F464746

General Info

Members Datasets Scaffolds Average Seq Length
569 263 569 300

Family's Representative Sequence

Representative Sequence 3300042142|Ga0450905_006481|Ga0450905_006481_564_1517
Length 317
Sequence VKVAYWPGCVSRGFTPELHGSMAKVAPLLDIELVELDRACCTGAGVIAEHNQELADTLNARTFALAQQEIANGADLMMNICSTCQGAQSECQERLDANSEYRAHVNETLSTEGLTYEKGIANKHFLWLMVEEIGLDAIRAKVQRPLTDLRVGPFYGCYIVRPTTRLNIDEEHPRDRYLHRLIEALGGTVVDYAGAYKCCGFPIITMNKQASLMQAGTHLGDAADAEADCLVTPCPLCHLNLDLQQPLAEQVVGRPLNMPVLHLPQLVGLAFGLDPKELGLNRHVVKPTSVIDWSTSVVAGVGGSDERAGSHAASGGW

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 12.48
Rhizosphere 78.91
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10045758 3300001990 Bacteria 1336
2 JGI25406J46586_10028559 3300003203 Bacteria 2124
3 Ga0070683_100029285 3300005329 Bacteria 4983
4 Ga0070683_100151150 3300005329 Bacteria 2201
5 Ga0070683_100436438 3300005329 Bacteria 1249
6 Ga0070690_100107249 3300005330 Bacteria 1859
7 Ga0070670_100172440 3300005331 Bacteria 1877
8 Ga0070680_100481573 3300005336 Bacteria 1061
9 Ga0068868_100158574 3300005338 Bacteria 1867
10 Ga0070660_100296041 3300005339 Bacteria 1326
11 Ga0070660_100326172 3300005339 Bacteria 1262
12 Ga0070691_10010760 3300005341 Bacteria 4175
13 Ga0070687_100008299 3300005343 Bacteria 4390
14 Ga0070668_100040383 3300005347 Bacteria 3570
15 Ga0070669_100007861 3300005353 Bacteria 7624
16 Ga0070675_100643862 3300005354 Bacteria 963
17 Ga0070671_100367354 3300005355 Bacteria 1229
18 Ga0070659_100000958 3300005366 Bacteria 21249
19 Ga0070659_100165836 3300005366 Bacteria 1807
20 Ga0070709_10284102 3300005434 Bacteria 1204
21 Ga0070714_100001248 3300005435 Bacteria 18354
22 Ga0070714_100045891 3300005435 Bacteria 3705
23 Ga0070714_100133597 3300005435 Bacteria 2219
24 Ga0070714_100281445 3300005435 Bacteria 1545
25 Ga0070714_100303139 3300005435 Bacteria 1490
26 Ga0070713_100107730 3300005436 Bacteria 2425
27 Ga0070710_10000001 3300005437 Bacteria 552187
28 Ga0070710_10004895 3300005437 Bacteria 6338
29 Ga0070701_10070592 3300005438 Bacteria 1866
30 Ga0070711_100000697 3300005439 Bacteria 17598
31 Ga0070705_100001031 3300005440 Bacteria 15524
32 Ga0070700_100023295 3300005441 Bacteria 3620
33 Ga0070700_100033379 3300005441 Bacteria 3099
34 Ga0070694_100146229 3300005444 Bacteria 1722
35 Ga0070663_100134882 3300005455 Bacteria 1879
36 Ga0070678_100150902 3300005456 Bacteria 1872
37 Ga0070678_100276750 3300005456 Bacteria 1418
38 Ga0068867_100064997 3300005459 Bacteria 2713
39 Ga0070685_10168846 3300005466 Bacteria 1401
40 Ga0070707_100322244 3300005468 Bacteria 1502
41 Ga0070684_100108879 3300005535 Bacteria 2483
42 Ga0070684_100124234 3300005535 Bacteria 2323
43 Ga0070684_100144156 3300005535 Bacteria 2155
44 Ga0070672_100118094 3300005543 Bacteria 2169
45 Ga0070686_100068730 3300005544 Bacteria 2311
46 Ga0070665_100005111 3300005548 Bacteria 13604
47 Ga0070665_100099732 3300005548 Bacteria 2909
48 Ga0070664_100020034 3300005564 Bacteria 5507
49 Ga0070664_100052463 3300005564 Bacteria 3454
50 Ga0068857_100143996 3300005577 Bacteria 2156
51 Ga0068857_100165735 3300005577 Bacteria 2007
52 Ga0068857_100412062 3300005577 Bacteria 1259
53 Ga0068857_100414692 3300005577 Bacteria 1255
54 Ga0068857_100503704 3300005577 Bacteria 1137
55 Ga0068854_100075484 3300005578 Bacteria 2475
56 Ga0068856_100031094 3300005614 Bacteria 5221
57 Ga0068856_100089582 3300005614 Bacteria 3059
58 Ga0068856_100235829 3300005614 Bacteria 1845
59 Ga0070702_100012690 3300005615 Bacteria 4233
60 Ga0068852_100181069 3300005616 Bacteria 1982
61 Ga0068859_100316003 3300005617 Bacteria 1656
62 Ga0068864_100008699 3300005618 Bacteria 8376
63 Ga0068861_100022634 3300005719 Bacteria 4530
64 Ga0068861_100090520 3300005719 Bacteria 2413
65 Ga0068861_100109208 3300005719 Bacteria 2214
66 Ga0068861_100177113 3300005719 Bacteria 1772
67 Ga0068851_10106353 3300005834 Bacteria 1494
68 Ga0068870_10090393 3300005840 Bacteria 1710
69 Ga0068870_10129839 3300005840 Bacteria 1462
70 Ga0068858_100446652 3300005842 Bacteria 1246
71 Ga0068860_100259450 3300005843 Bacteria 1694
72 Ga0068862_100224309 3300005844 Bacteria 1702
73 Ga0081455_10040966 3300005937 Bacteria 4080
74 Ga0081455_10082621 3300005937 Bacteria 2627
75 Ga0081455_10139900 3300005937 Bacteria 1881
76 Ga0081455_10179257 3300005937 Bacteria 1606
77 Ga0081538_10023034 3300005981 Bacteria 4489
78 Ga0081538_10035305 3300005981 Bacteria 3286
79 Ga0081540_1003705 3300005983 Bacteria 11972
80 Ga0081540_1024344 3300005983 Bacteria 3515
81 Ga0081540_1043050 3300005983 Bacteria 2321
82 Ga0081539_10003887 3300005985 Bacteria 17435
83 Ga0081539_10010609 3300005985 Bacteria 7442
84 Ga0081539_10024574 3300005985 Bacteria 3904
85 Ga0070717_10000010 3300006028 Bacteria 283501
86 Ga0070717_10079271 3300006028 Bacteria 2753
87 Ga0070717_10090633 3300006028 Bacteria 2580
88 Ga0075365_10139442 3300006038 Bacteria 1683
89 Ga0070715_10044048 3300006163 Bacteria 1885
90 Ga0070712_100000009 3300006175 Bacteria 143615
91 Ga0070712_100018606 3300006175 Bacteria 4515
92 Ga0070712_100236609 3300006175 Bacteria 1453
93 Ga0075428_100114672 3300006844 Bacteria 2935
94 Ga0075428_100146556 3300006844 Bacteria 2566
95 Ga0075430_100020474 3300006846 Bacteria 5627
96 Ga0075433_10024129 3300006852 Bacteria 5128
97 Ga0068865_100053887 3300006881 Bacteria 2792
98 Ga0075436_100083489 3300006914 Bacteria 2216
99 Ga0097620_100316028 3300006931 Bacteria 1656
100 Ga0075435_100087828 3300007076 Bacteria 2562
101 Ga0075435_100241675 3300007076 Bacteria 1536
102 Ga0105251_10088946 3300009011 Bacteria 1420
103 Ga0105240_10015687 3300009093 Bacteria 10285
104 Ga0105240_10052389 3300009093 Bacteria 5131
105 Ga0105240_10465592 3300009093 Bacteria 1411
106 Ga0105240_10731293 3300009093 Bacteria 1077
107 Ga0111539_10170388 3300009094 Bacteria 2544
108 Ga0111539_10341189 3300009094 Bacteria 1744
109 Ga0105245_10039725 3300009098 Bacteria 4188
110 Ga0114129_10929594 3300009147 Unclassified 1100
111 Ga0105243_10074830 3300009148 Bacteria 2747
112 Ga0105243_10089259 3300009148 Bacteria 2534
113 Ga0105243_10110628 3300009148 Bacteria 2298
114 Ga0105248_10648031 3300009177 Bacteria 1192
115 Ga0105237_10004179 3300009545 Bacteria 16814
116 Ga0105249_10028423 3300009553 Bacteria 5047
117 Ga0105249_10066065 3300009553 Bacteria 3329
118 Ga0105249_10301502 3300009553 Bacteria 1607
119 Ga0105239_10032416 3300010375 Bacteria 5742
120 Ga0105239_10073439 3300010375 Bacteria 3760
121 Ga0105239_10080355 3300010375 Bacteria 3587
122 Ga0105246_10061522 3300011119 Bacteria 2613
123 Ga0157374_10004714 3300013296 Bacteria 11449
124 Ga0157378_10057033 3300013297 Bacteria 3481
125 Ga0157372_10063787 3300013307 Bacteria 4133
126 Ga0163163_10264339 3300014325 Bacteria 1772
127 Ga0157380_10147264 3300014326 Bacteria 2031
128 Ga0157380_10156593 3300014326 Bacteria 1975
129 Ga0157377_10000780 3300014745 Bacteria 13175
130 Ga0157377_10137823 3300014745 Bacteria 1497
131 Ga0157379_10015321 3300014968 Bacteria 6725
132 Ga0157379_10298094 3300014968 Bacteria 1469
133 Ga0197907_11455233 3300020069 Bacteria 1707
134 Ga0206356_11093505 3300020070 Bacteria 1435
135 Ga0206351_10148293 3300020077 Bacteria 1304
136 Ga0206350_11110684 3300020080 Bacteria 1885
137 Ga0213873_10008091 3300021358 Bacteria 2134
138 Ga0213874_10004435 3300021377 Bacteria 3205
139 Ga0213876_10009122 3300021384 Bacteria 5341
140 Ga0213876_10009558 3300021384 Bacteria 5217
141 Ga0213876_10016703 3300021384 Bacteria 3878
142 Ga0213876_10026858 3300021384 Bacteria 3037
143 Ga0213876_10033713 3300021384 Bacteria 2699
144 Ga0213876_10060303 3300021384 Bacteria 2002
145 Ga0213876_10094135 3300021384 Bacteria 1587
146 Ga0213875_10007475 3300021388 Bacteria 5635
147 Ga0213875_10008271 3300021388 Bacteria 5336
148 Ga0213875_10082058 3300021388 Bacteria 1504
149 Ga0213875_10091727 3300021388 Bacteria 1417
150 Ga0207692_10000004 3300025898 Bacteria 413600
151 Ga0207692_10029380 3300025898 Bacteria 2612
152 Ga0207692_10142347 3300025898 Bacteria 1365
153 Ga0207688_10027234 3300025901 Bacteria 3144
154 Ga0207647_10080261 3300025904 Bacteria 1957
155 Ga0207643_10060791 3300025908 Bacteria 2157
156 Ga0207695_10025071 3300025913 Bacteria 6689
157 Ga0207695_10052956 3300025913 Bacteria 4248
158 Ga0207671_10007639 3300025914 Bacteria 9342
159 Ga0207693_10000036 3300025915 Bacteria 109562
160 Ga0207693_10016406 3300025915 Bacteria 5921
161 Ga0207693_10031883 3300025915 Bacteria 4163
162 Ga0207693_10058211 3300025915 Bacteria 3028
163 Ga0207693_10059167 3300025915 Bacteria 3001
164 Ga0207663_10000816 3300025916 Bacteria 14066
165 Ga0207663_10199405 3300025916 Bacteria 1443
166 Ga0207662_10054254 3300025918 Bacteria 2390
167 Ga0207657_10002206 3300025919 Bacteria 21118
168 Ga0207657_10046633 3300025919 Bacteria 3795
169 Ga0207657_10093105 3300025919 Bacteria 2510
170 Ga0207652_10023270 3300025921 Bacteria 5131
171 Ga0207646_10135675 3300025922 Bacteria 2216
172 Ga0207681_10006486 3300025923 Bacteria 7182
173 Ga0207650_10207655 3300025925 Bacteria 1572
174 Ga0207659_10108381 3300025926 Bacteria 2106
175 Ga0207687_10059409 3300025927 Bacteria 2694
176 Ga0207687_10067609 3300025927 Bacteria 2543
177 Ga0207700_10013684 3300025928 Bacteria 5289
178 Ga0207700_10146101 3300025928 Bacteria 1949
179 Ga0207664_10000012 3300025929 Bacteria 278872
180 Ga0207664_10004746 3300025929 Bacteria 9234
181 Ga0207664_10017334 3300025929 Bacteria 5277
182 Ga0207664_10032272 3300025929 Bacteria 4012
183 Ga0207664_10081462 3300025929 Bacteria 2634
184 Ga0207690_10000085 3300025932 Bacteria 78414
185 Ga0207690_10155366 3300025932 Bacteria 1700
186 Ga0207690_10156148 3300025932 Bacteria 1696
187 Ga0207706_10018897 3300025933 Bacteria 6198
188 Ga0207706_10066534 3300025933 Bacteria 3171
189 Ga0207709_10044976 3300025935 Bacteria 2671
190 Ga0207669_10032227 3300025937 Bacteria 2941
191 Ga0207704_10368852 3300025938 Bacteria 1123
192 Ga0207691_10169068 3300025940 Bacteria 1915
193 Ga0207689_10128144 3300025942 Bacteria 2087
194 Ga0207689_10313910 3300025942 Bacteria 1300
195 Ga0207689_10330996 3300025942 Bacteria 1265
196 Ga0207661_10074302 3300025944 Bacteria 2786
197 Ga0207661_10129726 3300025944 Bacteria 2158
198 Ga0207661_10575124 3300025944 Bacteria 1033
199 Ga0207679_10035059 3300025945 Bacteria 3547
200 Ga0207679_10059893 3300025945 Bacteria 2826
201 Ga0207679_10492857 3300025945 Bacteria 1092
202 Ga0207668_10062456 3300025972 Bacteria 2623
203 Ga0207677_10078997 3300026023 Bacteria 2351
204 Ga0207703_10180494 3300026035 Bacteria 1863
205 Ga0207678_10094575 3300026067 Bacteria 2553
206 Ga0207678_10125157 3300026067 Bacteria 2193
207 Ga0207708_10000854 3300026075 Bacteria 22951
208 Ga0207708_10021292 3300026075 Bacteria 4889
209 Ga0207708_10040954 3300026075 Bacteria 3533
210 Ga0207702_10052759 3300026078 Bacteria 3442
211 Ga0207648_10059508 3300026089 Bacteria 3332
212 Ga0207676_10099392 3300026095 Bacteria 2408
213 Ga0207676_10206420 3300026095 Bacteria 1740
214 Ga0207676_10311382 3300026095 Bacteria 1442
215 Ga0207674_10168635 3300026116 Bacteria 2143
216 Ga0207674_10269080 3300026116 Bacteria 1651
217 Ga0207675_100137086 3300026118 Bacteria 2323
218 Ga0207675_100211388 3300026118 Bacteria 1866
219 Ga0207675_100428785 3300026118 Bacteria 1307
220 Ga0207675_100739869 3300026118 Bacteria 994
221 Ga0207683_10133770 3300026121 Bacteria 2231
222 Ga0207698_10145120 3300026142 Bacteria 2051
223 Ga0207428_10032618 3300027907 Bacteria 4282
224 Ga0207428_10040274 3300027907 Bacteria 3791
225 Ga0207428_10118155 3300027907 Bacteria 2035
226 Ga0207428_10207666 3300027907 Bacteria 1472
227 Ga0268266_10052399 3300028379 Bacteria 3504
228 Ga0268266_10064248 3300028379 Bacteria 3170
229 Ga0268265_10188150 3300028380 Bacteria 1780
230 Ga0268264_10469780 3300028381 Bacteria 1222
231 Ga0265337_1007606 3300028556 Bacteria 4038
232 Ga0265326_10000008 3300028558 Bacteria 210923
233 Ga0265326_10008029 3300028558 Bacteria 3200
234 Ga0265319_1000816 3300028563 Bacteria 19901
235 Ga0265319_1000856 3300028563 Bacteria 19350
236 Ga0265319_1004830 3300028563 Bacteria 6597
237 Ga0265319_1017766 3300028563 Bacteria 2697
238 Ga0265334_10000152 3300028573 Bacteria 42908
239 Ga0265318_10001043 3300028577 Bacteria 17581
240 Ga0265318_10002031 3300028577 Bacteria 11174
241 Ga0265336_10000001 3300028666 Bacteria 916179
242 Ga0265338_10000004 3300028800 Bacteria 644793
243 Ga0265338_10017274 3300028800 Bacteria 7787
244 Ga0265338_10019858 3300028800 Bacteria 7101
245 Ga0265338_10043518 3300028800 Bacteria 4163
246 Ga0265324_10052840 3300029957 Bacteria 1395
247 Ga0265328_10053168 3300031239 Bacteria 1486
248 Ga0265320_10142844 3300031240 Bacteria 1083
249 Ga0265340_10000002 3300031247 Bacteria 711693
250 Ga0265339_10022692 3300031249 Bacteria 3633
251 Ga0265327_10015298 3300031251 Bacteria 4963
252 Ga0265327_10015845 3300031251 Bacteria 4834
253 Ga0265327_10027841 3300031251 Bacteria 3245
254 Ga0265314_10159195 3300031711 Bacteria 1376
255 Ga0307405_10030746 3300031731 Bacteria 3152
256 Ga0307413_10038954 3300031824 Bacteria 2759
257 Ga0307407_10144307 3300031903 Bacteria 1539
258 Ga0307412_10006995 3300031911 Bacteria 6404
259 Ga0307409_100020634 3300031995 Bacteria 4496
260 Ga0307409_100025208 3300031995 Bacteria 4166
261 Ga0307409_100072662 3300031995 Bacteria 2740
262 Ga0307409_100218092 3300031995 Bacteria 1720
263 Ga0307409_100305740 3300031995 Bacteria 1482
264 Ga0307416_100006253 3300032002 Bacteria 7437
265 Ga0307416_100017076 3300032002 Bacteria 5065
266 Ga0307416_100030625 3300032002 Bacteria 4039
267 Ga0307416_100460268 3300032002 Bacteria 1327
268 Ga0307414_10080139 3300032004 Bacteria 2386
269 Ga0307411_10120148 3300032005 Bacteria 1899
270 Ga0307415_100117781 3300032126 Bacteria 1984
271 Ga0373953_0006042 3300035117 Bacteria 3968
272 Ga0373962_0105461 3300035242 Bacteria 884
273 Ga0373924_0029689 3300035410 Bacteria 2187
274 Ga0373931_0244635 3300035691 Bacteria 1089
275 Ga0373925_0066093 3300037068 Bacteria 2725
276 Ga0373925_0302404 3300037068 Bacteria 1292
277 Ga0395900_0087820 3300037418 Bacteria 3196
278 Ga0395900_0317282 3300037418 Bacteria 1540
279 Ga0395898_0080706 3300037466 Bacteria 3137
280 Ga0436364_0061575 3300037853 Bacteria 4262
281 Ga0436364_0062618 3300037853 Bacteria 23174
282 Ga0436364_0069090 3300037853 Bacteria 1791
283 Ga0436364_0244708 3300037853 Bacteria 1624
284 Ga0436364_0356082 3300037853 Bacteria 1342
285 Ga0436364_0675766 3300037853 Bacteria 33099
286 Ga0436364_0777641 3300037853 Bacteria 1524
287 Ga0436364_0865495 3300037853 Bacteria 1109
288 Ga0436364_1169259 3300037853 Bacteria 1757
289 Ga0436364_1238678 3300037853 Bacteria 3847
290 Ga0436364_1460780 3300037853 Bacteria 4543
291 Ga0436364_1520628 3300037853 Bacteria 31090
292 Ga0395901_0018317 3300038443 Bacteria 7149
293 Ga0395901_0771948 3300038443 Bacteria 952
294 Ga0242420_010926 3300038996 Bacteria 1516
295 Ga0436365_0130921 3300039437 Bacteria 8552
296 Ga0436365_0248531 3300039437 Bacteria 2181
297 Ga0436365_0330823 3300039437 Bacteria 3863
298 Ga0436365_0457137 3300039437 Bacteria 1582
299 Ga0436365_0520637 3300039437 Bacteria 986
300 Ga0436365_0603064 3300039437 Bacteria 2278
301 Ga0436365_0664589 3300039437 Bacteria 14356
302 Ga0436365_0874987 3300039437 Bacteria 2158
303 Ga0436365_0987572 3300039437 Bacteria 4984
304 Ga0436365_1091091 3300039437 Bacteria 1615
305 Ga0436365_1110537 3300039437 Bacteria 6388
306 Ga0436365_1255617 3300039437 Bacteria 2534
307 Ga0436365_1305806 3300039437 Bacteria 8332
308 Ga0436365_1830138 3300039437 Bacteria 5199
309 Ga0436360_0759490 3300039438 Bacteria 1116
310 Ga0436360_1273425 3300039438 Bacteria 1082
311 Ga0436363_0266991 3300039450 Bacteria 2107
312 Ga0436363_0469620 3300039450 Bacteria 1097
313 Ga0436363_0482839 3300039450 Bacteria 998
314 Ga0436363_0611387 3300039450 Bacteria 2599
315 Ga0436363_0697951 3300039450 Bacteria 7429
316 Ga0436363_0884660 3300039450 Bacteria 26785
317 Ga0436363_1360186 3300039450 Bacteria 3318
318 Ga0436363_1586056 3300039450 Bacteria 2105
319 Ga0436362_0701923 3300039453 Bacteria 2893
320 Ga0436362_0983308 3300039453 Bacteria 2656
321 Ga0436362_1244081 3300039453 Bacteria 3504
322 Ga0439453_0032856 3300041408 Bacteria 990
323 Ga0451791_0824279 3300041451 Bacteria 1642
324 Ga0450905_006481 3300042142 Bacteria 1584
325 Ga0466969_0018138 3300044656 Bacteria 3671
326 Ga0466969_0247214 3300044656 Bacteria 809
327 Ga0466965_0020146 3300044683 Bacteria 3204
328 Ga0466966_0033252 3300044684 Bacteria 3339
329 Ga0466966_0067720 3300044684 Bacteria 2242
330 Ga0466966_0068222 3300044684 Bacteria 2233
331 Ga0466966_0091681 3300044684 Bacteria 1886
332 Ga0466966_0114449 3300044684 Bacteria 1661
333 Ga0466966_0304229 3300044684 Bacteria 958
334 Ga0466961_0012150 3300044693 Bacteria 5505
335 Ga0466961_0061511 3300044693 Bacteria 2386
336 Ga0466961_0105142 3300044693 Bacteria 1777
337 Ga0466961_0113024 3300044693 Bacteria 1708
338 Ga0466961_0212161 3300044693 Bacteria 1195
339 Ga0466963_0008216 3300044694 Bacteria 6255
340 Ga0466963_0009536 3300044694 Bacteria 5846
341 Ga0466963_0010915 3300044694 Bacteria 5517
342 Ga0466963_0015424 3300044694 Bacteria 4731
343 Ga0466963_0034009 3300044694 Bacteria 3314
344 Ga0466963_0040891 3300044694 Bacteria 3039
345 Ga0466963_0121658 3300044694 Bacteria 1797
346 Ga0466963_0292869 3300044694 Bacteria 1144
347 Ga0466964_0101556 3300044706 Bacteria 1269
348 Ga0466971_0006889 3300044719 Bacteria 4940
349 Ga0466971_0039599 3300044719 Bacteria 2115
350 Ga0466971_0048661 3300044719 Bacteria 1906
351 Ga0466971_0072537 3300044719 Bacteria 1564
352 Ga0466971_0094100 3300044719 Bacteria 1373
353 Ga0466968_0009848 3300044735 Bacteria 3689
354 Ga0466968_0070569 3300044735 Bacteria 1520
355 Ga0466970_0019493 3300044765 Bacteria 3517
356 Ga0466970_0113984 3300044765 Bacteria 1477
357 Ga0466957_0006639 3300044842 Bacteria 6542
358 Ga0466957_0107606 3300044842 Bacteria 1765
359 Ga0466960_0016276 3300044901 Bacteria 3222
360 Ga0466960_0056356 3300044901 Bacteria 1913
361 Ga0466960_0075659 3300044901 Bacteria 1685
362 Ga0466960_0119221 3300044901 Bacteria 1380
363 Ga0466959_0016730 3300045049 Bacteria 5365
364 Ga0466959_0035105 3300045049 Bacteria 3710
365 Ga0466959_0067457 3300045049 Bacteria 2594
366 Ga0466959_0086239 3300045049 Bacteria 2259
367 Ga0466959_0131798 3300045049 Bacteria 1771
368 Ga0466959_0188234 3300045049 Bacteria 1441
369 Ga0466959_0406524 3300045049 Bacteria 925
370 Ga0466958_0007923 3300045836 Bacteria 5870
371 Ga0466958_0008394 3300045836 Bacteria 5727
372 Ga0466958_0014469 3300045836 Bacteria 4505
373 Ga0466958_0018128 3300045836 Bacteria 4080
374 Ga0466958_0034896 3300045836 Bacteria 3003
375 Ga0466958_0061598 3300045836 Bacteria 2286
376 Ga0466958_0066421 3300045836 Bacteria 2202
377 Ga0466958_0079194 3300045836 Bacteria 2020
378 Ga0466958_0101059 3300045836 Bacteria 1793
379 Ga0466958_0115079 3300045836 Bacteria 1680
380 Ga0466958_0138555 3300045836 Bacteria 1531
381 Ga0466958_0202329 3300045836 Bacteria 1264
382 Ga0466958_0248390 3300045836 Bacteria 1138
383 Ga0466958_0255959 3300045836 Bacteria 1120
384 Ga0466967_0007861 3300045976 Bacteria 7748
385 Ga0466967_0008366 3300045976 Bacteria 7571
386 Ga0466967_0010059 3300045976 Bacteria 7069
387 Ga0466967_0015307 3300045976 Bacteria 6009
388 Ga0466967_0024860 3300045976 Bacteria 4931
389 Ga0466967_0072364 3300045976 Bacteria 3089
390 Ga0466967_0073232 3300045976 Bacteria 3072
391 Ga0466967_0075614 3300045976 Bacteria 3027
392 Ga0466967_0189697 3300045976 Bacteria 1942
393 Ga0466967_0211810 3300045976 Bacteria 1838
394 Ga0466967_0212812 3300045976 Bacteria 1834
395 Ga0466967_0267909 3300045976 Bacteria 1636
396 Ga0466967_0308188 3300045976 Bacteria 1524
397 Ga0466967_0335305 3300045976 Bacteria 1461
398 Ga0466967_0390965 3300045976 Bacteria 1352
399 Ga0466967_0459976 3300045976 Bacteria 1244
400 Ga0495629_0190160 3300046459 Bacteria 1421
401 Ga0495629_0246753 3300046459 Bacteria 1229
402 Ga0495629_0322072 3300046459 Bacteria 1057
403 Ga0495651_0060829 3300046462 Bacteria 2892
404 Ga0495653_0000754 3300046463 Bacteria 24761
405 Ga0495653_0106504 3300046463 Bacteria 2022
406 Ga0495653_0141821 3300046463 Bacteria 1689
407 Ga0495650_0000188 3300046471 Bacteria 134775
408 Ga0495582_0161244 3300046473 Bacteria 1275
409 Ga0495662_0141435 3300046476 Bacteria 1185
410 Ga0495664_0000205 3300046477 Bacteria 28535
411 Ga0495608_0146660 3300046511 Bacteria 1505
412 Ga0495608_0157676 3300046511 Bacteria 1444
413 Ga0495618_0001356 3300046514 Bacteria 16467
414 Ga0495618_0046908 3300046514 Bacteria 2727
415 Ga0495628_0043476 3300046516 Bacteria 3579
416 Ga0495630_0060404 3300046517 Bacteria 2845
417 Ga0495652_0060042 3300046529 Bacteria 3215
418 Ga0495652_0312688 3300046529 Bacteria 1138
419 Ga0495645_0000121 3300046543 Bacteria 52863
420 Ga0495645_0000767 3300046543 Bacteria 21944
421 Ga0495667_0002716 3300046559 Bacteria 11833
422 Ga0495635_0209261 3300046663 Bacteria 1321
423 Ga0495657_0000008 3300046675 Bacteria 221090
424 Ga0495657_0079747 3300046675 Bacteria 2119
425 Ga0495670_0097225 3300046691 Bacteria 1513
426 Ga0495600_0172610 3300046809 Bacteria 1395
427 Ga0495604_0000047 3300047317 Bacteria 109717
428 Ga0495604_0246629 3300047317 Bacteria 1219
429 Ga0495672_0015377 3300047320 Bacteria 5198
430 Ga0495680_0033414 3300047322 Bacteria 4165
431 Ga0495684_0001325 3300047471 Bacteria 19946
432 Ga0496100_0001384 3300048903 Bacteria 11881
433 Ga0496100_0016271 3300048903 Bacteria 4363
434 Ga0496100_0032465 3300048903 Bacteria 3257
435 Ga0496100_0047647 3300048903 Bacteria 2763
436 Ga0496101_0001701 3300048904 Bacteria 13168
437 Ga0496101_0107499 3300048904 Bacteria 2096
438 Ga0496101_0131731 3300048904 Bacteria 1899
439 Ga0496101_0170908 3300048904 Bacteria 1671
440 Ga0496101_0226694 3300048904 Bacteria 1452
441 Ga0496102_0000002 3300048905 Bacteria 814588
442 Ga0496102_0223535 3300048905 Bacteria 1775
443 Ga0496102_0428472 3300048905 Bacteria 1242
444 Ga0496103_0000046 3300048906 Bacteria 161981
445 Ga0496103_0014780 3300048906 Bacteria 4640
446 Ga0496103_0128039 3300048906 Bacteria 1620
447 Ga0496104_0000001 3300048907 Bacteria 711867
448 Ga0496104_0015831 3300048907 Bacteria 6842
449 Ga0496104_0049757 3300048907 Bacteria 3952
450 Ga0496104_0074733 3300048907 Bacteria 3226
451 Ga0496104_0082376 3300048907 Bacteria 3068
452 Ga0496104_0290564 3300048907 Bacteria 1547
453 Ga0496105_0001840 3300048908 Bacteria 15202
454 Ga0496105_0067259 3300048908 Bacteria 2958
455 Ga0496105_0081249 3300048908 Bacteria 2677
456 Ga0496105_0117981 3300048908 Bacteria 2189
457 Ga0496105_0132842 3300048908 Bacteria 2051
458 Ga0496105_0220969 3300048908 Bacteria 1542
459 Ga0496106_0014023 3300048909 Bacteria 5924
460 Ga0496106_0034783 3300048909 Bacteria 3765
461 Ga0496106_0077552 3300048909 Bacteria 2548
462 Ga0496107_0013498 3300048910 Bacteria 5711
463 Ga0496107_0014786 3300048910 Bacteria 5463
464 Ga0496107_0162263 3300048910 Bacteria 1656
465 Ga0496107_0465588 3300048910 Bacteria 938
466 Ga0496108_0002384 3300048911 Bacteria 15028
467 Ga0496108_0079290 3300048911 Bacteria 2780
468 Ga0496108_0095481 3300048911 Bacteria 2531
469 Ga0496108_0129569 3300048911 Bacteria 2168
470 Ga0496108_0136321 3300048911 Bacteria 2112
471 Ga0496108_0352226 3300048911 Bacteria 1285
472 Ga0496109_0011604 3300048912 Bacteria 7577
473 Ga0496109_0015699 3300048912 Bacteria 6606
474 Ga0496109_0020518 3300048912 Bacteria 5836
475 Ga0496109_0068350 3300048912 Bacteria 3257
476 Ga0496109_0096014 3300048912 Bacteria 2745
477 Ga0496110_0000153 3300048913 Bacteria 41540
478 Ga0496110_0053952 3300048913 Bacteria 3535
479 Ga0496110_0383660 3300048913 Bacteria 1280
480 Ga0496110_0500910 3300048913 Bacteria 1106
481 Ga0496111_0000110 3300048914 Bacteria 36104
482 Ga0496111_0012209 3300048914 Bacteria 5809
483 Ga0496111_0089931 3300048914 Bacteria 2249
484 Ga0496111_0100777 3300048914 Bacteria 2121
485 Ga0496111_0144979 3300048914 Bacteria 1760
486 Ga0496111_0289368 3300048914 Bacteria 1215
487 Ga0496112_0002728 3300048915 Bacteria 14297
488 Ga0496112_0005516 3300048915 Bacteria 10955
489 Ga0496112_0028226 3300048915 Bacteria 5415
490 Ga0496112_0032700 3300048915 Bacteria 5051
491 Ga0496112_0044985 3300048915 Bacteria 4326
492 Ga0496113_0001822 3300048916 Bacteria 12120
493 Ga0496113_0015189 3300048916 Bacteria 5282
494 Ga0496113_0129097 3300048916 Bacteria 1982
495 Ga0496114_0145902 3300048917 Bacteria 2051
496 Ga0496115_0000034 3300048918 Bacteria 135380
497 Ga0496115_0000240 3300048918 Bacteria 49737
498 Ga0496115_0010151 3300048918 Bacteria 7026
499 Ga0496115_0080129 3300048918 Bacteria 2658
500 Ga0496115_0211338 3300048918 Bacteria 1602
501 Ga0496115_0471565 3300048918 Bacteria 1012
502 Ga0496121_0001001 3300048924 Bacteria 50528
503 Ga0501031_0031849 3300049568 Bacteria 3439
504 Ga0501031_0098518 3300049568 Bacteria 1907
505 Ga0501032_0050192 3300049569 Bacteria 2813
506 Ga0501033_0031861 3300049570 Bacteria 3958
507 Ga0501034_0029954 3300049571 Bacteria 5532
508 Ga0501036_0011262 3300049572 Bacteria 7400
509 Ga0501036_0228375 3300049572 Bacteria 1562
510 Ga0501037_0006906 3300049573 Bacteria 8290
511 Ga0501038_0031222 3300049574 Bacteria 4709
512 Ga0501038_0340625 3300049574 Bacteria 1169
513 Ga0501039_0027769 3300049575 Bacteria 4352
514 Ga0501039_0066296 3300049575 Bacteria 2802
515 Ga0501040_0187913 3300049576 Bacteria 1466
516 Ga0501042_0073316 3300049578 Bacteria 2449
517 Ga0501042_0116872 3300049578 Bacteria 1920
518 Ga0501046_0056661 3300049580 Bacteria 3075
519 Ga0501046_0120283 3300049580 Bacteria 1998
520 Ga0501047_0092447 3300049581 Bacteria 2903
521 Ga0501047_0269751 3300049581 Bacteria 1548
522 Ga0501048_0045010 3300049582 Bacteria 3153
523 Ga0501048_0105644 3300049582 Bacteria 1987
524 Ga0501068_0006809 3300049584 Bacteria 6320
525 Ga0501069_0023208 3300049585 Bacteria 3381
526 Ga0501070_0141021 3300049586 Bacteria 1990
527 Ga0501071_0062921 3300049587 Bacteria 2689
528 Ga0501071_0066498 3300049587 Bacteria 2620
529 Ga0501071_0086580 3300049587 Bacteria 2298
530 Ga0501072_0079595 3300049588 Bacteria 2595
531 Ga0501073_0013163 3300049589 Bacteria 6030
532 Ga0501075_0201632 3300049591 Bacteria 1517
533 Ga0501076_0128876 3300049592 Bacteria 2051
534 Ga0501076_0166234 3300049592 Bacteria 1798
535 Ga0501079_0097194 3300049741 Bacteria 2283
536 Ga0501079_0121179 3300049741 Bacteria 2034
537 Ga0501079_0219848 3300049741 Bacteria 1484
538 Ga0501080_0093952 3300049742 Bacteria 2785
539 Ga0501083_0036142 3300049744 Bacteria 3370
540 Ga0501083_0148709 3300049744 Bacteria 1534
541 Ga0501044_0054925 3300049823 Bacteria 4091
542 Ga0501044_0267310 3300049823 Bacteria 1647
543 Ga0501045_0077302 3300049824 Bacteria 2452
544 Ga0501045_0151863 3300049824 Bacteria 1723
545 Ga0501045_0171713 3300049824 Bacteria 1615
546 nmdc:mga09592_10424_c1 3300050508 Bacteria 7563
547 nmdc:mga0qj67_2514_c1 3300050509 Bacteria 13094
548 nmdc:mga0n895_241878_c1 3300050512 Bacteria 1832
549 nmdc:mga0rr50_284969_c1 3300050513 Bacteria 1379
550 nmdc:mga08x19_271772_c1 3300050514 Bacteria 1173
551 nmdc:mga08x19_78493_c1 3300050514 Bacteria 2164
552 Ga0495601_0020606 3300053077 Bacteria 4028
553 Ga0495612_0000092 3300053078 Bacteria 39332
554 Ga0495619_0076611 3300053085 Bacteria 2245
555 Ga0495619_0102295 3300053085 Bacteria 1951
556 Ga0500616_0001780 3300053153 Bacteria 19684
557 Ga0501084_0036016 3300054114 Bacteria 4135
558 Ga0501084_0147489 3300054114 Bacteria 1982
559 Ga0501084_0353271 3300054114 Bacteria 1242
560 Ga0501084_0368774 3300054114 Bacteria 1213
561 Ga0501082_0019577 3300060353 Bacteria 5836
562 Ga0501082_0054990 3300060353 Bacteria 3430
563 Ga0501082_0066900 3300060353 Bacteria 3094
564 Ga0466962_0001846 3300061719 Bacteria 9957
565 Ga0466962_0014682 3300061719 Bacteria 3775
566 Ga0466962_0031565 3300061719 Bacteria 2536
567 Ga0466962_0094395 3300061719 Bacteria 1434
568 Ga0530510_0085888 3300061734 Bacteria 2292
569 Ga0530510_0281500 3300061734 Bacteria 1242

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0247214 Ga0466969_0247214_18_779 253
2 3300037853 Ga0436364_1520628 Ga0436364_1520628_15403_16242 268
3 3300039437 Ga0436365_0603064 Ga0436365_0603064_1003_1842 268
4 3300054114 Ga0501084_0368774 Ga0501084_0368774_382_1203 273
5 3300049580 Ga0501046_0120283 Ga0501046_0120283_1158_1985 274
6 3300037068 Ga0373925_0302404 Ga0373925_0302404_46_891 276
7 3300045976 Ga0466967_0267909 Ga0466967_0267909_685_1518 277
8 3300038443 Ga0395901_0771948 Ga0395901_0771948_89_925 278
9 3300044719 Ga0466971_0072537 Ga0466971_0072537_687_1523 278
10 3300044735 Ga0466968_0009848 Ga0466968_0009848_2822_3658 278
11 3300048910 Ga0496107_0465588 Ga0496107_0465588_81_917 278
12 3300037853 Ga0436364_0865495 Ga0436364_0865495_207_1058 279
13 3300039437 Ga0436365_1305806 Ga0436365_1305806_4065_4931 279
14 3300039438 Ga0436360_1273425 Ga0436360_1273425_224_1063 279
15 3300039450 Ga0436363_0482839 Ga0436363_0482839_99_953 279
16 3300039450 Ga0436363_0884660 Ga0436363_0884660_22033_22899 279
17 3300044693 Ga0466961_0212161 Ga0466961_0212161_228_1067 279
18 3300045049 Ga0466959_0406524 Ga0466959_0406524_36_875 279
19 3300045836 Ga0466958_0138555 Ga0466958_0138555_663_1505 279
20 3300046463 Ga0495653_0141821 Ga0495653_0141821_29_880 279
21 3300046511 Ga0495608_0146660 Ga0495608_0146660_412_1263 279
22 3300046529 Ga0495652_0312688 Ga0495652_0312688_91_930 279
23 3300048905 Ga0496102_0000002 Ga0496102_0000002_795934_796773 279
24 3300048906 Ga0496103_0000046 Ga0496103_0000046_16471_17310 279
25 3300049823 Ga0501044_0267310 Ga0501044_0267310_24_863 279
26 3300035242 Ga0373962_0105461 Ga0373962_0105461_10_873 280
27 3300044901 Ga0466960_0075659 Ga0466960_0075659_819_1661 280
28 3300044901 Ga0466960_0119221 Ga0466960_0119221_71_919 280
29 3300048913 Ga0496110_0383660 Ga0496110_0383660_28_870 280
30 3300044694 Ga0466963_0008216 Ga0466963_0008216_4199_5101 281
31 3300044719 Ga0466971_0048661 Ga0466971_0048661_789_1691 281
32 3300044765 Ga0466970_0019493 Ga0466970_0019493_1763_2665 281
33 3300044842 Ga0466957_0006639 Ga0466957_0006639_3050_3952 281
34 3300045976 Ga0466967_0010059 Ga0466967_0010059_2226_3128 281
35 3300061719 Ga0466962_0094395 Ga0466962_0094395_186_1088 281
36 3300021388 Ga0213875_10091727 Ga0213875_100917272 287
37 3300037853 Ga0436364_0061575 Ga0436364_0061575_2948_3850 287
38 3300039437 Ga0436365_0248531 Ga0436365_0248531_489_1391 287
39 3300045049 Ga0466959_0131798 Ga0466959_0131798_130_1029 287
40 3300037853 Ga0436364_1238678 Ga0436364_1238678_738_1640 288
41 3300044719 Ga0466971_0039599 Ga0466971_0039599_85_987 288
42 3300021384 Ga0213876_10094135 Ga0213876_100941352 289
43 3300044694 Ga0466963_0121658 Ga0466963_0121658_20_901 291
44 3300047317 Ga0495604_0246629 Ga0495604_0246629_22_897 291
45 3300044684 Ga0466966_0304229 Ga0466966_0304229_27_935 292
46 3300013297 Ga0157378_10057033 Ga0157378_100570334 294
47 3300009147 Ga0114129_10929594 Ga0114129_109295942 296
48 3300045976 Ga0466967_0015307 Ga0466967_0015307_263_1171 296
49 3300005329 Ga0070683_100029285 Ga0070683_1000292854 297
50 3300005339 Ga0070660_100296041 Ga0070660_1002960412 297
51 3300005341 Ga0070691_10010760 Ga0070691_100107606 297
52 3300005441 Ga0070700_100033379 Ga0070700_1000333792 297
53 3300005456 Ga0070678_100150902 Ga0070678_1001509022 297
54 3300005466 Ga0070685_10168846 Ga0070685_101688462 297
55 3300005535 Ga0070684_100108879 Ga0070684_1001088792 297
56 3300005564 Ga0070664_100020034 Ga0070664_1000200342 297
57 3300005577 Ga0068857_100165735 Ga0068857_1001657353 297
58 3300005577 Ga0068857_100412062 Ga0068857_1004120622 297
59 3300005614 Ga0068856_100031094 Ga0068856_1000310944 297
60 3300005618 Ga0068864_100008699 Ga0068864_1000086993 297
61 3300005719 Ga0068861_100109208 Ga0068861_1001092083 297
62 3300005834 Ga0068851_10106353 Ga0068851_101063532 297
63 3300006175 Ga0070712_100236609 Ga0070712_1002366092 297
64 3300006844 Ga0075428_100146556 Ga0075428_1001465563 297
65 3300006852 Ga0075433_10024129 Ga0075433_100241294 297
66 3300006914 Ga0075436_100083489 Ga0075436_1000834892 297
67 3300007076 Ga0075435_100087828 Ga0075435_1000878283 297
68 3300009094 Ga0111539_10170388 Ga0111539_101703882 297
69 3300009553 Ga0105249_10066065 Ga0105249_100660653 297
70 3300010375 Ga0105239_10032416 Ga0105239_100324162 297
71 3300013296 Ga0157374_10004714 Ga0157374_100047145 297
72 3300013307 Ga0157372_10063787 Ga0157372_100637872 297
73 3300014326 Ga0157380_10147264 Ga0157380_101472643 297
74 3300014745 Ga0157377_10000780 Ga0157377_1000078013 297
75 3300025915 Ga0207693_10031883 Ga0207693_100318836 297
76 3300025926 Ga0207659_10108381 Ga0207659_101083812 297
77 3300025933 Ga0207706_10018897 Ga0207706_100188976 297
78 3300026067 Ga0207678_10094575 Ga0207678_100945753 297
79 3300026075 Ga0207708_10000854 Ga0207708_100008548 297
80 3300026118 Ga0207675_100211388 Ga0207675_1002113882 297
81 3300027907 Ga0207428_10040274 Ga0207428_100402743 297
82 3300037418 Ga0395900_0317282 Ga0395900_0317282_92_988 297
83 3300048903 Ga0496100_0016271 Ga0496100_0016271_2237_3133 297
84 3300048906 Ga0496103_0014780 Ga0496103_0014780_3031_3927 297
85 3300048908 Ga0496105_0067259 Ga0496105_0067259_804_1700 297
86 3300048909 Ga0496106_0077552 Ga0496106_0077552_385_1281 297
87 3300048910 Ga0496107_0013498 Ga0496107_0013498_2752_3648 297
88 3300048912 Ga0496109_0011604 Ga0496109_0011604_3502_4398 297
89 3300048915 Ga0496112_0044985 Ga0496112_0044985_1261_2157 297
90 3300050512 nmdc:mga0n895_241878_c1 nmdc:mga0n895_241878_c1_370_1266 297
91 3300050514 nmdc:mga08x19_78493_c1 nmdc:mga08x19_78493_c1_1045_1941 297
92 3300005468 Ga0070707_100322244 Ga0070707_1003222441 298
93 3300044656 Ga0466969_0018138 Ga0466969_0018138_44_961 298
94 3300044684 Ga0466966_0067720 Ga0466966_0067720_373_1269 298
95 3300044684 Ga0466966_0091681 Ga0466966_0091681_828_1724 298
96 3300044693 Ga0466961_0105142 Ga0466961_0105142_830_1747 298
97 3300045836 Ga0466958_0079194 Ga0466958_0079194_101_997 298
98 3300045836 Ga0466958_0255959 Ga0466958_0255959_123_1025 298
99 3300054114 Ga0501084_0353271 Ga0501084_0353271_40_945 298
100 3300003203 JGI25406J46586_10028559 JGI25406J46586_100285592 299
101 3300005347 Ga0070668_100040383 Ga0070668_1000403833 299
102 3300005355 Ga0070671_100367354 Ga0070671_1003673541 299
103 3300005438 Ga0070701_10070592 Ga0070701_100705922 299
104 3300005456 Ga0070678_100276750 Ga0070678_1002767502 299
105 3300005543 Ga0070672_100118094 Ga0070672_1001180942 299
106 3300005577 Ga0068857_100414692 Ga0068857_1004146922 299
107 3300005840 Ga0068870_10090393 Ga0068870_100903932 299
108 3300005937 Ga0081455_10082621 Ga0081455_100826213 299
109 3300005985 Ga0081539_10010609 Ga0081539_100106092 299
110 3300005985 Ga0081539_10024574 Ga0081539_100245743 299
111 3300009093 Ga0105240_10465592 Ga0105240_104655922 299
112 3300009148 Ga0105243_10089259 Ga0105243_100892592 299
113 3300020070 Ga0206356_11093505 Ga0206356_110935052 299
114 3300021384 Ga0213876_10009558 Ga0213876_100095581 299
115 3300021384 Ga0213876_10026858 Ga0213876_100268584 299
116 3300025901 Ga0207688_10027234 Ga0207688_100272343 299
117 3300025915 Ga0207693_10058211 Ga0207693_100582111 299
118 3300025940 Ga0207691_10169068 Ga0207691_101690682 299
119 3300025972 Ga0207668_10062456 Ga0207668_100624562 299
120 3300026067 Ga0207678_10125157 Ga0207678_101251572 299
121 3300026075 Ga0207708_10021292 Ga0207708_100212923 299
122 3300026089 Ga0207648_10059508 Ga0207648_100595083 299
123 3300026118 Ga0207675_100137086 Ga0207675_1001370862 299
124 3300026118 Ga0207675_100428785 Ga0207675_1004287851 299
125 3300027907 Ga0207428_10032618 Ga0207428_100326184 299
126 3300027907 Ga0207428_10118155 Ga0207428_101181552 299
127 3300028381 Ga0268264_10469780 Ga0268264_104697802 299
128 3300028563 Ga0265319_1000816 Ga0265319_100081622 299
129 3300028563 Ga0265319_1004830 Ga0265319_10048303 299
130 3300028577 Ga0265318_10002031 Ga0265318_100020317 299
131 3300028800 Ga0265338_10043518 Ga0265338_100435182 299
132 3300037418 Ga0395900_0087820 Ga0395900_0087820_1123_2022 299
133 3300037466 Ga0395898_0080706 Ga0395898_0080706_2078_2977 299
134 3300038443 Ga0395901_0018317 Ga0395901_0018317_5635_6534 299
135 3300039437 Ga0436365_0987572 Ga0436365_0987572_1852_2751 299
136 3300039437 Ga0436365_1110537 Ga0436365_1110537_90_989 299
137 3300039453 Ga0436362_0701923 Ga0436362_0701923_1263_2162 299
138 3300044684 Ga0466966_0068222 Ga0466966_0068222_97_996 299
139 3300044693 Ga0466961_0061511 Ga0466961_0061511_793_1692 299
140 3300044694 Ga0466963_0010915 Ga0466963_0010915_3833_4732 299
141 3300044735 Ga0466968_0070569 Ga0466968_0070569_116_1015 299
142 3300045049 Ga0466959_0016730 Ga0466959_0016730_392_1291 299
143 3300045836 Ga0466958_0034896 Ga0466958_0034896_1891_2790 299
144 3300045836 Ga0466958_0066421 Ga0466958_0066421_322_1221 299
145 3300045976 Ga0466967_0308188 Ga0466967_0308188_489_1397 299
146 3300045976 Ga0466967_0390965 Ga0466967_0390965_13_912 299
147 3300048904 Ga0496101_0107499 Ga0496101_0107499_487_1386 299
148 3300048905 Ga0496102_0428472 Ga0496102_0428472_147_1046 299
149 3300048906 Ga0496103_0128039 Ga0496103_0128039_439_1338 299
150 3300048907 Ga0496104_0015831 Ga0496104_0015831_2651_3550 299
151 3300048907 Ga0496104_0074733 Ga0496104_0074733_432_1331 299
152 3300048907 Ga0496104_0290564 Ga0496104_0290564_437_1336 299
153 3300048908 Ga0496105_0001840 Ga0496105_0001840_11752_12651 299
154 3300048908 Ga0496105_0132842 Ga0496105_0132842_1055_1954 299
155 3300048912 Ga0496109_0096014 Ga0496109_0096014_1033_1932 299
156 3300048914 Ga0496111_0100777 Ga0496111_0100777_1005_1904 299
157 3300048915 Ga0496112_0002728 Ga0496112_0002728_12123_13022 299
158 3300048916 Ga0496113_0001822 Ga0496113_0001822_8783_9682 299
159 3300048918 Ga0496115_0211338 Ga0496115_0211338_370_1269 299
160 3300049569 Ga0501032_0050192 Ga0501032_0050192_174_1091 299
161 3300049570 Ga0501033_0031861 Ga0501033_0031861_360_1277 299
162 3300049571 Ga0501034_0029954 Ga0501034_0029954_4070_4999 299
163 3300049572 Ga0501036_0011262 Ga0501036_0011262_6309_7226 299
164 3300049573 Ga0501037_0006906 Ga0501037_0006906_1305_2222 299
165 3300049574 Ga0501038_0031222 Ga0501038_0031222_2525_3442 299
166 3300049578 Ga0501042_0116872 Ga0501042_0116872_937_1854 299
167 3300049580 Ga0501046_0056661 Ga0501046_0056661_1145_2062 299
168 3300049581 Ga0501047_0092447 Ga0501047_0092447_177_1094 299
169 3300049582 Ga0501048_0045010 Ga0501048_0045010_1841_2758 299
170 3300049584 Ga0501068_0006809 Ga0501068_0006809_5047_5964 299
171 3300049585 Ga0501069_0023208 Ga0501069_0023208_411_1328 299
172 3300049589 Ga0501073_0013163 Ga0501073_0013163_3572_4489 299
173 3300049741 Ga0501079_0097194 Ga0501079_0097194_226_1143 299
174 3300049744 Ga0501083_0036142 Ga0501083_0036142_1115_2032 299
175 3300049744 Ga0501083_0148709 Ga0501083_0148709_449_1378 299
176 3300049823 Ga0501044_0054925 Ga0501044_0054925_493_1410 299
177 3300053153 Ga0500616_0001780 Ga0500616_0001780_1772_2674 299
178 3300054114 Ga0501084_0147489 Ga0501084_0147489_439_1356 299
179 3300060353 Ga0501082_0019577 Ga0501082_0019577_492_1409 299
180 3300005329 Ga0070683_100151150 Ga0070683_1001511502 300
181 3300005336 Ga0070680_100481573 Ga0070680_1004815731 300
182 3300005354 Ga0070675_100643862 Ga0070675_1006438621 300
183 3300005366 Ga0070659_100165836 Ga0070659_1001658361 300
184 3300005434 Ga0070709_10284102 Ga0070709_102841021 300
185 3300005435 Ga0070714_100133597 Ga0070714_1001335972 300
186 3300005435 Ga0070714_100281445 Ga0070714_1002814452 300
187 3300005437 Ga0070710_10004895 Ga0070710_100048952 300
188 3300005439 Ga0070711_100000697 Ga0070711_1000006976 300
189 3300005444 Ga0070694_100146229 Ga0070694_1001462292 300
190 3300005535 Ga0070684_100124234 Ga0070684_1001242342 300
191 3300005577 Ga0068857_100503704 Ga0068857_1005037041 300
192 3300005614 Ga0068856_100089582 Ga0068856_1000895823 300
193 3300005614 Ga0068856_100235829 Ga0068856_1002358292 300
194 3300005937 Ga0081455_10040966 Ga0081455_100409663 300
195 3300005983 Ga0081540_1043050 Ga0081540_10430502 300
196 3300005985 Ga0081539_10003887 Ga0081539_1000388714 300
197 3300006028 Ga0070717_10079271 Ga0070717_100792712 300
198 3300006028 Ga0070717_10090633 Ga0070717_100906332 300
199 3300006163 Ga0070715_10044048 Ga0070715_100440482 300
200 3300006175 Ga0070712_100018606 Ga0070712_1000186063 300
201 3300007076 Ga0075435_100241675 Ga0075435_1002416752 300
202 3300009093 Ga0105240_10015687 Ga0105240_1001568712 300
203 3300020069 Ga0197907_11455233 Ga0197907_114552332 300
204 3300020077 Ga0206351_10148293 Ga0206351_101482931 300
205 3300020080 Ga0206350_11110684 Ga0206350_111106842 300
206 3300021358 Ga0213873_10008091 Ga0213873_100080912 300
207 3300021377 Ga0213874_10004435 Ga0213874_100044353 300
208 3300021384 Ga0213876_10009122 Ga0213876_100091227 300
209 3300021384 Ga0213876_10016703 Ga0213876_100167033 300
210 3300021384 Ga0213876_10033713 Ga0213876_100337133 300
211 3300021384 Ga0213876_10060303 Ga0213876_100603032 300
212 3300021388 Ga0213875_10007475 Ga0213875_100074757 300
213 3300021388 Ga0213875_10008271 Ga0213875_100082712 300
214 3300021388 Ga0213875_10082058 Ga0213875_100820582 300
215 3300025898 Ga0207692_10029380 Ga0207692_100293802 300
216 3300025898 Ga0207692_10142347 Ga0207692_101423472 300
217 3300025913 Ga0207695_10025071 Ga0207695_100250713 300
218 3300025915 Ga0207693_10016406 Ga0207693_100164064 300
219 3300025915 Ga0207693_10059167 Ga0207693_100591672 300
220 3300025916 Ga0207663_10000816 Ga0207663_100008168 300
221 3300025916 Ga0207663_10199405 Ga0207663_101994052 300
222 3300025922 Ga0207646_10135675 Ga0207646_101356752 300
223 3300025928 Ga0207700_10146101 Ga0207700_101461012 300
224 3300025929 Ga0207664_10017334 Ga0207664_100173346 300
225 3300025929 Ga0207664_10032272 Ga0207664_100322722 300
226 3300025932 Ga0207690_10156148 Ga0207690_101561482 300
227 3300025944 Ga0207661_10129726 Ga0207661_101297262 300
228 3300026023 Ga0207677_10078997 Ga0207677_100789972 300
229 3300026078 Ga0207702_10052759 Ga0207702_100527593 300
230 3300028556 Ga0265337_1007606 Ga0265337_10076063 300
231 3300028558 Ga0265326_10008029 Ga0265326_100080293 300
232 3300028563 Ga0265319_1000856 Ga0265319_10008562 300
233 3300028563 Ga0265319_1017766 Ga0265319_10177662 300
234 3300028577 Ga0265318_10001043 Ga0265318_1000104316 300
235 3300028666 Ga0265336_10000001 Ga0265336_10000001496 300
236 3300028800 Ga0265338_10000004 Ga0265338_10000004386 300
237 3300028800 Ga0265338_10019858 Ga0265338_100198583 300
238 3300031239 Ga0265328_10053168 Ga0265328_100531681 300
239 3300031247 Ga0265340_10000002 Ga0265340_10000002386 300
240 3300031249 Ga0265339_10022692 Ga0265339_100226923 300
241 3300031251 Ga0265327_10015298 Ga0265327_100152982 300
242 3300031251 Ga0265327_10015845 Ga0265327_100158455 300
243 3300031251 Ga0265327_10027841 Ga0265327_100278411 300
244 3300031903 Ga0307407_10144307 Ga0307407_101443072 300
245 3300031995 Ga0307409_100218092 Ga0307409_1002180922 300
246 3300035117 Ga0373953_0006042 Ga0373953_0006042_1822_2724 300
247 3300035410 Ga0373924_0029689 Ga0373924_0029689_1265_2167 300
248 3300037068 Ga0373925_0066093 Ga0373925_0066093_25_927 300
249 3300037853 Ga0436364_0062618 Ga0436364_0062618_17482_18384 300
250 3300037853 Ga0436364_0069090 Ga0436364_0069090_823_1725 300
251 3300037853 Ga0436364_0244708 Ga0436364_0244708_449_1351 300
252 3300037853 Ga0436364_0356082 Ga0436364_0356082_22_927 300
253 3300037853 Ga0436364_0675766 Ga0436364_0675766_15977_16879 300
254 3300037853 Ga0436364_0777641 Ga0436364_0777641_45_947 300
255 3300037853 Ga0436364_1169259 Ga0436364_1169259_601_1503 300
256 3300037853 Ga0436364_1460780 Ga0436364_1460780_1361_2263 300
257 3300039437 Ga0436365_0130921 Ga0436365_0130921_6400_7302 300
258 3300039437 Ga0436365_0330823 Ga0436365_0330823_1863_2765 300
259 3300039437 Ga0436365_0457137 Ga0436365_0457137_112_1014 300
260 3300039437 Ga0436365_0520637 Ga0436365_0520637_63_965 300
261 3300039437 Ga0436365_0664589 Ga0436365_0664589_939_1841 300
262 3300039437 Ga0436365_0874987 Ga0436365_0874987_442_1344 300
263 3300039437 Ga0436365_1091091 Ga0436365_1091091_282_1184 300
264 3300039437 Ga0436365_1255617 Ga0436365_1255617_1306_2214 300
265 3300039437 Ga0436365_1830138 Ga0436365_1830138_2105_3007 300
266 3300039438 Ga0436360_0759490 Ga0436360_0759490_104_1006 300
267 3300039450 Ga0436363_0266991 Ga0436363_0266991_620_1522 300
268 3300039450 Ga0436363_0469620 Ga0436363_0469620_119_1027 300
269 3300039450 Ga0436363_0611387 Ga0436363_0611387_1665_2582 300
270 3300039450 Ga0436363_0697951 Ga0436363_0697951_1410_2312 300
271 3300039450 Ga0436363_1360186 Ga0436363_1360186_1772_2674 300
272 3300039450 Ga0436363_1586056 Ga0436363_1586056_195_1097 300
273 3300039453 Ga0436362_0983308 Ga0436362_0983308_1031_1933 300
274 3300039453 Ga0436362_1244081 Ga0436362_1244081_2265_3167 300
275 3300044683 Ga0466965_0020146 Ga0466965_0020146_510_1418 300
276 3300044684 Ga0466966_0033252 Ga0466966_0033252_2068_2970 300
277 3300044693 Ga0466961_0012150 Ga0466961_0012150_2724_3626 300
278 3300044694 Ga0466963_0009536 Ga0466963_0009536_3058_3960 300
279 3300044694 Ga0466963_0015424 Ga0466963_0015424_1109_2014 300
280 3300044694 Ga0466963_0034009 Ga0466963_0034009_888_1805 300
281 3300044694 Ga0466963_0040891 Ga0466963_0040891_2118_3026 300
282 3300044694 Ga0466963_0292869 Ga0466963_0292869_32_943 300
283 3300044706 Ga0466964_0101556 Ga0466964_0101556_21_923 300
284 3300044719 Ga0466971_0006889 Ga0466971_0006889_2238_3140 300
285 3300044719 Ga0466971_0094100 Ga0466971_0094100_372_1274 300
286 3300044842 Ga0466957_0107606 Ga0466957_0107606_534_1442 300
287 3300045049 Ga0466959_0035105 Ga0466959_0035105_83_985 300
288 3300045049 Ga0466959_0067457 Ga0466959_0067457_104_1030 300
289 3300045049 Ga0466959_0086239 Ga0466959_0086239_844_1746 300
290 3300045049 Ga0466959_0188234 Ga0466959_0188234_295_1200 300
291 3300045836 Ga0466958_0007923 Ga0466958_0007923_1194_2096 300
292 3300045836 Ga0466958_0008394 Ga0466958_0008394_1723_2625 300
293 3300045836 Ga0466958_0014469 Ga0466958_0014469_1000_1902 300
294 3300045836 Ga0466958_0018128 Ga0466958_0018128_1145_2047 300
295 3300045836 Ga0466958_0061598 Ga0466958_0061598_1223_2149 300
296 3300045836 Ga0466958_0101059 Ga0466958_0101059_725_1627 300
297 3300045836 Ga0466958_0115079 Ga0466958_0115079_677_1594 300
298 3300045836 Ga0466958_0202329 Ga0466958_0202329_177_1079 300
299 3300045976 Ga0466967_0007861 Ga0466967_0007861_2787_3701 300
300 3300045976 Ga0466967_0008366 Ga0466967_0008366_2516_3424 300
301 3300045976 Ga0466967_0024860 Ga0466967_0024860_2063_2971 300
302 3300045976 Ga0466967_0073232 Ga0466967_0073232_918_1826 300
303 3300045976 Ga0466967_0189697 Ga0466967_0189697_905_1807 300
304 3300045976 Ga0466967_0335305 Ga0466967_0335305_244_1152 300
305 3300046459 Ga0495629_0190160 Ga0495629_0190160_62_979 300
306 3300046459 Ga0495629_0246753 Ga0495629_0246753_66_980 300
307 3300046459 Ga0495629_0322072 Ga0495629_0322072_105_1007 300
308 3300046462 Ga0495651_0060829 Ga0495651_0060829_1047_1949 300
309 3300046463 Ga0495653_0106504 Ga0495653_0106504_326_1228 300
310 3300046477 Ga0495664_0000205 Ga0495664_0000205_8098_9000 300
311 3300046511 Ga0495608_0157676 Ga0495608_0157676_16_918 300
312 3300046514 Ga0495618_0046908 Ga0495618_0046908_1634_2536 300
313 3300046516 Ga0495628_0043476 Ga0495628_0043476_1804_2706 300
314 3300046517 Ga0495630_0060404 Ga0495630_0060404_261_1178 300
315 3300046529 Ga0495652_0060042 Ga0495652_0060042_808_1710 300
316 3300046543 Ga0495645_0000767 Ga0495645_0000767_4958_5887 300
317 3300046559 Ga0495667_0002716 Ga0495667_0002716_1172_2074 300
318 3300046663 Ga0495635_0209261 Ga0495635_0209261_232_1134 300
319 3300046675 Ga0495657_0000008 Ga0495657_0000008_77160_78062 300
320 3300046675 Ga0495657_0079747 Ga0495657_0079747_737_1639 300
321 3300046809 Ga0495600_0172610 Ga0495600_0172610_472_1374 300
322 3300047317 Ga0495604_0000047 Ga0495604_0000047_88102_89004 300
323 3300047322 Ga0495680_0033414 Ga0495680_0033414_1994_2896 300
324 3300047471 Ga0495684_0001325 Ga0495684_0001325_15752_16654 300
325 3300048904 Ga0496101_0226694 Ga0496101_0226694_98_1000 300
326 3300048907 Ga0496104_0000001 Ga0496104_0000001_200812_201714 300
327 3300048907 Ga0496104_0082376 Ga0496104_0082376_1956_2858 300
328 3300048908 Ga0496105_0081249 Ga0496105_0081249_330_1232 300
329 3300048911 Ga0496108_0352226 Ga0496108_0352226_317_1225 300
330 3300048913 Ga0496110_0000153 Ga0496110_0000153_11097_11999 300
331 3300048914 Ga0496111_0000110 Ga0496111_0000110_11052_11954 300
332 3300048914 Ga0496111_0089931 Ga0496111_0089931_308_1216 300
333 3300048915 Ga0496112_0028226 Ga0496112_0028226_2451_3359 300
334 3300048916 Ga0496113_0129097 Ga0496113_0129097_457_1359 300
335 3300048918 Ga0496115_0471565 Ga0496115_0471565_94_999 300
336 3300049568 Ga0501031_0098518 Ga0501031_0098518_543_1445 300
337 3300049575 Ga0501039_0066296 Ga0501039_0066296_1704_2606 300
338 3300049581 Ga0501047_0269751 Ga0501047_0269751_371_1273 300
339 3300049587 Ga0501071_0066498 Ga0501071_0066498_1700_2602 300
340 3300049592 Ga0501076_0166234 Ga0501076_0166234_499_1401 300
341 3300049741 Ga0501079_0219848 Ga0501079_0219848_271_1173 300
342 3300049824 Ga0501045_0171713 Ga0501045_0171713_646_1548 300
343 3300050513 nmdc:mga0rr50_284969_c1 nmdc:mga0rr50_284969_c1_82_984 300
344 3300053077 Ga0495601_0020606 Ga0495601_0020606_3001_3903 300
345 3300053078 Ga0495612_0000092 Ga0495612_0000092_36861_37763 300
346 3300053085 Ga0495619_0076611 Ga0495619_0076611_883_1785 300
347 3300053085 Ga0495619_0102295 Ga0495619_0102295_230_1132 300
348 3300061719 Ga0466962_0001846 Ga0466962_0001846_6216_7118 300
349 3300061719 Ga0466962_0014682 Ga0466962_0014682_2520_3422 300
350 3300001990 JGI24737J22298_10045758 JGI24737J22298_100457581 301
351 3300005329 Ga0070683_100436438 Ga0070683_1004364381 301
352 3300005330 Ga0070690_100107249 Ga0070690_1001072492 301
353 3300005331 Ga0070670_100172440 Ga0070670_1001724402 301
354 3300005338 Ga0068868_100158574 Ga0068868_1001585742 301
355 3300005339 Ga0070660_100326172 Ga0070660_1003261722 301
356 3300005343 Ga0070687_100008299 Ga0070687_1000082992 301
357 3300005353 Ga0070669_100007861 Ga0070669_1000078618 301
358 3300005366 Ga0070659_100000958 Ga0070659_1000009582 301
359 3300005435 Ga0070714_100001248 Ga0070714_10000124816 301
360 3300005435 Ga0070714_100045891 Ga0070714_1000458915 301
361 3300005435 Ga0070714_100303139 Ga0070714_1003031392 301
362 3300005436 Ga0070713_100107730 Ga0070713_1001077303 301
363 3300005437 Ga0070710_10000001 Ga0070710_10000001170 301
364 3300005440 Ga0070705_100001031 Ga0070705_10000103114 301
365 3300005441 Ga0070700_100023295 Ga0070700_1000232952 301
366 3300005455 Ga0070663_100134882 Ga0070663_1001348822 301
367 3300005459 Ga0068867_100064997 Ga0068867_1000649974 301
368 3300005535 Ga0070684_100144156 Ga0070684_1001441561 301
369 3300005544 Ga0070686_100068730 Ga0070686_1000687302 301
370 3300005548 Ga0070665_100005111 Ga0070665_1000051117 301
371 3300005548 Ga0070665_100099732 Ga0070665_1000997322 301
372 3300005564 Ga0070664_100052463 Ga0070664_1000524633 301
373 3300005577 Ga0068857_100143996 Ga0068857_1001439962 301
374 3300005578 Ga0068854_100075484 Ga0068854_1000754842 301
375 3300005615 Ga0070702_100012690 Ga0070702_1000126903 301
376 3300005616 Ga0068852_100181069 Ga0068852_1001810692 301
377 3300005617 Ga0068859_100316003 Ga0068859_1003160032 301
378 3300005719 Ga0068861_100022634 Ga0068861_1000226343 301
379 3300005719 Ga0068861_100090520 Ga0068861_1000905202 301
380 3300005719 Ga0068861_100177113 Ga0068861_1001771132 301
381 3300005840 Ga0068870_10129839 Ga0068870_101298392 301
382 3300005842 Ga0068858_100446652 Ga0068858_1004466522 301
383 3300005843 Ga0068860_100259450 Ga0068860_1002594502 301
384 3300005844 Ga0068862_100224309 Ga0068862_1002243092 301
385 3300005937 Ga0081455_10139900 Ga0081455_101399002 301
386 3300005937 Ga0081455_10179257 Ga0081455_101792572 301
387 3300005981 Ga0081538_10023034 Ga0081538_100230343 301
388 3300005981 Ga0081538_10035305 Ga0081538_100353052 301
389 3300005983 Ga0081540_1003705 Ga0081540_10037056 301
390 3300005983 Ga0081540_1024344 Ga0081540_10243442 301
391 3300006028 Ga0070717_10000010 Ga0070717_1000001029 301
392 3300006038 Ga0075365_10139442 Ga0075365_101394422 301
393 3300006175 Ga0070712_100000009 Ga0070712_10000000918 301
394 3300006844 Ga0075428_100114672 Ga0075428_1001146723 301
395 3300006846 Ga0075430_100020474 Ga0075430_1000204746 301
396 3300006881 Ga0068865_100053887 Ga0068865_1000538872 301
397 3300006931 Ga0097620_100316028 Ga0097620_1003160282 301
398 3300009011 Ga0105251_10088946 Ga0105251_100889462 301
399 3300009093 Ga0105240_10052389 Ga0105240_100523892 301
400 3300009093 Ga0105240_10731293 Ga0105240_107312931 301
401 3300009094 Ga0111539_10341189 Ga0111539_103411892 301
402 3300009098 Ga0105245_10039725 Ga0105245_100397253 301
403 3300009148 Ga0105243_10074830 Ga0105243_100748302 301
404 3300009148 Ga0105243_10110628 Ga0105243_101106282 301
405 3300009177 Ga0105248_10648031 Ga0105248_106480312 301
406 3300009545 Ga0105237_10004179 Ga0105237_100041794 301
407 3300009553 Ga0105249_10028423 Ga0105249_100284232 301
408 3300009553 Ga0105249_10301502 Ga0105249_103015022 301
409 3300010375 Ga0105239_10073439 Ga0105239_100734393 301
410 3300010375 Ga0105239_10080355 Ga0105239_100803554 301
411 3300011119 Ga0105246_10061522 Ga0105246_100615222 301
412 3300014325 Ga0163163_10264339 Ga0163163_102643392 301
413 3300014326 Ga0157380_10156593 Ga0157380_101565932 301
414 3300014745 Ga0157377_10137823 Ga0157377_101378232 301
415 3300014968 Ga0157379_10015321 Ga0157379_100153212 301
416 3300014968 Ga0157379_10298094 Ga0157379_102980942 301
417 3300025898 Ga0207692_10000004 Ga0207692_10000004259 301
418 3300025904 Ga0207647_10080261 Ga0207647_100802612 301
419 3300025908 Ga0207643_10060791 Ga0207643_100607912 301
420 3300025913 Ga0207695_10052956 Ga0207695_100529562 301
421 3300025914 Ga0207671_10007639 Ga0207671_100076393 301
422 3300025915 Ga0207693_10000036 Ga0207693_1000003655 301
423 3300025918 Ga0207662_10054254 Ga0207662_100542542 301
424 3300025919 Ga0207657_10002206 Ga0207657_1000220613 301
425 3300025919 Ga0207657_10046633 Ga0207657_100466331 301
426 3300025919 Ga0207657_10093105 Ga0207657_100931051 301
427 3300025921 Ga0207652_10023270 Ga0207652_100232704 301
428 3300025923 Ga0207681_10006486 Ga0207681_100064862 301
429 3300025925 Ga0207650_10207655 Ga0207650_102076552 301
430 3300025927 Ga0207687_10059409 Ga0207687_100594092 301
431 3300025927 Ga0207687_10067609 Ga0207687_100676093 301
432 3300025928 Ga0207700_10013684 Ga0207700_100136844 301
433 3300025929 Ga0207664_10000012 Ga0207664_10000012227 301
434 3300025929 Ga0207664_10004746 Ga0207664_100047469 301
435 3300025929 Ga0207664_10081462 Ga0207664_100814622 301
436 3300025932 Ga0207690_10000085 Ga0207690_1000008544 301
437 3300025932 Ga0207690_10155366 Ga0207690_101553662 301
438 3300025933 Ga0207706_10066534 Ga0207706_100665343 301
439 3300025935 Ga0207709_10044976 Ga0207709_100449762 301
440 3300025937 Ga0207669_10032227 Ga0207669_100322272 301
441 3300025938 Ga0207704_10368852 Ga0207704_103688521 301
442 3300025942 Ga0207689_10128144 Ga0207689_101281442 301
443 3300025942 Ga0207689_10313910 Ga0207689_103139102 301
444 3300025942 Ga0207689_10330996 Ga0207689_103309961 301
445 3300025944 Ga0207661_10074302 Ga0207661_100743022 301
446 3300025944 Ga0207661_10575124 Ga0207661_105751241 301
447 3300025945 Ga0207679_10035059 Ga0207679_100350593 301
448 3300025945 Ga0207679_10059893 Ga0207679_100598932 301
449 3300025945 Ga0207679_10492857 Ga0207679_104928571 301
450 3300026035 Ga0207703_10180494 Ga0207703_101804942 301
451 3300026075 Ga0207708_10040954 Ga0207708_100409542 301
452 3300026095 Ga0207676_10099392 Ga0207676_100993922 301
453 3300026095 Ga0207676_10206420 Ga0207676_102064202 301
454 3300026095 Ga0207676_10311382 Ga0207676_103113822 301
455 3300026116 Ga0207674_10168635 Ga0207674_101686352 301
456 3300026116 Ga0207674_10269080 Ga0207674_102690802 301
457 3300026118 Ga0207675_100739869 Ga0207675_1007398691 301
458 3300026121 Ga0207683_10133770 Ga0207683_101337702 301
459 3300026142 Ga0207698_10145120 Ga0207698_101451202 301
460 3300027907 Ga0207428_10207666 Ga0207428_102076662 301
461 3300028379 Ga0268266_10052399 Ga0268266_100523992 301
462 3300028379 Ga0268266_10064248 Ga0268266_100642482 301
463 3300028380 Ga0268265_10188150 Ga0268265_101881502 301
464 3300028558 Ga0265326_10000008 Ga0265326_1000000836 301
465 3300028573 Ga0265334_10000152 Ga0265334_1000015236 301
466 3300028800 Ga0265338_10017274 Ga0265338_100172747 301
467 3300029957 Ga0265324_10052840 Ga0265324_100528402 301
468 3300031240 Ga0265320_10142844 Ga0265320_101428441 301
469 3300031711 Ga0265314_10159195 Ga0265314_101591951 301
470 3300031731 Ga0307405_10030746 Ga0307405_100307463 301
471 3300031824 Ga0307413_10038954 Ga0307413_100389542 301
472 3300031911 Ga0307412_10006995 Ga0307412_100069956 301
473 3300031995 Ga0307409_100020634 Ga0307409_1000206342 301
474 3300031995 Ga0307409_100025208 Ga0307409_1000252081 301
475 3300031995 Ga0307409_100072662 Ga0307409_1000726621 301
476 3300031995 Ga0307409_100305740 Ga0307409_1003057402 301
477 3300032002 Ga0307416_100006253 Ga0307416_1000062532 301
478 3300032002 Ga0307416_100017076 Ga0307416_1000170762 301
479 3300032002 Ga0307416_100030625 Ga0307416_1000306252 301
480 3300032002 Ga0307416_100460268 Ga0307416_1004602681 301
481 3300032004 Ga0307414_10080139 Ga0307414_100801392 301
482 3300032005 Ga0307411_10120148 Ga0307411_101201482 301
483 3300032126 Ga0307415_100117781 Ga0307415_1001177811 301
484 3300035691 Ga0373931_0244635 Ga0373931_0244635_65_970 301
485 3300038996 Ga0242420_010926 Ga0242420_010926_152_1057 301
486 3300041408 Ga0439453_0032856 Ga0439453_0032856_55_966 301
487 3300041451 Ga0451791_0824279 Ga0451791_0824279_170_1081 301
488 3300042142 Ga0450905_006481 Ga0450905_006481_564_1517 301
489 3300044684 Ga0466966_0114449 Ga0466966_0114449_292_1197 301
490 3300044693 Ga0466961_0113024 Ga0466961_0113024_233_1147 301
491 3300044765 Ga0466970_0113984 Ga0466970_0113984_175_1110 301
492 3300044901 Ga0466960_0016276 Ga0466960_0016276_1306_2211 301
493 3300044901 Ga0466960_0056356 Ga0466960_0056356_131_1039 301
494 3300045836 Ga0466958_0248390 Ga0466958_0248390_89_994 301
495 3300045976 Ga0466967_0072364 Ga0466967_0072364_2095_3003 301
496 3300045976 Ga0466967_0075614 Ga0466967_0075614_1564_2496 301
497 3300045976 Ga0466967_0211810 Ga0466967_0211810_760_1674 301
498 3300045976 Ga0466967_0212812 Ga0466967_0212812_382_1299 301
499 3300045976 Ga0466967_0459976 Ga0466967_0459976_118_1026 301
500 3300046463 Ga0495653_0000754 Ga0495653_0000754_19366_20286 301
501 3300046471 Ga0495650_0000188 Ga0495650_0000188_97907_98827 301
502 3300046473 Ga0495582_0161244 Ga0495582_0161244_283_1197 301
503 3300046476 Ga0495662_0141435 Ga0495662_0141435_120_1040 301
504 3300046514 Ga0495618_0001356 Ga0495618_0001356_11150_12073 301
505 3300046543 Ga0495645_0000121 Ga0495645_0000121_22103_23023 301
506 3300046691 Ga0495670_0097225 Ga0495670_0097225_535_1455 301
507 3300047320 Ga0495672_0015377 Ga0495672_0015377_4209_5123 301
508 3300048903 Ga0496100_0001384 Ga0496100_0001384_6960_7880 301
509 3300048903 Ga0496100_0032465 Ga0496100_0032465_823_1731 301
510 3300048903 Ga0496100_0047647 Ga0496100_0047647_49_957 301
511 3300048904 Ga0496101_0001701 Ga0496101_0001701_48_965 301
512 3300048904 Ga0496101_0131731 Ga0496101_0131731_705_1613 301
513 3300048904 Ga0496101_0170908 Ga0496101_0170908_48_953 301
514 3300048905 Ga0496102_0223535 Ga0496102_0223535_267_1172 301
515 3300048907 Ga0496104_0049757 Ga0496104_0049757_2789_3697 301
516 3300048908 Ga0496105_0117981 Ga0496105_0117981_641_1561 301
517 3300048908 Ga0496105_0220969 Ga0496105_0220969_26_934 301
518 3300048909 Ga0496106_0014023 Ga0496106_0014023_473_1390 301
519 3300048909 Ga0496106_0034783 Ga0496106_0034783_2513_3418 301
520 3300048910 Ga0496107_0014786 Ga0496107_0014786_267_1184 301
521 3300048910 Ga0496107_0162263 Ga0496107_0162263_107_1012 301
522 3300048911 Ga0496108_0002384 Ga0496108_0002384_4611_5519 301
523 3300048911 Ga0496108_0079290 Ga0496108_0079290_842_1747 301
524 3300048911 Ga0496108_0095481 Ga0496108_0095481_510_1415 301
525 3300048911 Ga0496108_0129569 Ga0496108_0129569_982_1890 301
526 3300048911 Ga0496108_0136321 Ga0496108_0136321_846_1754 301
527 3300048912 Ga0496109_0015699 Ga0496109_0015699_55_966 301
528 3300048912 Ga0496109_0020518 Ga0496109_0020518_681_1589 301
529 3300048912 Ga0496109_0068350 Ga0496109_0068350_135_1043 301
530 3300048913 Ga0496110_0053952 Ga0496110_0053952_384_1292 301
531 3300048913 Ga0496110_0500910 Ga0496110_0500910_149_1081 301
532 3300048914 Ga0496111_0012209 Ga0496111_0012209_2895_3803 301
533 3300048914 Ga0496111_0144979 Ga0496111_0144979_666_1574 301
534 3300048914 Ga0496111_0289368 Ga0496111_0289368_235_1155 301
535 3300048915 Ga0496112_0005516 Ga0496112_0005516_37_945 301
536 3300048915 Ga0496112_0032700 Ga0496112_0032700_4081_5010 301
537 3300048916 Ga0496113_0015189 Ga0496113_0015189_3465_4370 301
538 3300048917 Ga0496114_0145902 Ga0496114_0145902_613_1518 301
539 3300048918 Ga0496115_0000034 Ga0496115_0000034_102015_102935 301
540 3300048918 Ga0496115_0000240 Ga0496115_0000240_1900_2820 301
541 3300048918 Ga0496115_0010151 Ga0496115_0010151_3015_3932 301
542 3300048918 Ga0496115_0080129 Ga0496115_0080129_1054_1959 301
543 3300048924 Ga0496121_0001001 Ga0496121_0001001_3507_4433 301
544 3300049568 Ga0501031_0031849 Ga0501031_0031849_368_1273 301
545 3300049572 Ga0501036_0228375 Ga0501036_0228375_406_1311 301
546 3300049574 Ga0501038_0340625 Ga0501038_0340625_36_941 301
547 3300049575 Ga0501039_0027769 Ga0501039_0027769_925_1833 301
548 3300049576 Ga0501040_0187913 Ga0501040_0187913_292_1197 301
549 3300049578 Ga0501042_0073316 Ga0501042_0073316_617_1525 301
550 3300049582 Ga0501048_0105644 Ga0501048_0105644_88_996 301
551 3300049586 Ga0501070_0141021 Ga0501070_0141021_513_1445 301
552 3300049587 Ga0501071_0062921 Ga0501071_0062921_401_1306 301
553 3300049587 Ga0501071_0086580 Ga0501071_0086580_253_1158 301
554 3300049588 Ga0501072_0079595 Ga0501072_0079595_1168_2076 301
555 3300049591 Ga0501075_0201632 Ga0501075_0201632_427_1332 301
556 3300049592 Ga0501076_0128876 Ga0501076_0128876_670_1575 301
557 3300049741 Ga0501079_0121179 Ga0501079_0121179_148_1053 301
558 3300049742 Ga0501080_0093952 Ga0501080_0093952_861_1784 301
559 3300049824 Ga0501045_0077302 Ga0501045_0077302_711_1616 301
560 3300049824 Ga0501045_0151863 Ga0501045_0151863_617_1525 301
561 3300050508 nmdc:mga09592_10424_c1 nmdc:mga09592_10424_c1_3399_4310 301
562 3300050509 nmdc:mga0qj67_2514_c1 nmdc:mga0qj67_2514_c1_1126_2031 301
563 3300050514 nmdc:mga08x19_271772_c1 nmdc:mga08x19_271772_c1_120_1028 301
564 3300054114 Ga0501084_0036016 Ga0501084_0036016_811_1719 301
565 3300060353 Ga0501082_0054990 Ga0501082_0054990_941_1846 301
566 3300060353 Ga0501082_0066900 Ga0501082_0066900_1610_2518 301
567 3300061719 Ga0466962_0031565 Ga0466962_0031565_827_1762 301
568 3300061734 Ga0530510_0085888 Ga0530510_0085888_784_1692 301
569 3300061734 Ga0530510_0281500 Ga0530510_0281500_143_1048 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

3

87

0.93

PF02754

CCG

Cysteine-rich domain

151

242

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.912 1 289
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.9031 1 289
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.8998 2 296
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.8911 2 296
3kwl-assembly1.cif.gz_A crystal structure of a hypothetical protein from helicobacter pylori 0.8609 3 284
ID Description Score Start End Superfamily
af_Q58273_1_128_1.20.1050.140 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9114 1 129 1.20.1050.140
af_Q58273_1_128_1.20.1050.140 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9048 1 129 1.20.1050.140
3kwlA03 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8404 3 129 1.20.1050.140
3kwlA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8232 140 284 3.40.50.11810
3kwlA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7731 140 284 3.40.50.11810
ID Description Score Start End GO Terms
AF-A0A3B8VPW6-F1-model_v4 Disulfide reductase 0.9767 172 261 GO:0016491
AF-A0A7V9M680-F1-model_v4 CoB--CoM heterodisulfide reductase iron-sulfur subunit B family protein 0.9739 1 288 GO:0016491
AF-A0A661HSC2-F1-model_v4 Heterodisulfide reductase subunit B 0.9675 188 281 GO:0016491
AF-A0A7C7PM84-F1-model_v4 Heterodisulfide reductase subunit B 0.9653 78 288 GO:0016491
AF-X1W2N9-F1-model_v4 Cysteine-rich domain-containing protein 0.9651 206 287

Feature Viewer

pLDDT pTM Quality
89.45 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map