0068857_1004146922 | 299 |
| 107 | 3300005840 | Ga0068870_10090393 | Ga0068870_100903932 | 299 |
| 108 | 3300005937 | Ga0081455_10082621 | Ga0081455_100826213 | 299 |
| 109 | 3300005985 | Ga0081539_10010609 | Ga0081539_100106092 | 299 |
| 110 | 3300005985 | Ga0081539_10024574 | Ga0081539_100245743 | 299 |
| 111 | 3300009093 | Ga0105240_10465592 | Ga0105240_104655922 | 299 |
| 112 | 3300009148 | Ga0105243_10089259 | Ga0105243_100892592 | 299 |
| 113 | 3300020070 | Ga0206356_11093505 | Ga0206356_110935052 | 299 |
| 114 | 3300021384 | Ga0213876_10009558 | Ga0213876_100095581 | 299 |
| 115 | 3300021384 | Ga0213876_10026858 | Ga0213876_100268584 | 299 |
| 116 | 3300025901 | Ga0207688_10027234 | Ga0207688_100272343 | 299 |
| 117 | 3300025915 | Ga0207693_10058211 | Ga0207693_100582111 | 299 |
| 118 | 3300025940 | Ga0207691_10169068 | Ga0207691_101690682 | 299 |
| 119 | 3300025972 | Ga0207668_10062456 | Ga0207668_100624562 | 299 |
| 120 | 3300026067 | Ga0207678_10125157 | Ga0207678_101251572 | 299 |
| 121 | 3300026075 | Ga0207708_10021292 | Ga0207708_100212923 | 299 |
| 122 | 3300026089 | Ga0207648_10059508 | Ga0207648_100595083 | 299 |
| 123 | 3300026118 | Ga0207675_100137086 | Ga0207675_1001370862 | 299 |
| 124 | 3300026118 | Ga0207675_100428785 | Ga0207675_1004287851 | 299 |
| 125 | 3300027907 | Ga0207428_10032618 | Ga0207428_100326184 | 299 |
| 126 | 3300027907 | Ga0207428_10118155 | Ga0207428_101181552 | 299 |
| 127 | 3300028381 | Ga0268264_10469780 | Ga0268264_104697802 | 299 |
| 128 | 3300028563 | Ga0265319_1000816 | Ga0265319_100081622 | 299 |
| 129 | 3300028563 | Ga0265319_1004830 | Ga0265319_10048303 | 299 |
| 130 | 3300028577 | Ga0265318_10002031 | Ga0265318_100020317 | 299 |
| 131 | 3300028800 | Ga0265338_10043518 | Ga0265338_100435182 | 299 |
| 132 | 3300037418 | Ga0395900_0087820 | Ga0395900_0087820_1123_2022 | 299 |
| 133 | 3300037466 | Ga0395898_0080706 | Ga0395898_0080706_2078_2977 | 299 |
| 134 | 3300038443 | Ga0395901_0018317 | Ga0395901_0018317_5635_6534 | 299 |
| 135 | 3300039437 | Ga0436365_0987572 | Ga0436365_0987572_1852_2751 | 299 |
| 136 | 3300039437 | Ga0436365_1110537 | Ga0436365_1110537_90_989 | 299 |
| 137 | 3300039453 | Ga0436362_0701923 | Ga0436362_0701923_1263_2162 | 299 |
| 138 | 3300044684 | Ga0466966_0068222 | Ga0466966_0068222_97_996 | 299 |
| 139 | 3300044693 | Ga0466961_0061511 | Ga0466961_0061511_793_1692 | 299 |
| 140 | 3300044694 | Ga0466963_0010915 | Ga0466963_0010915_3833_4732 | 299 |
| 141 | 3300044735 | Ga0466968_0070569 | Ga0466968_0070569_116_1015 | 299 |
| 142 | 3300045049 | Ga0466959_0016730 | Ga0466959_0016730_392_1291 | 299 |
| 143 | 3300045836 | Ga0466958_0034896 | Ga0466958_0034896_1891_2790 | 299 |
| 144 | 3300045836 | Ga0466958_0066421 | Ga0466958_0066421_322_1221 | 299 |
| 145 | 3300045976 | Ga0466967_0308188 | Ga0466967_0308188_489_1397 | 299 |
| 146 | 3300045976 | Ga0466967_0390965 | Ga0466967_0390965_13_912 | 299 |
| 147 | 3300048904 | Ga0496101_0107499 | Ga0496101_0107499_487_1386 | 299 |
| 148 | 3300048905 | Ga0496102_0428472 | Ga0496102_0428472_147_1046 | 299 |
| 149 | 3300048906 | Ga0496103_0128039 | Ga0496103_0128039_439_1338 | 299 |
| 150 | 3300048907 | Ga0496104_0015831 | Ga0496104_0015831_2651_3550 | 299 |
| 151 | 3300048907 | Ga0496104_0074733 | Ga0496104_0074733_432_1331 | 299 |
| 152 | 3300048907 | Ga0496104_0290564 | Ga0496104_0290564_437_1336 | 299 |
| 153 | 3300048908 | Ga0496105_0001840 | Ga0496105_0001840_11752_12651 | 299 |
| 154 | 3300048908 | Ga0496105_0132842 | Ga0496105_0132842_1055_1954 | 299 |
| 155 | 3300048912 | Ga0496109_0096014 | Ga0496109_0096014_1033_1932 | 299 |
| 156 | 3300048914 | Ga0496111_0100777 | Ga0496111_0100777_1005_1904 | 299 |
| 157 | 3300048915 | Ga0496112_0002728 | Ga0496112_0002728_12123_13022 | 299 |
| 158 | 3300048916 | Ga0496113_0001822 | Ga0496113_0001822_8783_9682 | 299 |
| 159 | 3300048918 | Ga0496115_0211338 | Ga0496115_0211338_370_1269 | 299 |
| 160 | 3300049569 | Ga0501032_0050192 | Ga0501032_0050192_174_1091 | 299 |
| 161 | 3300049570 | Ga0501033_0031861 | Ga0501033_0031861_360_1277 | 299 |
| 162 | 3300049571 | Ga0501034_0029954 | Ga0501034_0029954_4070_4999 | 299 |
| 163 | 3300049572 | Ga0501036_0011262 | Ga0501036_0011262_6309_7226 | 299 |
| 164 | 3300049573 | Ga0501037_0006906 | Ga0501037_0006906_1305_2222 | 299 |
| 165 | 3300049574 | Ga0501038_0031222 | Ga0501038_0031222_2525_3442 | 299 |
| 166 | 3300049578 | Ga0501042_0116872 | Ga0501042_0116872_937_1854 | 299 |
| 167 | 3300049580 | Ga0501046_0056661 | Ga0501046_0056661_1145_2062 | 299 |
| 168 | 3300049581 | Ga0501047_0092447 | Ga0501047_0092447_177_1094 | 299 |
| 169 | 3300049582 | Ga0501048_0045010 | Ga0501048_0045010_1841_2758 | 299 |
| 170 | 3300049584 | Ga0501068_0006809 | Ga0501068_0006809_5047_5964 | 299 |
| 171 | 3300049585 | Ga0501069_0023208 | Ga0501069_0023208_411_1328 | 299 |
| 172 | 3300049589 | Ga0501073_0013163 | Ga0501073_0013163_3572_4489 | 299 |
| 173 | 3300049741 | Ga0501079_0097194 | Ga0501079_0097194_226_1143 | 299 |
| 174 | 3300049744 | Ga0501083_0036142 | Ga0501083_0036142_1115_2032 | 299 |
| 175 | 3300049744 | Ga0501083_0148709 | Ga0501083_0148709_449_1378 | 299 |
| 176 | 3300049823 | Ga0501044_0054925 | Ga0501044_0054925_493_1410 | 299 |
| 177 | 3300053153 | Ga0500616_0001780 | Ga0500616_0001780_1772_2674 | 299 |
| 178 | 3300054114 | Ga0501084_0147489 | Ga0501084_0147489_439_1356 | 299 |
| 179 | 3300060353 | Ga0501082_0019577 | Ga0501082_0019577_492_1409 | 299 |
| 180 | 3300005329 | Ga0070683_100151150 | Ga0070683_1001511502 | 300 |
| 181 | 3300005336 | Ga0070680_100481573 | Ga0070680_1004815731 | 300 |
| 182 | 3300005354 | Ga0070675_100643862 | Ga0070675_1006438621 | 300 |
| 183 | 3300005366 | Ga0070659_100165836 | Ga0070659_1001658361 | 300 |
| 184 | 3300005434 | Ga0070709_10284102 | Ga0070709_102841021 | 300 |
| 185 | 3300005435 | Ga0070714_100133597 | Ga0070714_1001335972 | 300 |
| 186 | 3300005435 | Ga0070714_100281445 | Ga0070714_1002814452 | 300 |
| 187 | 3300005437 | Ga0070710_10004895 | Ga0070710_100048952 | 300 |
| 188 | 3300005439 | Ga0070711_100000697 | Ga0070711_1000006976 | 300 |
| 189 | 3300005444 | Ga0070694_100146229 | Ga0070694_1001462292 | 300 |
| 190 | 3300005535 | Ga0070684_100124234 | Ga0070684_1001242342 | 300 |
| 191 | 3300005577 | Ga0068857_100503704 | Ga0068857_1005037041 | 300 |
| 192 | 3300005614 | Ga0068856_100089582 | Ga0068856_1000895823 | 300 |
| 193 | 3300005614 | Ga0068856_100235829 | Ga0068856_1002358292 | 300 |
| 194 | 3300005937 | Ga0081455_10040966 | Ga0081455_100409663 | 300 |
| 195 | 3300005983 | Ga0081540_1043050 | Ga0081540_10430502 | 300 |
| 196 | 3300005985 | Ga0081539_10003887 | Ga0081539_1000388714 | 300 |
| 197 | 3300006028 | Ga0070717_10079271 | Ga0070717_100792712 | 300 |
| 198 | 3300006028 | Ga0070717_10090633 | Ga0070717_100906332 | 300 |
| 199 | 3300006163 | Ga0070715_10044048 | Ga0070715_100440482 | 300 |
| 200 | 3300006175 | Ga0070712_100018606 | Ga0070712_1000186063 | 300 |
| 201 | 3300007076 | Ga0075435_100241675 | Ga0075435_1002416752 | 300 |
| 202 | 3300009093 | Ga0105240_10015687 | Ga0105240_1001568712 | 300 |
| 203 | 3300020069 | Ga0197907_11455233 | Ga0197907_114552332 | 300 |
| 204 | 3300020077 | Ga0206351_10148293 | Ga0206351_101482931 | 300 |
| 205 | 3300020080 | Ga0206350_11110684 | Ga0206350_111106842 | 300 |
| 206 | 3300021358 | Ga0213873_10008091 | Ga0213873_100080912 | 300 |
| 207 | 3300021377 | Ga0213874_10004435 | Ga0213874_100044353 | 300 |
| 208 | 3300021384 | Ga0213876_10009122 | Ga0213876_100091227 | 300 |
| 209 | 3300021384 | Ga0213876_10016703 | Ga0213876_100167033 | 300 |
| 210 | 3300021384 | Ga0213876_10033713 | Ga0213876_100337133 | 300 |
| 211 | 3300021384 | Ga0213876_10060303 | Ga0213876_100603032 | 300 |
| 212 | 3300021388 | Ga0213875_10007475 | Ga0213875_100074757 | 300 |
| 213 | 3300021388 | Ga0213875_10008271 | Ga0213875_100082712 | 300 |
| 214 | 3300021388 | Ga0213875_10082058 | Ga0213875_100820582 | 300 |
| 215 | 3300025898 | Ga0207692_10029380 | Ga0207692_100293802 | 300 |
| 216 | 3300025898 | Ga0207692_10142347 | Ga0207692_101423472 | 300 |
| 217 | 3300025913 | Ga0207695_10025071 | Ga0207695_100250713 | 300 |
| 218 | 3300025915 | Ga0207693_10016406 | Ga0207693_100164064 | 300 |
| 219 | 3300025915 | Ga0207693_10059167 | Ga0207693_100591672 | 300 |
| 220 | 3300025916 | Ga0207663_10000816 | Ga0207663_100008168 | 300 |
| 221 | 3300025916 | Ga0207663_10199405 | Ga0207663_101994052 | 300 |
| 222 | 3300025922 | Ga0207646_10135675 | Ga0207646_101356752 | 300 |
| 223 | 3300025928 | Ga0207700_10146101 | Ga0207700_101461012 | 300 |
| 224 | 3300025929 | Ga0207664_10017334 | Ga0207664_100173346 | 300 |
| 225 | 3300025929 | Ga0207664_10032272 | Ga0207664_100322722 | 300 |
| 226 | 3300025932 | Ga0207690_10156148 | Ga0207690_101561482 | 300 |
| 227 | 3300025944 | Ga0207661_10129726 | Ga0207661_101297262 | 300 |
| 228 | 3300026023 | Ga0207677_10078997 | Ga0207677_100789972 | 300 |
| 229 | 3300026078 | Ga0207702_10052759 | Ga0207702_100527593 | 300 |
| 230 | 3300028556 | Ga0265337_1007606 | Ga0265337_10076063 | 300 |
| 231 | 3300028558 | Ga0265326_10008029 | Ga0265326_100080293 | 300 |
| 232 | 3300028563 | Ga0265319_1000856 | Ga0265319_10008562 | 300 |
| 233 | 3300028563 | Ga0265319_1017766 | Ga0265319_10177662 | 300 |
| 234 | 3300028577 | Ga0265318_10001043 | Ga0265318_1000104316 | 300 |
| 235 | 3300028666 | Ga0265336_10000001 | Ga0265336_10000001496 | 300 |
| 236 | 3300028800 | Ga0265338_10000004 | Ga0265338_10000004386 | 300 |
| 237 | 3300028800 | Ga0265338_10019858 | Ga0265338_100198583 | 300 |
| 238 | 3300031239 | Ga0265328_10053168 | Ga0265328_100531681 | 300 |
| 239 | 3300031247 | Ga0265340_10000002 | Ga0265340_10000002386 | 300 |
| 240 | 3300031249 | Ga0265339_10022692 | Ga0265339_100226923 | 300 |
| 241 | 3300031251 | Ga0265327_10015298 | Ga0265327_100152982 | 300 |
| 242 | 3300031251 | Ga0265327_10015845 | Ga0265327_100158455 | 300 |
| 243 | 3300031251 | Ga0265327_10027841 | Ga0265327_100278411 | 300 |
| 244 | 3300031903 | Ga0307407_10144307 | Ga0307407_101443072 | 300 |
| 245 | 3300031995 | Ga0307409_100218092 | Ga0307409_1002180922 | 300 |
| 246 | 3300035117 | Ga0373953_0006042 | Ga0373953_0006042_1822_2724 | 300 |
| 247 | 3300035410 | Ga0373924_0029689 | Ga0373924_0029689_1265_2167 | 300 |
| 248 | 3300037068 | Ga0373925_0066093 | Ga0373925_0066093_25_927 | 300 |
| 249 | 3300037853 | Ga0436364_0062618 | Ga0436364_0062618_17482_18384 | 300 |
| 250 | 3300037853 | Ga0436364_0069090 | Ga0436364_0069090_823_1725 | 300 |
| 251 | 3300037853 | Ga0436364_0244708 | Ga0436364_0244708_449_1351 | 300 |
| 252 | 3300037853 | Ga0436364_0356082 | Ga0436364_0356082_22_927 | 300 |
| 253 | 3300037853 | Ga0436364_0675766 | Ga0436364_0675766_15977_16879 | 300 |
| 254 | 3300037853 | Ga0436364_0777641 | Ga0436364_0777641_45_947 | 300 |
| 255 | 3300037853 | Ga0436364_1169259 | Ga0436364_1169259_601_1503 | 300 |
| 256 | 3300037853 | Ga0436364_1460780 | Ga0436364_1460780_1361_2263 | 300 |
| 257 | 3300039437 | Ga0436365_0130921 | Ga0436365_0130921_6400_7302 | 300 |
| 258 | 3300039437 | Ga0436365_0330823 | Ga0436365_0330823_1863_2765 | 300 |
| 259 | 3300039437 | Ga0436365_0457137 | Ga0436365_0457137_112_1014 | 300 |
| 260 | 3300039437 | Ga0436365_0520637 | Ga0436365_0520637_63_965 | 300 |
| 261 | 3300039437 | Ga0436365_0664589 | Ga0436365_0664589_939_1841 | 300 |
| 262 | 3300039437 | Ga0436365_0874987 | Ga0436365_0874987_442_1344 | 300 |
| 263 | 3300039437 | Ga0436365_1091091 | Ga0436365_1091091_282_1184 | 300 |
| 264 | 3300039437 | Ga0436365_1255617 | Ga0436365_1255617_1306_2214 | 300 |
| 265 | 3300039437 | Ga0436365_1830138 | Ga0436365_1830138_2105_3007 | 300 |
| 266 | 3300039438 | Ga0436360_0759490 | Ga0436360_0759490_104_1006 | 300 |
| 267 | 3300039450 | Ga0436363_0266991 | Ga0436363_0266991_620_1522 | 300 |
| 268 | 3300039450 | Ga0436363_0469620 | Ga0436363_0469620_119_1027 | 300 |
| 269 | 3300039450 | Ga0436363_0611387 | Ga0436363_0611387_1665_2582 | 300 |
| 270 | 3300039450 | Ga0436363_0697951 | Ga0436363_0697951_1410_2312 | 300 |
| 271 | 3300039450 | Ga0436363_1360186 | Ga0436363_1360186_1772_2674 | 300 |
| 272 | 3300039450 | Ga0436363_1586056 | Ga0436363_1586056_195_1097 | 300 |
| 273 | 3300039453 | Ga0436362_0983308 | Ga0436362_0983308_1031_1933 | 300 |
| 274 | 3300039453 | Ga0436362_1244081 | Ga0436362_1244081_2265_3167 | 300 |
| 275 | 3300044683 | Ga0466965_0020146 | Ga0466965_0020146_510_1418 | 300 |
| 276 | 3300044684 | Ga0466966_0033252 | Ga0466966_0033252_2068_2970 | 300 |
| 277 | 3300044693 | Ga0466961_0012150 | Ga0466961_0012150_2724_3626 | 300 |
| 278 | 3300044694 | Ga0466963_0009536 | Ga0466963_0009536_3058_3960 | 300 |
| 279 | 3300044694 | Ga0466963_0015424 | Ga0466963_0015424_1109_2014 | 300 |
| 280 | 3300044694 | Ga0466963_0034009 | Ga0466963_0034009_888_1805 | 300 |
| 281 | 3300044694 | Ga0466963_0040891 | Ga0466963_0040891_2118_3026 | 300 |
| 282 | 3300044694 | Ga0466963_0292869 | Ga0466963_0292869_32_943 | 300 |
| 283 | 3300044706 | Ga0466964_0101556 | Ga0466964_0101556_21_923 | 300 |
| 284 | 3300044719 | Ga0466971_0006889 | Ga0466971_0006889_2238_3140 | 300 |
| 285 | 3300044719 | Ga0466971_0094100 | Ga0466971_0094100_372_1274 | 300 |
| 286 | 3300044842 | Ga0466957_0107606 | Ga0466957_0107606_534_1442 | 300 |
| 287 | 3300045049 | Ga0466959_0035105 | Ga0466959_0035105_83_985 | 300 |
| 288 | 3300045049 | Ga0466959_0067457 | Ga0466959_0067457_104_1030 | 300 |
| 289 | 3300045049 | Ga0466959_0086239 | Ga0466959_0086239_844_1746 | 300 |
| 290 | 3300045049 | Ga0466959_0188234 | Ga0466959_0188234_295_1200 | 300 |
| 291 | 3300045836 | Ga0466958_0007923 | Ga0466958_0007923_1194_2096 | 300 |
| 292 | 3300045836 | Ga0466958_0008394 | Ga0466958_0008394_1723_2625 | 300 |
| 293 | 3300045836 | Ga0466958_0014469 | Ga0466958_0014469_1000_1902 | 300 |
| 294 | 3300045836 | Ga0466958_0018128 | Ga0466958_0018128_1145_2047 | 300 |
| 295 | 3300045836 | Ga0466958_0061598 | Ga0466958_0061598_1223_2149 | 300 |
| 296 | 3300045836 | Ga0466958_0101059 | Ga0466958_0101059_725_1627 | 300 |
| 297 | 3300045836 | Ga0466958_0115079 | Ga0466958_0115079_677_1594 | 300 |
| 298 | 3300045836 | Ga0466958_0202329 | Ga0466958_0202329_177_1079 | 300 |
| 299 | 3300045976 | Ga0466967_0007861 | Ga0466967_0007861_2787_3701 | 300 |
| 300 | 3300045976 | Ga0466967_0008366 | Ga0466967_0008366_2516_3424 | 300 |
| 301 | 3300045976 | Ga0466967_0024860 | Ga0466967_0024860_2063_2971 | 300 |
| 302 | 3300045976 | Ga0466967_0073232 | Ga0466967_0073232_918_1826 | 300 |
| 303 | 3300045976 | Ga0466967_0189697 | Ga0466967_0189697_905_1807 | 300 |
| 304 | 3300045976 | Ga0466967_0335305 | Ga0466967_0335305_244_1152 | 300 |
| 305 | 3300046459 | Ga0495629_0190160 | Ga0495629_0190160_62_979 | 300 |
| 306 | 3300046459 | Ga0495629_0246753 | Ga0495629_0246753_66_980 | 300 |
| 307 | 3300046459 | Ga0495629_0322072 | Ga0495629_0322072_105_1007 | 300 |
| 308 | 3300046462 | Ga0495651_0060829 | Ga0495651_0060829_1047_1949 | 300 |
| 309 | 3300046463 | Ga0495653_0106504 | Ga0495653_0106504_326_1228 | 300 |
| 310 | 3300046477 | Ga0495664_0000205 | Ga0495664_0000205_8098_9000 | 300 |
| 311 | 3300046511 | Ga0495608_0157676 | Ga0495608_0157676_16_918 | 300 |
| 312 | 3300046514 | Ga0495618_0046908 | Ga0495618_0046908_1634_2536 | 300 |
| 313 | 3300046516 | Ga0495628_0043476 | Ga0495628_0043476_1804_2706 | 300 |
| 314 | 3300046517 | Ga0495630_0060404 | Ga0495630_0060404_261_1178 | 300 |
| 315 | 3300046529 | Ga0495652_0060042 | Ga0495652_0060042_808_1710 | 300 |
| 316 | 3300046543 | Ga0495645_0000767 | Ga0495645_0000767_4958_5887 | 300 |
| 317 | 3300046559 | Ga0495667_0002716 | Ga0495667_0002716_1172_2074 | 300 |
| 318 | 3300046663 | Ga0495635_0209261 | Ga0495635_0209261_232_1134 | 300 |
| 319 | 3300046675 | Ga0495657_0000008 | Ga0495657_0000008_77160_78062 | 300 |
| 320 | 3300046675 | Ga0495657_0079747 | Ga0495657_0079747_737_1639 | 300 |
| 321 | 3300046809 | Ga0495600_0172610 | Ga0495600_0172610_472_1374 | 300 |
| 322 | 3300047317 | Ga0495604_0000047 | Ga0495604_0000047_88102_89004 | 300 |
| 323 | 3300047322 | Ga0495680_0033414 | Ga0495680_0033414_1994_2896 | 300 |
| 324 | 3300047471 | Ga0495684_0001325 | Ga0495684_0001325_15752_16654 | 300 |
| 325 | 3300048904 | Ga0496101_0226694 | Ga0496101_0226694_98_1000 | 300 |
| 326 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_200812_201714 | 300 |
| 327 | 3300048907 | Ga0496104_0082376 | Ga0496104_0082376_1956_2858 | 300 |
| 328 | 3300048908 | Ga0496105_0081249 | Ga0496105_0081249_330_1232 | 300 |
| 329 | 3300048911 | Ga0496108_0352226 | Ga0496108_0352226_317_1225 | 300 |
| 330 | 3300048913 | Ga0496110_0000153 | Ga0496110_0000153_11097_11999 | 300 |
| 331 | 3300048914 | Ga0496111_0000110 | Ga0496111_0000110_11052_11954 | 300 |
| 332 | 3300048914 | Ga0496111_0089931 | Ga0496111_0089931_308_1216 | 300 |
| 333 | 3300048915 | Ga0496112_0028226 | Ga0496112_0028226_2451_3359 | 300 |
| 334 | 3300048916 | Ga0496113_0129097 | Ga0496113_0129097_457_1359 | 300 |
| 335 | 3300048918 | Ga0496115_0471565 | Ga0496115_0471565_94_999 | 300 |
| 336 | 3300049568 | Ga0501031_0098518 | Ga0501031_0098518_543_1445 | 300 |
| 337 | 3300049575 | Ga0501039_0066296 | Ga0501039_0066296_1704_2606 | 300 |
| 338 | 3300049581 | Ga0501047_0269751 | Ga0501047_0269751_371_1273 | 300 |
| 339 | 3300049587 | Ga0501071_0066498 | Ga0501071_0066498_1700_2602 | 300 |
| 340 | 3300049592 | Ga0501076_0166234 | Ga0501076_0166234_499_1401 | 300 |
| 341 | 3300049741 | Ga0501079_0219848 | Ga0501079_0219848_271_1173 | 300 |
| 342 | 3300049824 | Ga0501045_0171713 | Ga0501045_0171713_646_1548 | 300 |
| 343 | 3300050513 | nmdc:mga0rr50_284969_c1 | nmdc:mga0rr50_284969_c1_82_984 | 300 |
| 344 | 3300053077 | Ga0495601_0020606 | Ga0495601_0020606_3001_3903 | 300 |
| 345 | 3300053078 | Ga0495612_0000092 | Ga0495612_0000092_36861_37763 | 300 |
| 346 | 3300053085 | Ga0495619_0076611 | Ga0495619_0076611_883_1785 | 300 |
| 347 | 3300053085 | Ga0495619_0102295 | Ga0495619_0102295_230_1132 | 300 |
| 348 | 3300061719 | Ga0466962_0001846 | Ga0466962_0001846_6216_7118 | 300 |
| 349 | 3300061719 | Ga0466962_0014682 | Ga0466962_0014682_2520_3422 | 300 |
| 350 | 3300001990 | JGI24737J22298_10045758 | JGI24737J22298_100457581 | 301 |
| 351 | 3300005329 | Ga0070683_100436438 | Ga0070683_1004364381 | 301 |
| 352 | 3300005330 | Ga0070690_100107249 | Ga0070690_1001072492 | 301 |
| 353 | 3300005331 | Ga0070670_100172440 | Ga0070670_1001724402 | 301 |
| 354 | 3300005338 | Ga0068868_100158574 | Ga0068868_1001585742 | 301 |
| 355 | 3300005339 | Ga0070660_100326172 | Ga0070660_1003261722 | 301 |
| 356 | 3300005343 | Ga0070687_100008299 | Ga0070687_1000082992 | 301 |
| 357 | 3300005353 | Ga0070669_100007861 | Ga0070669_1000078618 | 301 |
| 358 | 3300005366 | Ga0070659_100000958 | Ga0070659_1000009582 | 301 |
| 359 | 3300005435 | Ga0070714_100001248 | Ga0070714_10000124816 | 301 |
| 360 | 3300005435 | Ga0070714_100045891 | Ga0070714_1000458915 | 301 |
| 361 | 3300005435 | Ga0070714_100303139 | Ga0070714_1003031392 | 301 |
| 362 | 3300005436 | Ga0070713_100107730 | Ga0070713_1001077303 | 301 |
| 363 | 3300005437 | Ga0070710_10000001 | Ga0070710_10000001170 | 301 |
| 364 | 3300005440 | Ga0070705_100001031 | Ga0070705_10000103114 | 301 |
| 365 | 3300005441 | Ga0070700_100023295 | Ga0070700_1000232952 | 301 |
| 366 | 3300005455 | Ga0070663_100134882 | Ga0070663_1001348822 | 301 |
| 367 | 3300005459 | Ga0068867_100064997 | Ga0068867_1000649974 | 301 |
| 368 | 3300005535 | Ga0070684_100144156 | Ga0070684_1001441561 | 301 |
| 369 | 3300005544 | Ga0070686_100068730 | Ga0070686_1000687302 | 301 |
| 370 | 3300005548 | Ga0070665_100005111 | Ga0070665_1000051117 | 301 |
| 371 | 3300005548 | Ga0070665_100099732 | Ga0070665_1000997322 | 301 |
| 372 | 3300005564 | Ga0070664_100052463 | Ga0070664_1000524633 | 301 |
| 373 | 3300005577 | Ga0068857_100143996 | Ga0068857_1001439962 | 301 |
| 374 | 3300005578 | Ga0068854_100075484 | Ga0068854_1000754842 | 301 |
| 375 | 3300005615 | Ga0070702_100012690 | Ga0070702_1000126903 | 301 |
| 376 | 3300005616 | Ga0068852_100181069 | Ga0068852_1001810692 | 301 |
| 377 | 3300005617 | Ga0068859_100316003 | Ga0068859_1003160032 | 301 |
| 378 | 3300005719 | Ga0068861_100022634 | Ga0068861_1000226343 | 301 |
| 379 | 3300005719 | Ga0068861_100090520 | Ga0068861_1000905202 | 301 |
| 380 | 3300005719 | Ga0068861_100177113 | Ga0068861_1001771132 | 301 |
| 381 | 3300005840 | Ga0068870_10129839 | Ga0068870_101298392 | 301 |
| 382 | 3300005842 | Ga0068858_100446652 | Ga0068858_1004466522 | 301 |
| 383 | 3300005843 | Ga0068860_100259450 | Ga0068860_1002594502 | 301 |
| 384 | 3300005844 | Ga0068862_100224309 | Ga0068862_1002243092 | 301 |
| 385 | 3300005937 | Ga0081455_10139900 | Ga0081455_101399002 | 301 |
| 386 | 3300005937 | Ga0081455_10179257 | Ga0081455_101792572 | 301 |
| 387 | 3300005981 | Ga0081538_10023034 | Ga0081538_100230343 | 301 |
| 388 | 3300005981 | Ga0081538_10035305 | Ga0081538_100353052 | 301 |
| 389 | 3300005983 | Ga0081540_1003705 | Ga0081540_10037056 | 301 |
| 390 | 3300005983 | Ga0081540_1024344 | Ga0081540_10243442 | 301 |
| 391 | 3300006028 | Ga0070717_10000010 | Ga0070717_1000001029 | 301 |
| 392 | 3300006038 | Ga0075365_10139442 | Ga0075365_101394422 | 301 |
| 393 | 3300006175 | Ga0070712_100000009 | Ga0070712_10000000918 | 301 |
| 394 | 3300006844 | Ga0075428_100114672 | Ga0075428_1001146723 | 301 |
| 395 | 3300006846 | Ga0075430_100020474 | Ga0075430_1000204746 | 301 |
| 396 | 3300006881 | Ga0068865_100053887 | Ga0068865_1000538872 | 301 |
| 397 | 3300006931 | Ga0097620_100316028 | Ga0097620_1003160282 | 301 |
| 398 | 3300009011 | Ga0105251_10088946 | Ga0105251_100889462 | 301 |
| 399 | 3300009093 | Ga0105240_10052389 | Ga0105240_100523892 | 301 |
| 400 | 3300009093 | Ga0105240_10731293 | Ga0105240_107312931 | 301 |
| 401 | 3300009094 | Ga0111539_10341189 | Ga0111539_103411892 | 301 |
| 402 | 3300009098 | Ga0105245_10039725 | Ga0105245_100397253 | 301 |
| 403 | 3300009148 | Ga0105243_10074830 | Ga0105243_100748302 | 301 |
| 404 | 3300009148 | Ga0105243_10110628 | Ga0105243_101106282 | 301 |
| 405 | 3300009177 | Ga0105248_10648031 | Ga0105248_106480312 | 301 |
| 406 | 3300009545 | Ga0105237_10004179 | Ga0105237_100041794 | 301 |
| 407 | 3300009553 | Ga0105249_10028423 | Ga0105249_100284232 | 301 |
| 408 | 3300009553 | Ga0105249_10301502 | Ga0105249_103015022 | 301 |
| 409 | 3300010375 | Ga0105239_10073439 | Ga0105239_100734393 | 301 |
| 410 | 3300010375 | Ga0105239_10080355 | Ga0105239_100803554 | 301 |
| 411 | 3300011119 | Ga0105246_10061522 | Ga0105246_100615222 | 301 |
| 412 | 3300014325 | Ga0163163_10264339 | Ga0163163_102643392 | 301 |
| 413 | 3300014326 | Ga0157380_10156593 | Ga0157380_101565932 | 301 |
| 414 | 3300014745 | Ga0157377_10137823 | Ga0157377_101378232 | 301 |
| 415 | 3300014968 | Ga0157379_10015321 | Ga0157379_100153212 | 301 |
| 416 | 3300014968 | Ga0157379_10298094 | Ga0157379_102980942 | 301 |
| 417 | 3300025898 | Ga0207692_10000004 | Ga0207692_10000004259 | 301 |
| 418 | 3300025904 | Ga0207647_10080261 | Ga0207647_100802612 | 301 |
| 419 | 3300025908 | Ga0207643_10060791 | Ga0207643_100607912 | 301 |
| 420 | 3300025913 | Ga0207695_10052956 | Ga0207695_100529562 | 301 |
| 421 | 3300025914 | Ga0207671_10007639 | Ga0207671_100076393 | 301 |
| 422 | 3300025915 | Ga0207693_10000036 | Ga0207693_1000003655 | 301 |
| 423 | 3300025918 | Ga0207662_10054254 | Ga0207662_100542542 | 301 |
| 424 | 3300025919 | Ga0207657_10002206 | Ga0207657_1000220613 | 301 |
| 425 | 3300025919 | Ga0207657_10046633 | Ga0207657_100466331 | 301 |
| 426 | 3300025919 | Ga0207657_10093105 | Ga0207657_100931051 | 301 |
| 427 | 3300025921 | Ga0207652_10023270 | Ga0207652_100232704 | 301 |
| 428 | 3300025923 | Ga0207681_10006486 | Ga0207681_100064862 | 301 |
| 429 | 3300025925 | Ga0207650_10207655 | Ga0207650_102076552 | 301 |
| 430 | 3300025927 | Ga0207687_10059409 | Ga0207687_100594092 | 301 |
| 431 | 3300025927 | Ga0207687_10067609 | Ga0207687_100676093 | 301 |
| 432 | 3300025928 | Ga0207700_10013684 | Ga0207700_100136844 | 301 |
| 433 | 3300025929 | Ga0207664_10000012 | Ga0207664_10000012227 | 301 |
| 434 | 3300025929 | Ga0207664_10004746 | Ga0207664_100047469 | 301 |
| 435 | 3300025929 | Ga0207664_10081462 | Ga0207664_100814622 | 301 |
| 436 | 3300025932 | Ga0207690_10000085 | Ga0207690_1000008544 | 301 |
| 437 | 3300025932 | Ga0207690_10155366 | Ga0207690_101553662 | 301 |
| 438 | 3300025933 | Ga0207706_10066534 | Ga0207706_100665343 | 301 |
| 439 | 3300025935 | Ga0207709_10044976 | Ga0207709_100449762 | 301 |
| 440 | 3300025937 | Ga0207669_10032227 | Ga0207669_100322272 | 301 |
| 441 | 3300025938 | Ga0207704_10368852 | Ga0207704_103688521 | 301 |
| 442 | 3300025942 | Ga0207689_10128144 | Ga0207689_101281442 | 301 |
| 443 | 3300025942 | Ga0207689_10313910 | Ga0207689_103139102 | 301 |
| 444 | 3300025942 | Ga0207689_10330996 | Ga0207689_103309961 | 301 |
| 445 | 3300025944 | Ga0207661_10074302 | Ga0207661_100743022 | 301 |
| 446 | 3300025944 | Ga0207661_10575124 | Ga0207661_105751241 | 301 |
| 447 | 3300025945 | Ga0207679_10035059 | Ga0207679_100350593 | 301 |
| 448 | 3300025945 | Ga0207679_10059893 | Ga0207679_100598932 | 301 |
| 449 | 3300025945 | Ga0207679_10492857 | Ga0207679_104928571 | 301 |
| 450 | 3300026035 | Ga0207703_10180494 | Ga0207703_101804942 | 301 |
| 451 | 3300026075 | Ga0207708_10040954 | Ga0207708_100409542 | 301 |
| 452 | 3300026095 | Ga0207676_10099392 | Ga0207676_100993922 | 301 |
| 453 | 3300026095 | Ga0207676_10206420 | Ga0207676_102064202 | 301 |
| 454 | 3300026095 | Ga0207676_10311382 | Ga0207676_103113822 | 301 |
| 455 | 3300026116 | Ga0207674_10168635 | Ga0207674_101686352 | 301 |
| 456 | 3300026116 | Ga0207674_10269080 | Ga0207674_102690802 | 301 |
| 457 | 3300026118 | Ga0207675_100739869 | Ga0207675_1007398691 | 301 |
| 458 | 3300026121 | Ga0207683_10133770 | Ga0207683_101337702 | 301 |
| 459 | 3300026142 | Ga0207698_10145120 | Ga0207698_101451202 | 301 |
| 460 | 3300027907 | Ga0207428_10207666 | Ga0207428_102076662 | 301 |
| 461 | 3300028379 | Ga0268266_10052399 | Ga0268266_100523992 | 301 |
| 462 | 3300028379 | Ga0268266_10064248 | Ga0268266_100642482 | 301 |
| 463 | 3300028380 | Ga0268265_10188150 | Ga0268265_101881502 | 301 |
| 464 | 3300028558 | Ga0265326_10000008 | Ga0265326_1000000836 | 301 |
| 465 | 3300028573 | Ga0265334_10000152 | Ga0265334_1000015236 | 301 |
| 466 | 3300028800 | Ga0265338_10017274 | Ga0265338_100172747 | 301 |
| 467 | 3300029957 | Ga0265324_10052840 | Ga0265324_100528402 | 301 |
| 468 | 3300031240 | Ga0265320_10142844 | Ga0265320_101428441 | 301 |
| 469 | 3300031711 | Ga0265314_10159195 | Ga0265314_101591951 | 301 |
| 470 | 3300031731 | Ga0307405_10030746 | Ga0307405_100307463 | 301 |
| 471 | 3300031824 | Ga0307413_10038954 | Ga0307413_100389542 | 301 |
| 472 | 3300031911 | Ga0307412_10006995 | Ga0307412_100069956 | 301 |
| 473 | 3300031995 | Ga0307409_100020634 | Ga0307409_1000206342 | 301 |
| 474 | 3300031995 | Ga0307409_100025208 | Ga0307409_1000252081 | 301 |
| 475 | 3300031995 | Ga0307409_100072662 | Ga0307409_1000726621 | 301 |
| 476 | 3300031995 | Ga0307409_100305740 | Ga0307409_1003057402 | 301 |
| 477 | 3300032002 | Ga0307416_100006253 | Ga0307416_1000062532 | 301 |
| 478 | 3300032002 | Ga0307416_100017076 | Ga0307416_1000170762 | 301 |
| 479 | 3300032002 | Ga0307416_100030625 | Ga0307416_1000306252 | 301 |
| 480 | 3300032002 | Ga0307416_100460268 | Ga0307416_1004602681 | 301 |
| 481 | 3300032004 | Ga0307414_10080139 | Ga0307414_100801392 | 301 |
| 482 | 3300032005 | Ga0307411_10120148 | Ga0307411_101201482 | 301 |
| 483 | 3300032126 | Ga0307415_100117781 | Ga0307415_1001177811 | 301 |
| 484 | 3300035691 | Ga0373931_0244635 | Ga0373931_0244635_65_970 | 301 |
| 485 | 3300038996 | Ga0242420_010926 | Ga0242420_010926_152_1057 | 301 |
| 486 | 3300041408 | Ga0439453_0032856 | Ga0439453_0032856_55_966 | 301 |
| 487 | 3300041451 | Ga0451791_0824279 | Ga0451791_0824279_170_1081 | 301 |
| 488 | 3300042142 | Ga0450905_006481 | Ga0450905_006481_564_1517 | 301 |
| 489 | 3300044684 | Ga0466966_0114449 | Ga0466966_0114449_292_1197 | 301 |
| 490 | 3300044693 | Ga0466961_0113024 | Ga0466961_0113024_233_1147 | 301 |
| 491 | 3300044765 | Ga0466970_0113984 | Ga0466970_0113984_175_1110 | 301 |
| 492 | 3300044901 | Ga0466960_0016276 | Ga0466960_0016276_1306_2211 | 301 |
| 493 | 3300044901 | Ga0466960_0056356 | Ga0466960_0056356_131_1039 | 301 |
| 494 | 3300045836 | Ga0466958_0248390 | Ga0466958_0248390_89_994 | 301 |
| 495 | 3300045976 | Ga0466967_0072364 | Ga0466967_0072364_2095_3003 | 301 |
| 496 | 3300045976 | Ga0466967_0075614 | Ga0466967_0075614_1564_2496 | 301 |
| 497 | 3300045976 | Ga0466967_0211810 | Ga0466967_0211810_760_1674 | 301 |
| 498 | 3300045976 | Ga0466967_0212812 | Ga0466967_0212812_382_1299 | 301 |
| 499 | 3300045976 | Ga0466967_0459976 | Ga0466967_0459976_118_1026 | 301 |
| 500 | 3300046463 | Ga0495653_0000754 | Ga0495653_0000754_19366_20286 | 301 |
| 501 | 3300046471 | Ga0495650_0000188 | Ga0495650_0000188_97907_98827 | 301 |
| 502 | 3300046473 | Ga0495582_0161244 | Ga0495582_0161244_283_1197 | 301 |
| 503 | 3300046476 | Ga0495662_0141435 | Ga0495662_0141435_120_1040 | 301 |
| 504 | 3300046514 | Ga0495618_0001356 | Ga0495618_0001356_11150_12073 | 301 |
| 505 | 3300046543 | Ga0495645_0000121 | Ga0495645_0000121_22103_23023 | 301 |
| 506 | 3300046691 | Ga0495670_0097225 | Ga0495670_0097225_535_1455 | 301 |
| 507 | 3300047320 | Ga0495672_0015377 | Ga0495672_0015377_4209_5123 | 301 |
| 508 | 3300048903 | Ga0496100_0001384 | Ga0496100_0001384_6960_7880 | 301 |
| 509 | 3300048903 | Ga0496100_0032465 | Ga0496100_0032465_823_1731 | 301 |
| 510 | 3300048903 | Ga0496100_0047647 | Ga0496100_0047647_49_957 | 301 |
| 511 | 3300048904 | Ga0496101_0001701 | Ga0496101_0001701_48_965 | 301 |
| 512 | 3300048904 | Ga0496101_0131731 | Ga0496101_0131731_705_1613 | 301 |
| 513 | 3300048904 | Ga0496101_0170908 | Ga0496101_0170908_48_953 | 301 |
| 514 | 3300048905 | Ga0496102_0223535 | Ga0496102_0223535_267_1172 | 301 |
| 515 | 3300048907 | Ga0496104_0049757 | Ga0496104_0049757_2789_3697 | 301 |
| 516 | 3300048908 | Ga0496105_0117981 | Ga0496105_0117981_641_1561 | 301 |
| 517 | 3300048908 | Ga0496105_0220969 | Ga0496105_0220969_26_934 | 301 |
| 518 | 3300048909 | Ga0496106_0014023 | Ga0496106_0014023_473_1390 | 301 |
| 519 | 3300048909 | Ga0496106_0034783 | Ga0496106_0034783_2513_3418 | 301 |
| 520 | 3300048910 | Ga0496107_0014786 | Ga0496107_0014786_267_1184 | 301 |
| 521 | 3300048910 | Ga0496107_0162263 | Ga0496107_0162263_107_1012 | 301 |
| 522 | 3300048911 | Ga0496108_0002384 | Ga0496108_0002384_4611_5519 | 301 |
| 523 | 3300048911 | Ga0496108_0079290 | Ga0496108_0079290_842_1747 | 301 |
| 524 | 3300048911 | Ga0496108_0095481 | Ga0496108_0095481_510_1415 | 301 |
| 525 | 3300048911 | Ga0496108_0129569 | Ga0496108_0129569_982_1890 | 301 |
| 526 | 3300048911 | Ga0496108_0136321 | Ga0496108_0136321_846_1754 | 301 |
| 527 | 3300048912 | Ga0496109_0015699 | Ga0496109_0015699_55_966 | 301 |
| 528 | 3300048912 | Ga0496109_0020518 | Ga0496109_0020518_681_1589 | 301 |
| 529 | 3300048912 | Ga0496109_0068350 | Ga0496109_0068350_135_1043 | 301 |
| 530 | 3300048913 | Ga0496110_0053952 | Ga0496110_0053952_384_1292 | 301 |
| 531 | 3300048913 | Ga0496110_0500910 | Ga0496110_0500910_149_1081 | 301 |
| 532 | 3300048914 | Ga0496111_0012209 | Ga0496111_0012209_2895_3803 | 301 |
| 533 | 3300048914 | Ga0496111_0144979 | Ga0496111_0144979_666_1574 | 301 |
| 534 | 3300048914 | Ga0496111_0289368 | Ga0496111_0289368_235_1155 | 301 |
| 535 | 3300048915 | Ga0496112_0005516 | Ga0496112_0005516_37_945 | 301 |
| 536 | 3300048915 | Ga0496112_0032700 | Ga0496112_0032700_4081_5010 | 301 |
| 537 | 3300048916 | Ga0496113_0015189 | Ga0496113_0015189_3465_4370 | 301 |
| 538 | 3300048917 | Ga0496114_0145902 | Ga0496114_0145902_613_1518 | 301 |
| 539 | 3300048918 | Ga0496115_0000034 | Ga0496115_0000034_102015_102935 | 301 |
| 540 | 3300048918 | Ga0496115_0000240 | Ga0496115_0000240_1900_2820 | 301 |
| 541 | 3300048918 | Ga0496115_0010151 | Ga0496115_0010151_3015_3932 | 301 |
| 542 | 3300048918 | Ga0496115_0080129 | Ga0496115_0080129_1054_1959 | 301 |
| 543 | 3300048924 | Ga0496121_0001001 | Ga0496121_0001001_3507_4433 | 301 |
| 544 | 3300049568 | Ga0501031_0031849 | Ga0501031_0031849_368_1273 | 301 |
| 545 | 3300049572 | Ga0501036_0228375 | Ga0501036_0228375_406_1311 | 301 |
| 546 | 3300049574 | Ga0501038_0340625 | Ga0501038_0340625_36_941 | 301 |
| 547 | 3300049575 | Ga0501039_0027769 | Ga0501039_0027769_925_1833 | 301 |
| 548 | 3300049576 | Ga0501040_0187913 | Ga0501040_0187913_292_1197 | 301 |
| 549 | 3300049578 | Ga0501042_0073316 | Ga0501042_0073316_617_1525 | 301 |
| 550 | 3300049582 | Ga0501048_0105644 | Ga0501048_0105644_88_996 | 301 |
| 551 | 3300049586 | Ga0501070_0141021 | Ga0501070_0141021_513_1445 | 301 |
| 552 | 3300049587 | Ga0501071_0062921 | Ga0501071_0062921_401_1306 | 301 |
| 553 | 3300049587 | Ga0501071_0086580 | Ga0501071_0086580_253_1158 | 301 |
| 554 | 3300049588 | Ga0501072_0079595 | Ga0501072_0079595_1168_2076 | 301 |
| 555 | 3300049591 | Ga0501075_0201632 | Ga0501075_0201632_427_1332 | 301 |
| 556 | 3300049592 | Ga0501076_0128876 | Ga0501076_0128876_670_1575 | 301 |
| 557 | 3300049741 | Ga0501079_0121179 | Ga0501079_0121179_148_1053 | 301 |
| 558 | 3300049742 | Ga0501080_0093952 | Ga0501080_0093952_861_1784 | 301 |
| 559 | 3300049824 | Ga0501045_0077302 | Ga0501045_0077302_711_1616 | 301 |
| 560 | 3300049824 | Ga0501045_0151863 | Ga0501045_0151863_617_1525 | 301 |
| 561 | 3300050508 | nmdc:mga09592_10424_c1 | nmdc:mga09592_10424_c1_3399_4310 | 301 |
| 562 | 3300050509 | nmdc:mga0qj67_2514_c1 | nmdc:mga0qj67_2514_c1_1126_2031 | 301 |
| 563 | 3300050514 | nmdc:mga08x19_271772_c1 | nmdc:mga08x19_271772_c1_120_1028 | 301 |
| 564 | 3300054114 | Ga0501084_0036016 | Ga0501084_0036016_811_1719 | 301 |
| 565 | 3300060353 | Ga0501082_0054990 | Ga0501082_0054990_941_1846 | 301 |
| 566 | 3300060353 | Ga0501082_0066900 | Ga0501082_0066900_1610_2518 | 301 |
| 567 | 3300061719 | Ga0466962_0031565 | Ga0466962_0031565_827_1762 | 301 |
| 568 | 3300061734 | Ga0530510_0085888 | Ga0530510_0085888_784_1692 | 301 |
| 569 | 3300061734 | Ga0530510_0281500 | Ga0530510_0281500_143_1048 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5odq-assembly1.cif.gz_B | heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. | 0.912 | 1 | 289 |
| 5odq-assembly1.cif.gz_B | heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. | 0.9031 | 1 | 289 |
| 7bkb-assembly1.cif.gz_B | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) | 0.8998 | 2 | 296 |
| 7bkb-assembly1.cif.gz_B | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) | 0.8911 | 2 | 296 |
| 3kwl-assembly1.cif.gz_A | crystal structure of a hypothetical protein from helicobacter pylori | 0.8609 | 3 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58273_1_128_1.20.1050.140 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9114 | 1 | 129 | 1.20.1050.140 |
| af_Q58273_1_128_1.20.1050.140 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9048 | 1 | 129 | 1.20.1050.140 |
| 3kwlA03 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.8404 | 3 | 129 | 1.20.1050.140 |
| 3kwlA04 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8232 | 140 | 284 | 3.40.50.11810 |
| 3kwlA04 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7731 | 140 | 284 | 3.40.50.11810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8VPW6-F1-model_v4 | Disulfide reductase | 0.9767 | 172 | 261 |
GO:0016491
|
| AF-A0A7V9M680-F1-model_v4 | CoB--CoM heterodisulfide reductase iron-sulfur subunit B family protein | 0.9739 | 1 | 288 |
GO:0016491
|
| AF-A0A661HSC2-F1-model_v4 | Heterodisulfide reductase subunit B | 0.9675 | 188 | 281 |
GO:0016491
|
| AF-A0A7C7PM84-F1-model_v4 | Heterodisulfide reductase subunit B | 0.9653 | 78 | 288 |
GO:0016491
|
| AF-X1W2N9-F1-model_v4 | Cysteine-rich domain-containing protein | 0.9651 | 206 | 287 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar