F464738

General Info

Members Datasets Scaffolds Average Seq Length
569 208 569 146

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_101713929|Ga0207675_1017139291
Length 140
Sequence MSDRNPKLVLDTEKLTDEFFYDSRLLGIMAPVKDYQFCWNLNSTIGLNFRINNDLEIQLTKKKRSYFFTVYEYCEPTRFLSHYVYKNQFDGEYLLPEFKHLDFLWLMKGDEVSDESLQETIQLVLELTNEKIKNKEHLVF

Samples

Sample ID Description Type Environment
1 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
166 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
167 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
187 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
188 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
189 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
190 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
191 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
196 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
197 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
198 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
199 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 0.88
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c011568 3300000043 Bacteria 745
2 JGI24751J29686_10030404 3300002459 Bacteria 1120
3 Ga0065704_10390956 3300005289 Bacteria 756
4 Ga0065712_10006450 3300005290 Bacteria 3475
5 Ga0065707_10173646 3300005295 Bacteria 1466
6 Ga0070658_10099518 3300005327 Bacteria 2402
7 Ga0070658_10191348 3300005327 Bacteria 1724
8 Ga0070658_10212501 3300005327 Bacteria 1634
9 Ga0070658_10248127 3300005327 Bacteria 1510
10 Ga0070658_10414876 3300005327 Bacteria 1157
11 Ga0070658_10694432 3300005327 Bacteria 883
12 Ga0070658_10812875 3300005327 Unclassified 812
13 Ga0070683_100296253 3300005329 Bacteria 1538
14 Ga0070683_101072220 3300005329 Bacteria 774
15 Ga0070670_100049006 3300005331 Bacteria 3634
16 Ga0070670_100083450 3300005331 Bacteria 2745
17 Ga0070670_100107240 3300005331 Bacteria 2407
18 Ga0070670_100131111 3300005331 Unclassified 2164
19 Ga0070670_100648856 3300005331 Unclassified 947
20 Ga0070677_10232663 3300005333 Unclassified 906
21 Ga0068869_100024863 3300005334 Bacteria 4152
22 Ga0070680_100009385 3300005336 Bacteria 7517
23 Ga0070680_100031154 3300005336 Bacteria 4287
24 Ga0070680_100039392 3300005336 Bacteria 3824
25 Ga0070680_100081642 3300005336 Bacteria 2667
26 Ga0070680_100204521 3300005336 Bacteria 1665
27 Ga0070682_100357769 3300005337 Bacteria 1090
28 Ga0068868_100039380 3300005338 Unclassified 3673
29 Ga0068868_100620699 3300005338 Bacteria 960
30 Ga0070660_100001935 3300005339 Bacteria 14274
31 Ga0070660_100021641 3300005339 Bacteria 4745
32 Ga0070660_100115862 3300005339 Bacteria 2136
33 Ga0070660_100118855 3300005339 Bacteria 2108
34 Ga0070660_100871534 3300005339 Unclassified 758
35 Ga0070687_100164521 3300005343 Bacteria 1315
36 Ga0070687_100213343 3300005343 Bacteria 1177
37 Ga0070661_100027194 3300005344 Bacteria 4118
38 Ga0070661_100538965 3300005344 Bacteria 938
39 Ga0070692_10141046 3300005345 Unclassified 1364
40 Ga0070692_10249306 3300005345 Bacteria 1062
41 Ga0070668_100814013 3300005347 Bacteria 830
42 Ga0070669_100031912 3300005353 Bacteria 3805
43 Ga0070669_100101392 3300005353 Bacteria 2172
44 Ga0070675_100104298 3300005354 Bacteria 2392
45 Ga0070675_101078991 3300005354 Unclassified 738
46 Ga0070671_100266562 3300005355 Bacteria 1456
47 Ga0070671_100361570 3300005355 Unclassified 1239
48 Ga0070674_100683927 3300005356 Bacteria 875
49 Ga0070673_100074775 3300005364 Bacteria 2731
50 Ga0070673_100607960 3300005364 Bacteria 998
51 Ga0070688_100249801 3300005365 Unclassified 1262
52 Ga0070659_100001791 3300005366 Bacteria 15465
53 Ga0070659_100035067 3300005366 Bacteria 3904
54 Ga0070659_100053397 3300005366 Bacteria 3180
55 Ga0070659_100156709 3300005366 Bacteria 1860
56 Ga0070659_100926344 3300005366 Unclassified 762
57 Ga0070714_100528889 3300005435 Unclassified 1127
58 Ga0070705_100241081 3300005440 Unclassified 1263
59 Ga0070663_100856225 3300005455 Bacteria 783
60 Ga0070678_100822354 3300005456 Bacteria 845
61 Ga0070678_101293502 3300005456 Unclassified 678
62 Ga0070681_10018161 3300005458 Bacteria 7031
63 Ga0070681_10157488 3300005458 Bacteria 2195
64 Ga0070681_10349581 3300005458 Bacteria 1389
65 Ga0070681_10588485 3300005458 Bacteria 1027
66 Ga0070681_11374123 3300005458 Bacteria 630
67 Ga0068867_100581512 3300005459 Bacteria 974
68 Ga0070685_10406834 3300005466 Bacteria 944
69 Ga0070685_10524724 3300005466 Bacteria 841
70 Ga0070685_10886459 3300005466 Bacteria 663
71 Ga0070707_100779394 3300005468 Bacteria 920
72 Ga0070698_100000282 3300005471 Bacteria 51827
73 Ga0070698_100004896 3300005471 Bacteria 14697
74 Ga0070699_100120659 3300005518 Bacteria 2305
75 Ga0070679_100000065 3300005530 Bacteria 78829
76 Ga0070679_100063296 3300005530 Unclassified 3687
77 Ga0070679_100075450 3300005530 Bacteria 3361
78 Ga0070679_100130669 3300005530 Bacteria 2493
79 Ga0070679_100447673 3300005530 Bacteria 1236
80 Ga0070679_100937160 3300005530 Unclassified 809
81 Ga0070679_101208181 3300005530 Bacteria 701
82 Ga0070684_100000793 3300005535 Bacteria 21959
83 Ga0068853_100016566 3300005539 Bacteria 6070
84 Ga0068853_100024373 3300005539 Bacteria 5072
85 Ga0068853_100047906 3300005539 Bacteria 3669
86 Ga0068853_100094190 3300005539 Bacteria 2638
87 Ga0068853_100196313 3300005539 Bacteria 1836
88 Ga0068853_100981828 3300005539 Bacteria 813
89 Ga0068853_101131974 3300005539 Unclassified 755
90 Ga0068853_102180465 3300005539 Bacteria 537
91 Ga0068853_102199387 3300005539 Unclassified 535
92 Ga0070686_100197361 3300005544 Bacteria 1440
93 Ga0070686_101514478 3300005544 Unclassified 566
94 Ga0070696_100092277 3300005546 Bacteria 2158
95 Ga0070696_100698733 3300005546 Bacteria 827
96 Ga0070665_100362186 3300005548 Bacteria 1456
97 Ga0070704_100555263 3300005549 Bacteria 1004
98 Ga0068855_100000189 3300005563 Bacteria 79227
99 Ga0068855_100001235 3300005563 Bacteria 31705
100 Ga0068855_100345673 3300005563 Bacteria 1639
101 Ga0068855_100346249 3300005563 Bacteria 1638
102 Ga0068855_100585614 3300005563 Bacteria 1205
103 Ga0068855_100622397 3300005563 Bacteria 1162
104 Ga0068855_100716470 3300005563 Unclassified 1069
105 Ga0068855_101080551 3300005563 Unclassified 840
106 Ga0068855_101174495 3300005563 Bacteria 799
107 Ga0070664_100152412 3300005564 Bacteria 2041
108 Ga0070664_100361485 3300005564 Unclassified 1322
109 Ga0070664_100463984 3300005564 Unclassified 1164
110 Ga0070664_100722394 3300005564 Unclassified 929
111 Ga0070664_100870843 3300005564 Bacteria 844
112 Ga0068857_100022671 3300005577 Bacteria 5524
113 Ga0068857_100098119 3300005577 Bacteria 2627
114 Ga0068854_100095888 3300005578 Bacteria 2215
115 Ga0068854_100132123 3300005578 Bacteria 1907
116 Ga0068854_100183731 3300005578 Bacteria 1635
117 Ga0068856_100022167 3300005614 Bacteria 6175
118 Ga0068856_100063993 3300005614 Bacteria 3634
119 Ga0068852_100002826 3300005616 Bacteria 12036
120 Ga0068852_100020117 3300005616 Bacteria 5302
121 Ga0068852_100030254 3300005616 Bacteria 4455
122 Ga0068852_100047642 3300005616 Bacteria 3657
123 Ga0068852_100253017 3300005616 Bacteria 1688
124 Ga0068852_100824713 3300005616 Bacteria 942
125 Ga0068852_101109875 3300005616 Bacteria 811
126 Ga0068852_101467786 3300005616 Bacteria 704
127 Ga0068852_102023086 3300005616 Bacteria 598
128 Ga0068852_102689474 3300005616 Unclassified 517
129 Ga0068859_100065142 3300005617 Bacteria 3678
130 Ga0068859_100090394 3300005617 Unclassified 3113
131 Ga0068859_100276220 3300005617 Bacteria 1773
132 Ga0068859_100312158 3300005617 Bacteria 1666
133 Ga0068859_100382481 3300005617 Bacteria 1503
134 Ga0068859_100617796 3300005617 Bacteria 1176
135 Ga0068859_100781245 3300005617 Unclassified 1043
136 Ga0068864_100035197 3300005618 Bacteria 4263
137 Ga0068864_100123836 3300005618 Unclassified 2314
138 Ga0068864_100357915 3300005618 Bacteria 1379
139 Ga0068861_100004473 3300005719 Bacteria 9382
140 Ga0068861_100303297 3300005719 Bacteria 1384
141 Ga0068861_102410844 3300005719 Bacteria 529
142 Ga0068851_10012642 3300005834 Bacteria 3983
143 Ga0068851_10101705 3300005834 Unclassified 1526
144 Ga0068851_10106657 3300005834 Unclassified 1492
145 Ga0068851_10555620 3300005834 Bacteria 694
146 Ga0068851_10959381 3300005834 Unclassified 538
147 Ga0068870_10758166 3300005840 Bacteria 674
148 Ga0068863_100029142 3300005841 Bacteria 5270
149 Ga0068863_100038534 3300005841 Bacteria 4547
150 Ga0068863_100258808 3300005841 Bacteria 1682
151 Ga0068863_100619655 3300005841 Unclassified 1072
152 Ga0068863_100891301 3300005841 Bacteria 890
153 Ga0068858_100388364 3300005842 Bacteria 1340
154 Ga0068860_100013488 3300005843 Bacteria 8014
155 Ga0068860_100479507 3300005843 Bacteria 1240
156 Ga0068860_100516751 3300005843 Bacteria 1194
157 Ga0068860_101000708 3300005843 Unclassified 854
158 Ga0068862_100245586 3300005844 Bacteria 1629
159 Ga0068862_100584045 3300005844 Bacteria 1071
160 Ga0097621_100014286 3300006237 Bacteria 5938
161 Ga0097621_100243572 3300006237 Bacteria 1572
162 Ga0068871_100804610 3300006358 Bacteria 866
163 Ga0068871_100861015 3300006358 Bacteria 838
164 Ga0075428_100014821 3300006844 Bacteria 8663
165 Ga0075428_100048180 3300006844 Bacteria 4678
166 Ga0075428_100132746 3300006844 Bacteria 2708
167 Ga0075428_101817476 3300006844 Bacteria 634
168 Ga0075430_100001793 3300006846 Bacteria 17561
169 Ga0075431_100031975 3300006847 Bacteria 5422
170 Ga0075431_100908330 3300006847 Bacteria 850
171 Ga0075431_101294479 3300006847 Bacteria 690
172 Ga0075429_100000136 3300006880 Bacteria 44169
173 Ga0075429_100589406 3300006880 Bacteria 974
174 Ga0097620_100062773 3300006931 Bacteria 3745
175 Ga0097620_100065142 3300006931 Bacteria 3678
176 Ga0097620_100090395 3300006931 Unclassified 3113
177 Ga0097620_100276205 3300006931 Bacteria 1773
178 Ga0097620_100312157 3300006931 Bacteria 1666
179 Ga0097620_100382492 3300006931 Bacteria 1503
180 Ga0097620_100617801 3300006931 Bacteria 1176
181 Ga0097620_100781049 3300006931 Unclassified 1043
182 Ga0105240_10294577 3300009093 Bacteria 1859
183 Ga0111539_10118607 3300009094 Bacteria 3101
184 Ga0111539_10120160 3300009094 Bacteria 3079
185 Ga0111539_12080550 3300009094 Unclassified 658
186 Ga0105247_10136885 3300009101 Bacteria 1601
187 Ga0114129_12026737 3300009147 Bacteria 695
188 Ga0105243_10621789 3300009148 Bacteria 1043
189 Ga0105243_11457419 3300009148 Bacteria 707
190 Ga0105241_10021632 3300009174 Unclassified 4757
191 Ga0105242_10007396 3300009176 Bacteria 8457
192 Ga0105242_10197772 3300009176 Unclassified 1784
193 Ga0105242_10358502 3300009176 Unclassified 1349
194 Ga0105242_11761951 3300009176 Bacteria 657
195 Ga0105248_11335531 3300009177 Bacteria 811
196 Ga0105237_10108498 3300009545 Bacteria 2767
197 Ga0105237_10571112 3300009545 Unclassified 1138
198 Ga0105249_10001213 3300009553 Bacteria 22729
199 Ga0105249_10001789 3300009553 Bacteria 18712
200 Ga0105249_10164540 3300009553 Bacteria 2146
201 Ga0105249_10168015 3300009553 Bacteria 2125
202 Ga0105249_11916919 3300009553 Bacteria 665
203 Ga0105249_12466618 3300009553 Bacteria 592
204 Ga0105249_12679515 3300009553 Bacteria 571
205 Ga0105239_10038971 3300010375 Bacteria 5205
206 Ga0105246_10375027 3300011119 Bacteria 1174
207 Ga0157373_10001339 3300013100 Bacteria 18861
208 Ga0157373_10035077 3300013100 Unclassified 3603
209 Ga0157373_10043440 3300013100 Bacteria 3210
210 Ga0157373_10048599 3300013100 Bacteria 3024
211 Ga0157373_10379302 3300013100 Bacteria 1011
212 Ga0157373_10387725 3300013100 Unclassified 1000
213 Ga0157373_10617003 3300013100 Bacteria 790
214 Ga0157371_10000326 3300013102 Bacteria 61810
215 Ga0157371_10003758 3300013102 Bacteria 13588
216 Ga0157371_10004714 3300013102 Bacteria 11787
217 Ga0157371_10004797 3300013102 Bacteria 11645
218 Ga0157371_10010426 3300013102 Bacteria 7239
219 Ga0157371_10016890 3300013102 Bacteria 5434
220 Ga0157371_10032682 3300013102 Bacteria 3743
221 Ga0157371_10038313 3300013102 Bacteria 3430
222 Ga0157371_10039550 3300013102 Bacteria 3372
223 Ga0157371_10140511 3300013102 Unclassified 1720
224 Ga0157371_10209806 3300013102 Bacteria 1397
225 Ga0157371_10212440 3300013102 Bacteria 1389
226 Ga0157371_10253519 3300013102 Bacteria 1267
227 Ga0157371_10266039 3300013102 Bacteria 1237
228 Ga0157371_10300213 3300013102 Unclassified 1162
229 Ga0157371_10377573 3300013102 Bacteria 1035
230 Ga0157370_10003774 3300013104 Bacteria 17678
231 Ga0157370_10007491 3300013104 Bacteria 11857
232 Ga0157370_10056533 3300013104 Bacteria 3734
233 Ga0157370_10092662 3300013104 Bacteria 2836
234 Ga0157370_10120438 3300013104 Bacteria 2450
235 Ga0157370_10164225 3300013104 Bacteria 2066
236 Ga0157370_10193227 3300013104 Bacteria 1889
237 Ga0157370_10307372 3300013104 Bacteria 1463
238 Ga0157370_10403959 3300013104 Bacteria 1257
239 Ga0157370_10752516 3300013104 Bacteria 888
240 Ga0157369_10042466 3300013105 Bacteria 4960
241 Ga0157369_10090879 3300013105 Bacteria 3259
242 Ga0157369_10248419 3300013105 Bacteria 1857
243 Ga0157369_10272481 3300013105 Bacteria 1763
244 Ga0157369_10363334 3300013105 Bacteria 1503
245 Ga0157369_10372401 3300013105 Bacteria 1483
246 Ga0157369_10487553 3300013105 Bacteria 1275
247 Ga0157369_10702940 3300013105 Bacteria 1041
248 Ga0157369_10761062 3300013105 Bacteria 996
249 Ga0157369_10986183 3300013105 Bacteria 863
250 Ga0157374_10848542 3300013296 Unclassified 930
251 Ga0157378_10029228 3300013297 Bacteria 4865
252 Ga0157378_10461065 3300013297 Bacteria 1263
253 Ga0157378_10603524 3300013297 Bacteria 1109
254 Ga0157378_10637902 3300013297 Unclassified 1080
255 Ga0157378_10745324 3300013297 Bacteria 1002
256 Ga0157378_11935647 3300013297 Unclassified 639
257 Ga0157378_12463009 3300013297 Unclassified 572
258 Ga0163162_10025727 3300013306 Bacteria 5819
259 Ga0163162_10079613 3300013306 Bacteria 3343
260 Ga0163162_10437185 3300013306 Unclassified 1440
261 Ga0163162_10809341 3300013306 Bacteria 1054
262 Ga0163162_11929064 3300013306 Unclassified 676
263 Ga0157372_10003572 3300013307 Bacteria 16736
264 Ga0157372_10004470 3300013307 Bacteria 14921
265 Ga0157372_10010326 3300013307 Bacteria 9922
266 Ga0157372_10015473 3300013307 Bacteria 8177
267 Ga0157372_10029328 3300013307 Bacteria 6006
268 Ga0157372_10040641 3300013307 Bacteria 5138
269 Ga0157372_10055092 3300013307 Bacteria 4439
270 Ga0157372_10074037 3300013307 Bacteria 3840
271 Ga0157372_10082966 3300013307 Bacteria 3630
272 Ga0157372_10151244 3300013307 Bacteria 2679
273 Ga0157372_10183170 3300013307 Bacteria 2425
274 Ga0157372_10185925 3300013307 Bacteria 2406
275 Ga0157372_10192017 3300013307 Bacteria 2365
276 Ga0157372_10356446 3300013307 Unclassified 1704
277 Ga0157372_10403898 3300013307 Bacteria 1592
278 Ga0157372_10533852 3300013307 Bacteria 1367
279 Ga0157372_10791761 3300013307 Bacteria 1102
280 Ga0157372_10889854 3300013307 Bacteria 1033
281 Ga0157372_10944221 3300013307 Bacteria 1000
282 Ga0157372_11193112 3300013307 Bacteria 880
283 Ga0157372_11246250 3300013307 Bacteria 859
284 Ga0157372_11615305 3300013307 Unclassified 746
285 Ga0157372_12035599 3300013307 Unclassified 660
286 Ga0157372_12273695 3300013307 Bacteria 623
287 Ga0157375_10496111 3300013308 Bacteria 1385
288 Ga0157375_10555888 3300013308 Bacteria 1309
289 Ga0157375_10757597 3300013308 Unclassified 1122
290 Ga0157375_11126062 3300013308 Bacteria 919
291 Ga0157375_12550438 3300013308 Bacteria 611
292 Ga0163163_10014847 3300014325 Bacteria 7175
293 Ga0163163_10054518 3300014325 Bacteria 3950
294 Ga0163163_10289720 3300014325 Bacteria 1689
295 Ga0163163_10587713 3300014325 Unclassified 1177
296 Ga0163163_11369979 3300014325 Bacteria 769
297 Ga0157380_10309721 3300014326 Unclassified 1459
298 Ga0157380_10799381 3300014326 Bacteria 960
299 Ga0157380_11328459 3300014326 Bacteria 767
300 Ga0157377_10014841 3300014745 Bacteria 3973
301 Ga0157377_10398320 3300014745 Unclassified 937
302 Ga0157377_10578622 3300014745 Bacteria 798
303 Ga0157377_10865062 3300014745 Bacteria 672
304 Ga0157379_10203428 3300014968 Bacteria 1791
305 Ga0157379_10212274 3300014968 Bacteria 1752
306 Ga0157379_10257223 3300014968 Bacteria 1586
307 Ga0157376_10018476 3300014969 Bacteria 5347
308 Ga0157376_10052998 3300014969 Unclassified 3376
309 Ga0157376_10218135 3300014969 Unclassified 1765
310 Ga0163161_10041693 3300017792 Bacteria 3299
311 Ga0163161_10123891 3300017792 Bacteria 1944
312 Ga0163161_10153391 3300017792 Unclassified 1752
313 Ga0163161_10242298 3300017792 Bacteria 1403
314 Ga0163161_10633452 3300017792 Bacteria 885
315 Ga0207656_10024735 3300025321 Bacteria 2431
316 Ga0207656_10331771 3300025321 Bacteria 757
317 Ga0207682_10251077 3300025893 Bacteria 823
318 Ga0207710_10093233 3300025900 Bacteria 1412
319 Ga0207647_10000794 3300025904 Bacteria 24490
320 Ga0207647_10215361 3300025904 Unclassified 1108
321 Ga0207643_10094634 3300025908 Unclassified 1745
322 Ga0207643_10326702 3300025908 Bacteria 959
323 Ga0207705_10018694 3300025909 Bacteria 4958
324 Ga0207705_10033790 3300025909 Bacteria 3655
325 Ga0207705_10034314 3300025909 Bacteria 3627
326 Ga0207705_10145824 3300025909 Bacteria 1771
327 Ga0207705_10260844 3300025909 Bacteria 1323
328 Ga0207705_10555070 3300025909 Bacteria 893
329 Ga0207705_11218757 3300025909 Bacteria 577
330 Ga0207654_10831810 3300025911 Bacteria 668
331 Ga0207707_10028000 3300025912 Bacteria 4926
332 Ga0207707_10054406 3300025912 Bacteria 3484
333 Ga0207707_10156587 3300025912 Unclassified 1993
334 Ga0207707_10434401 3300025912 Bacteria 1124
335 Ga0207707_10497331 3300025912 Unclassified 1040
336 Ga0207695_10029182 3300025913 Bacteria 6102
337 Ga0207695_10208817 3300025913 Bacteria 1864
338 Ga0207671_10140689 3300025914 Bacteria 1859
339 Ga0207671_10730316 3300025914 Unclassified 787
340 Ga0207660_10048222 3300025917 Bacteria 3014
341 Ga0207660_10052547 3300025917 Bacteria 2901
342 Ga0207660_10202750 3300025917 Bacteria 1550
343 Ga0207660_10224626 3300025917 Bacteria 1475
344 Ga0207662_10155573 3300025918 Bacteria 1457
345 Ga0207662_10271326 3300025918 Bacteria 1120
346 Ga0207657_10004092 3300025919 Bacteria 15482
347 Ga0207657_10059125 3300025919 Bacteria 3296
348 Ga0207657_10080133 3300025919 Bacteria 2745
349 Ga0207657_10102550 3300025919 Unclassified 2373
350 Ga0207649_10018781 3300025920 Bacteria 3940
351 Ga0207652_10000013 3300025921 Bacteria 222247
352 Ga0207652_10000035 3300025921 Bacteria 138263
353 Ga0207652_10005883 3300025921 Bacteria 9926
354 Ga0207652_10090171 3300025921 Bacteria 2693
355 Ga0207652_10121421 3300025921 Bacteria 2325
356 Ga0207652_10164230 3300025921 Bacteria 1991
357 Ga0207681_10181261 3300025923 Bacteria 1604
358 Ga0207650_10002238 3300025925 Bacteria 13508
359 Ga0207650_10154762 3300025925 Bacteria 1812
360 Ga0207650_10170261 3300025925 Bacteria 1730
361 Ga0207650_10589888 3300025925 Bacteria 934
362 Ga0207650_11541732 3300025925 Bacteria 564
363 Ga0207659_10034673 3300025926 Bacteria 3482
364 Ga0207659_10526338 3300025926 Bacteria 1003
365 Ga0207644_10168473 3300025931 Bacteria 1708
366 Ga0207644_10253780 3300025931 Bacteria 1404
367 Ga0207690_10009384 3300025932 Bacteria 5811
368 Ga0207690_10053726 3300025932 Bacteria 2705
369 Ga0207690_10132347 3300025932 Bacteria 1827
370 Ga0207690_10260084 3300025932 Unclassified 1344
371 Ga0207690_10440370 3300025932 Unclassified 1046
372 Ga0207686_10000709 3300025934 Bacteria 20683
373 Ga0207709_10147068 3300025935 Bacteria 1627
374 Ga0207670_10945769 3300025936 Bacteria 723
375 Ga0207669_11247159 3300025937 Bacteria 631
376 Ga0207691_10134620 3300025940 Unclassified 2181
377 Ga0207691_10488652 3300025940 Bacteria 1046
378 Ga0207689_10034122 3300025942 Bacteria 4226
379 Ga0207689_10155124 3300025942 Bacteria 1887
380 Ga0207689_10246872 3300025942 Unclassified 1476
381 Ga0207661_10086982 3300025944 Bacteria 2594
382 Ga0207661_10187673 3300025944 Unclassified 1811
383 Ga0207661_10933568 3300025944 Bacteria 799
384 Ga0207661_10987944 3300025944 Bacteria 775
385 Ga0207661_11622894 3300025944 Bacteria 591
386 Ga0207679_10048577 3300025945 Bacteria 3090
387 Ga0207679_10179004 3300025945 Bacteria 1752
388 Ga0207679_10814154 3300025945 Bacteria 852
389 Ga0207667_10002703 3300025949 Bacteria 21943
390 Ga0207667_10031804 3300025949 Bacteria 5693
391 Ga0207667_10051249 3300025949 Bacteria 4352
392 Ga0207667_10117582 3300025949 Bacteria 2740
393 Ga0207667_10189696 3300025949 Bacteria 2109
394 Ga0207667_10925665 3300025949 Bacteria 862
395 Ga0207651_10033206 3300025960 Bacteria 3326
396 Ga0207651_10673980 3300025960 Bacteria 909
397 Ga0207651_11230088 3300025960 Unclassified 673
398 Ga0207712_10001032 3300025961 Bacteria 19728
399 Ga0207712_10130810 3300025961 Unclassified 1912
400 Ga0207712_11242735 3300025961 Bacteria 665
401 Ga0207640_10046443 3300025981 Bacteria 2794
402 Ga0207640_10120011 3300025981 Bacteria 1881
403 Ga0207640_10158151 3300025981 Unclassified 1673
404 Ga0207640_10893714 3300025981 Bacteria 775
405 Ga0207677_10097653 3300026023 Bacteria 2153
406 Ga0207639_10027480 3300026041 Bacteria 4146
407 Ga0207639_10082827 3300026041 Unclassified 2544
408 Ga0207639_10273809 3300026041 Unclassified 1482
409 Ga0207639_10538421 3300026041 Bacteria 1071
410 Ga0207639_10942659 3300026041 Bacteria 807
411 Ga0207639_11366981 3300026041 Bacteria 665
412 Ga0207639_11860959 3300026041 Bacteria 563
413 Ga0207708_10179244 3300026075 Unclassified 1682
414 Ga0207702_10055653 3300026078 Bacteria 3355
415 Ga0207702_10948282 3300026078 Bacteria 853
416 Ga0207702_10957846 3300026078 Bacteria 849
417 Ga0207641_10001063 3300026088 Bacteria 27692
418 Ga0207641_10020932 3300026088 Bacteria 5376
419 Ga0207641_10296292 3300026088 Bacteria 1526
420 Ga0207641_10418048 3300026088 Unclassified 1290
421 Ga0207641_10771418 3300026088 Bacteria 950
422 Ga0207641_10830163 3300026088 Bacteria 915
423 Ga0207648_10140172 3300026089 Bacteria 2131
424 Ga0207648_10243328 3300026089 Unclassified 1602
425 Ga0207648_10253113 3300026089 Bacteria 1570
426 Ga0207648_11310616 3300026089 Bacteria 680
427 Ga0207676_10093751 3300026095 Bacteria 2472
428 Ga0207676_10280597 3300026095 Unclassified 1512
429 Ga0207676_10302695 3300026095 Bacteria 1460
430 Ga0207674_10063984 3300026116 Bacteria 3711
431 Ga0207674_10206841 3300026116 Unclassified 1912
432 Ga0207674_10241127 3300026116 Bacteria 1755
433 Ga0207674_10381852 3300026116 Bacteria 1362
434 Ga0207674_11759691 3300026116 Bacteria 587
435 Ga0207675_100005394 3300026118 Bacteria 12252
436 Ga0207675_100791072 3300026118 Bacteria 961
437 Ga0207675_100824289 3300026118 Unclassified 942
438 Ga0207675_101713929 3300026118 Bacteria 648
439 Ga0207683_10282275 3300026121 Bacteria 1517
440 Ga0207683_11770699 3300026121 Unclassified 567
441 Ga0207698_10005633 3300026142 Bacteria 7752
442 Ga0207698_10019044 3300026142 Bacteria 4690
443 Ga0207698_10150853 3300026142 Bacteria 2017
444 Ga0207698_10413026 3300026142 Bacteria 1293
445 Ga0207698_10976008 3300026142 Unclassified 857
446 Ga0207698_11200907 3300026142 Bacteria 772
447 Ga0210000_1082064 3300027462 Unclassified 529
448 Ga0209995_1060740 3300027471 Bacteria 644
449 Ga0209974_10018336 3300027876 Unclassified 2322
450 Ga0207428_10438323 3300027907 Bacteria 953
451 Ga0268266_10330619 3300028379 Bacteria 1428
452 Ga0268265_10055836 3300028380 Bacteria 3002
453 Ga0268265_10586893 3300028380 Bacteria 1063
454 Ga0268265_10675746 3300028380 Bacteria 995
455 Ga0268265_10813085 3300028380 Bacteria 912
456 Ga0268264_10008032 3300028381 Bacteria 8776
457 Ga0268264_10633133 3300028381 Unclassified 1057
458 Ga0268264_11330986 3300028381 Bacteria 728
459 Ga0307515_10000001 3300028794 Bacteria 4259510
460 Ga0307405_10462138 3300031731 Bacteria 1009
461 Ga0307410_11109920 3300031852 Bacteria 686
462 Ga0307410_11944820 3300031852 Unclassified 524
463 Ga0307407_10232499 3300031903 Bacteria 1253
464 Ga0307416_100420738 3300032002 Bacteria 1380
465 Ga0307414_10033768 3300032004 Bacteria 3385
466 Ga0307414_10521056 3300032004 Bacteria 1055
467 Ga0307414_10891633 3300032004 Bacteria 815
468 Ga0307414_12034440 3300032004 Bacteria 536
469 Ga0307411_10758063 3300032005 Bacteria 851
470 Ga0307415_100107217 3300032126 Bacteria 2064
471 Ga0373944_0082765 3300035089 Bacteria 1062
472 Ga0395899_0001073 3300037312 Bacteria 24679
473 Ga0395899_0019583 3300037312 Bacteria 5139
474 Ga0395899_0032073 3300037312 Bacteria 3946
475 Ga0395899_0040164 3300037312 Bacteria 3499
476 Ga0395899_0058033 3300037312 Bacteria 2855
477 Ga0395899_0084451 3300037312 Bacteria 2308
478 Ga0395899_0094263 3300037312 Bacteria 2166
479 Ga0395900_0010637 3300037418 Bacteria 9409
480 Ga0395900_0022979 3300037418 Bacteria 6381
481 Ga0395900_0029293 3300037418 Bacteria 5648
482 Ga0395900_0037380 3300037418 Bacteria 5006
483 Ga0395900_0039345 3300037418 Bacteria 4872
484 Ga0395900_0060587 3300037418 Bacteria 3894
485 Ga0395900_0073817 3300037418 Bacteria 3507
486 Ga0395900_0167963 3300037418 Bacteria 2235
487 Ga0395898_0001155 3300037466 Bacteria 40306
488 Ga0395898_0021921 3300037466 Bacteria 6471
489 Ga0395898_0030751 3300037466 Bacteria 5371
490 Ga0395898_0101190 3300037466 Bacteria 2767
491 Ga0395905_0002707 3300037471 Bacteria 19419
492 Ga0395905_0012996 3300037471 Bacteria 8002
493 Ga0395905_0014307 3300037471 Bacteria 7583
494 Ga0395905_0036792 3300037471 Bacteria 4598
495 Ga0395905_0105325 3300037471 Bacteria 2648
496 Ga0395905_0817382 3300037471 Bacteria 835
497 Ga0395901_0004755 3300038443 Bacteria 13702
498 Ga0395901_0007186 3300038443 Bacteria 11230
499 Ga0395901_0089701 3300038443 Bacteria 3217
500 Ga0395901_0096147 3300038443 Bacteria 3104
501 Ga0395901_0126297 3300038443 Bacteria 2688
502 Ga0395901_0163596 3300038443 Bacteria 2336
503 Ga0439461_0017964 3300041410 Bacteria 1380
504 Ga0451793_0399917 3300041452 Bacteria 1031
505 Ga0451800_1203668 3300041459 Bacteria 731
506 Ga0451800_1386280 3300041459 Bacteria 1034
507 Ga0451802_0109468 3300041460 Unclassified 694
508 Ga0451837_1295369 3300041494 Unclassified 512
509 Ga0451843_0590208 3300041509 Bacteria 1053
510 Ga0451843_1222221 3300041509 Bacteria 917
511 Ga0439443_060414 3300042003 Bacteria 678
512 Ga0439432_141933 3300042006 Bacteria 706
513 Ga0439449_0033477 3300042007 Bacteria 1914
514 Ga0439449_0055837 3300042007 Bacteria 1459
515 Ga0439452_070197 3300042010 Bacteria 773
516 Ga0439462_0172952 3300042015 Bacteria 611
517 Ga0450923_006724 3300042125 Bacteria 1917
518 Ga0439446_0101884 3300042156 Bacteria 909
519 Ga0439434_0007984 3300042435 Bacteria 3101
520 Ga0439444_0079175 3300042437 Unclassified 716
521 Ga0466969_0114639 3300044656 Bacteria 1259
522 Ga0453683_0564577 3300044673 Bacteria 741
523 Ga0453684_0047342 3300044712 Bacteria 5704
524 Ga0453684_0315633 3300044712 Bacteria 1772
525 Ga0466959_0102749 3300045049 Bacteria 2045
526 Ga0466967_0199623 3300045976 Unclassified 1894
527 Ga0495621_0034299 3300046539 Unclassified 1753
528 Ga0495581_0393909 3300047315 Bacteria 808
529 Ga0495672_0024295 3300047320 Bacteria 3907
530 Ga0495672_0284229 3300047320 Bacteria 789
531 Ga0495676_0078176 3300047321 Bacteria 2520
532 Ga0496104_1369514 3300048907 Bacteria 611
533 Ga0501300_061766 3300049523 Bacteria 594
534 Ga0501033_0072796 3300049570 Unclassified 2523
535 Ga0501034_0720378 3300049571 Bacteria 895
536 Ga0501034_0904236 3300049571 Bacteria 770
537 Ga0501047_1025706 3300049581 Unclassified 638
538 Ga0501070_0212762 3300049586 Bacteria 1586
539 Ga0501201_010099 3300049651 Bacteria 922
540 Ga0501202_006825 3300049652 Bacteria 2052
541 Ga0501202_080467 3300049652 Bacteria 764
542 Ga0501227_026653 3300049665 Bacteria 1364
543 Ga0501240_118176 3300049673 Unclassified 522
544 Ga0501250_004954 3300049680 Bacteria 1348
545 Ga0501250_013878 3300049680 Bacteria 972
546 Ga0501252_001409 3300049682 Bacteria 2212
547 Ga0501257_207368 3300049686 Bacteria 566
548 Ga0501259_004751 3300049688 Bacteria 2155
549 Ga0501225_0100467 3300049705 Bacteria 845
550 Ga0501245_000547 3300049708 Bacteria 4582
551 Ga0501266_005308 3300049763 Bacteria 1604
552 Ga0501268_010463 3300049765 Bacteria 1445
553 Ga0501273_029537 3300049770 Unclassified 775
554 Ga0501282_031565 3300049778 Bacteria 608
555 Ga0501044_1138731 3300049823 Unclassified 649
556 Ga0501044_1620327 3300049823 Unclassified 512
557 nmdc:mga0k408_432391_c1 3300050493 Bacteria 782
558 nmdc:mga05p37_255658_c1 3300050507 Bacteria 2099
559 nmdc:mga09592_531488_c1 3300050508 Bacteria 1011
560 nmdc:mga09592_996_c1 3300050508 Bacteria 22453
561 nmdc:mga0qj67_9805_c1 3300050509 Bacteria 7137
562 nmdc:mga06r32_1196595_c1 3300050510 Bacteria 706
563 nmdc:mga06r32_1387683_c1 3300050510 Bacteria 645
564 nmdc:mga06r32_64331_c1 3300050510 Bacteria 3537
565 nmdc:mga08y16_101883_c1 3300050511 Bacteria 2989
566 nmdc:mga08y16_194305_c1 3300050511 Bacteria 2104
567 nmdc:mga08y16_783329_c1 3300050511 Unclassified 947
568 nmdc:mga0n895_954761_c1 3300050512 Bacteria 840
569 Ga0500628_060250 3300053129 Bacteria 925

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10094634 Ga0207643_100946342 126
2 3300005466 Ga0070685_10886459 Ga0070685_108864591 135
3 3300026118 Ga0207675_101713929 Ga0207675_1017139291 135
4 3300049652 Ga0501202_006825 Ga0501202_006825_278_703 141
5 3300000043 ARcpr5yngRDRAFT_c011568 ARcpr5yngRDRAFT_0115682 144
6 3300002459 JGI24751J29686_10030404 JGI24751J29686_100304042 144
7 3300005289 Ga0065704_10390956 Ga0065704_103909562 144
8 3300005290 Ga0065712_10006450 Ga0065712_100064504 144
9 3300005295 Ga0065707_10173646 Ga0065707_101736461 144
10 3300005327 Ga0070658_10099518 Ga0070658_100995182 144
11 3300005327 Ga0070658_10191348 Ga0070658_101913483 144
12 3300005327 Ga0070658_10212501 Ga0070658_102125013 144
13 3300005327 Ga0070658_10248127 Ga0070658_102481272 144
14 3300005327 Ga0070658_10414876 Ga0070658_104148762 144
15 3300005327 Ga0070658_10694432 Ga0070658_106944322 144
16 3300005327 Ga0070658_10812875 Ga0070658_108128752 144
17 3300005329 Ga0070683_100296253 Ga0070683_1002962533 144
18 3300005329 Ga0070683_101072220 Ga0070683_1010722201 144
19 3300005331 Ga0070670_100049006 Ga0070670_1000490063 144
20 3300005331 Ga0070670_100083450 Ga0070670_1000834502 144
21 3300005331 Ga0070670_100107240 Ga0070670_1001072403 144
22 3300005331 Ga0070670_100131111 Ga0070670_1001311112 144
23 3300005331 Ga0070670_100648856 Ga0070670_1006488563 144
24 3300005333 Ga0070677_10232663 Ga0070677_102326632 144
25 3300005334 Ga0068869_100024863 Ga0068869_1000248632 144
26 3300005336 Ga0070680_100009385 Ga0070680_1000093856 144
27 3300005336 Ga0070680_100031154 Ga0070680_1000311545 144
28 3300005336 Ga0070680_100039392 Ga0070680_1000393922 144
29 3300005336 Ga0070680_100081642 Ga0070680_1000816424 144
30 3300005336 Ga0070680_100204521 Ga0070680_1002045212 144
31 3300005337 Ga0070682_100357769 Ga0070682_1003577692 144
32 3300005338 Ga0068868_100039380 Ga0068868_1000393802 144
33 3300005338 Ga0068868_100620699 Ga0068868_1006206991 144
34 3300005339 Ga0070660_100001935 Ga0070660_1000019357 144
35 3300005339 Ga0070660_100021641 Ga0070660_1000216415 144
36 3300005339 Ga0070660_100115862 Ga0070660_1001158624 144
37 3300005339 Ga0070660_100118855 Ga0070660_1001188554 144
38 3300005339 Ga0070660_100871534 Ga0070660_1008715341 144
39 3300005343 Ga0070687_100164521 Ga0070687_1001645212 144
40 3300005343 Ga0070687_100213343 Ga0070687_1002133432 144
41 3300005344 Ga0070661_100027194 Ga0070661_1000271946 144
42 3300005344 Ga0070661_100538965 Ga0070661_1005389653 144
43 3300005345 Ga0070692_10141046 Ga0070692_101410462 144
44 3300005345 Ga0070692_10249306 Ga0070692_102493062 144
45 3300005347 Ga0070668_100814013 Ga0070668_1008140131 144
46 3300005353 Ga0070669_100031912 Ga0070669_1000319123 144
47 3300005353 Ga0070669_100101392 Ga0070669_1001013921 144
48 3300005354 Ga0070675_100104298 Ga0070675_1001042982 144
49 3300005354 Ga0070675_101078991 Ga0070675_1010789912 144
50 3300005355 Ga0070671_100266562 Ga0070671_1002665623 144
51 3300005355 Ga0070671_100361570 Ga0070671_1003615703 144
52 3300005356 Ga0070674_100683927 Ga0070674_1006839272 144
53 3300005364 Ga0070673_100074775 Ga0070673_1000747753 144
54 3300005364 Ga0070673_100607960 Ga0070673_1006079603 144
55 3300005365 Ga0070688_100249801 Ga0070688_1002498012 144
56 3300005366 Ga0070659_100001791 Ga0070659_10000179110 144
57 3300005366 Ga0070659_100035067 Ga0070659_1000350672 144
58 3300005366 Ga0070659_100053397 Ga0070659_1000533973 144
59 3300005366 Ga0070659_100156709 Ga0070659_1001567092 144
60 3300005366 Ga0070659_100926344 Ga0070659_1009263441 144
61 3300005435 Ga0070714_100528889 Ga0070714_1005288892 144
62 3300005440 Ga0070705_100241081 Ga0070705_1002410812 144
63 3300005455 Ga0070663_100856225 Ga0070663_1008562251 144
64 3300005456 Ga0070678_100822354 Ga0070678_1008223541 144
65 3300005456 Ga0070678_101293502 Ga0070678_1012935021 144
66 3300005458 Ga0070681_10018161 Ga0070681_100181616 144
67 3300005458 Ga0070681_10157488 Ga0070681_101574882 144
68 3300005458 Ga0070681_10349581 Ga0070681_103495813 144
69 3300005458 Ga0070681_10588485 Ga0070681_105884851 144
70 3300005458 Ga0070681_11374123 Ga0070681_113741232 144
71 3300005459 Ga0068867_100581512 Ga0068867_1005815122 144
72 3300005466 Ga0070685_10406834 Ga0070685_104068342 144
73 3300005466 Ga0070685_10524724 Ga0070685_105247242 144
74 3300005468 Ga0070707_100779394 Ga0070707_1007793941 144
75 3300005471 Ga0070698_100000282 Ga0070698_1000002827 144
76 3300005471 Ga0070698_100004896 Ga0070698_1000048962 144
77 3300005518 Ga0070699_100120659 Ga0070699_1001206592 144
78 3300005530 Ga0070679_100000065 Ga0070679_10000006528 144
79 3300005530 Ga0070679_100063296 Ga0070679_1000632962 144
80 3300005530 Ga0070679_100075450 Ga0070679_1000754505 144
81 3300005530 Ga0070679_100130669 Ga0070679_1001306694 144
82 3300005530 Ga0070679_100447673 Ga0070679_1004476731 144
83 3300005530 Ga0070679_100937160 Ga0070679_1009371602 144
84 3300005530 Ga0070679_101208181 Ga0070679_1012081811 144
85 3300005535 Ga0070684_100000793 Ga0070684_1000007933 144
86 3300005539 Ga0068853_100016566 Ga0068853_1000165662 144
87 3300005539 Ga0068853_100024373 Ga0068853_1000243733 144
88 3300005539 Ga0068853_100047906 Ga0068853_1000479063 144
89 3300005539 Ga0068853_100094190 Ga0068853_1000941902 144
90 3300005539 Ga0068853_100196313 Ga0068853_1001963132 144
91 3300005539 Ga0068853_100981828 Ga0068853_1009818281 144
92 3300005539 Ga0068853_101131974 Ga0068853_1011319742 144
93 3300005539 Ga0068853_102180465 Ga0068853_1021804651 144
94 3300005539 Ga0068853_102199387 Ga0068853_1021993871 144
95 3300005544 Ga0070686_100197361 Ga0070686_1001973614 144
96 3300005544 Ga0070686_101514478 Ga0070686_1015144781 144
97 3300005546 Ga0070696_100092277 Ga0070696_1000922774 144
98 3300005546 Ga0070696_100698733 Ga0070696_1006987331 144
99 3300005548 Ga0070665_100362186 Ga0070665_1003621862 144
100 3300005549 Ga0070704_100555263 Ga0070704_1005552632 144
101 3300005563 Ga0068855_100000189 Ga0068855_10000018923 144
102 3300005563 Ga0068855_100001235 Ga0068855_1000012351 144
103 3300005563 Ga0068855_100345673 Ga0068855_1003456733 144
104 3300005563 Ga0068855_100346249 Ga0068855_1003462493 144
105 3300005563 Ga0068855_100585614 Ga0068855_1005856142 144
106 3300005563 Ga0068855_100622397 Ga0068855_1006223973 144
107 3300005563 Ga0068855_100716470 Ga0068855_1007164703 144
108 3300005563 Ga0068855_101080551 Ga0068855_1010805512 144
109 3300005563 Ga0068855_101174495 Ga0068855_1011744951 144
110 3300005564 Ga0070664_100152412 Ga0070664_1001524122 144
111 3300005564 Ga0070664_100361485 Ga0070664_1003614852 144
112 3300005564 Ga0070664_100463984 Ga0070664_1004639842 144
113 3300005564 Ga0070664_100722394 Ga0070664_1007223942 144
114 3300005564 Ga0070664_100870843 Ga0070664_1008708432 144
115 3300005577 Ga0068857_100022671 Ga0068857_1000226714 144
116 3300005577 Ga0068857_100098119 Ga0068857_1000981194 144
117 3300005578 Ga0068854_100095888 Ga0068854_1000958882 144
118 3300005578 Ga0068854_100132123 Ga0068854_1001321234 144
119 3300005578 Ga0068854_100183731 Ga0068854_1001837312 144
120 3300005614 Ga0068856_100022167 Ga0068856_1000221674 144
121 3300005614 Ga0068856_100063993 Ga0068856_1000639935 144
122 3300005616 Ga0068852_100002826 Ga0068852_1000028269 144
123 3300005616 Ga0068852_100020117 Ga0068852_1000201174 144
124 3300005616 Ga0068852_100030254 Ga0068852_1000302544 144
125 3300005616 Ga0068852_100047642 Ga0068852_1000476422 144
126 3300005616 Ga0068852_100253017 Ga0068852_1002530172 144
127 3300005616 Ga0068852_100824713 Ga0068852_1008247131 144
128 3300005616 Ga0068852_101109875 Ga0068852_1011098751 144
129 3300005616 Ga0068852_101467786 Ga0068852_1014677862 144
130 3300005616 Ga0068852_102023086 Ga0068852_1020230861 144
131 3300005616 Ga0068852_102689474 Ga0068852_1026894741 144
132 3300005617 Ga0068859_100065142 Ga0068859_1000651422 144
133 3300005617 Ga0068859_100090394 Ga0068859_1000903942 144
134 3300005617 Ga0068859_100276220 Ga0068859_1002762201 144
135 3300005617 Ga0068859_100312158 Ga0068859_1003121583 144
136 3300005617 Ga0068859_100382481 Ga0068859_1003824813 144
137 3300005617 Ga0068859_100617796 Ga0068859_1006177962 144
138 3300005617 Ga0068859_100781245 Ga0068859_1007812452 144
139 3300005618 Ga0068864_100035197 Ga0068864_1000351973 144
140 3300005618 Ga0068864_100123836 Ga0068864_1001238363 144
141 3300005618 Ga0068864_100357915 Ga0068864_1003579152 144
142 3300005719 Ga0068861_100004473 Ga0068861_1000044733 144
143 3300005719 Ga0068861_100303297 Ga0068861_1003032972 144
144 3300005719 Ga0068861_102410844 Ga0068861_1024108442 144
145 3300005834 Ga0068851_10012642 Ga0068851_100126422 144
146 3300005834 Ga0068851_10101705 Ga0068851_101017052 144
147 3300005834 Ga0068851_10106657 Ga0068851_101066571 144
148 3300005834 Ga0068851_10555620 Ga0068851_105556202 144
149 3300005834 Ga0068851_10959381 Ga0068851_109593811 144
150 3300005840 Ga0068870_10758166 Ga0068870_107581662 144
151 3300005841 Ga0068863_100029142 Ga0068863_1000291425 144
152 3300005841 Ga0068863_100038534 Ga0068863_1000385343 144
153 3300005841 Ga0068863_100258808 Ga0068863_1002588083 144
154 3300005841 Ga0068863_100619655 Ga0068863_1006196552 144
155 3300005841 Ga0068863_100891301 Ga0068863_1008913012 144
156 3300005842 Ga0068858_100388364 Ga0068858_1003883641 144
157 3300005843 Ga0068860_100013488 Ga0068860_1000134885 144
158 3300005843 Ga0068860_100479507 Ga0068860_1004795073 144
159 3300005843 Ga0068860_100516751 Ga0068860_1005167513 144
160 3300005843 Ga0068860_101000708 Ga0068860_1010007082 144
161 3300005844 Ga0068862_100245586 Ga0068862_1002455862 144
162 3300005844 Ga0068862_100584045 Ga0068862_1005840452 144
163 3300006237 Ga0097621_100014286 Ga0097621_1000142867 144
164 3300006237 Ga0097621_100243572 Ga0097621_1002435722 144
165 3300006358 Ga0068871_100804610 Ga0068871_1008046102 144
166 3300006358 Ga0068871_100861015 Ga0068871_1008610152 144
167 3300006844 Ga0075428_100014821 Ga0075428_1000148215 144
168 3300006844 Ga0075428_100048180 Ga0075428_1000481803 144
169 3300006844 Ga0075428_100132746 Ga0075428_1001327462 144
170 3300006844 Ga0075428_101817476 Ga0075428_1018174762 144
171 3300006846 Ga0075430_100001793 Ga0075430_10000179315 144
172 3300006847 Ga0075431_100031975 Ga0075431_1000319753 144
173 3300006847 Ga0075431_100908330 Ga0075431_1009083301 144
174 3300006847 Ga0075431_101294479 Ga0075431_1012944791 144
175 3300006880 Ga0075429_100000136 Ga0075429_10000013638 144
176 3300006880 Ga0075429_100589406 Ga0075429_1005894063 144
177 3300006931 Ga0097620_100062773 Ga0097620_1000627736 144
178 3300006931 Ga0097620_100065142 Ga0097620_1000651425 144
179 3300006931 Ga0097620_100090395 Ga0097620_1000903952 144
180 3300006931 Ga0097620_100276205 Ga0097620_1002762051 144
181 3300006931 Ga0097620_100312157 Ga0097620_1003121573 144
182 3300006931 Ga0097620_100382492 Ga0097620_1003824922 144
183 3300006931 Ga0097620_100617801 Ga0097620_1006178012 144
184 3300006931 Ga0097620_100781049 Ga0097620_1007810493 144
185 3300009093 Ga0105240_10294577 Ga0105240_102945773 144
186 3300009094 Ga0111539_10118607 Ga0111539_101186073 144
187 3300009094 Ga0111539_10120160 Ga0111539_101201602 144
188 3300009094 Ga0111539_12080550 Ga0111539_120805502 144
189 3300009101 Ga0105247_10136885 Ga0105247_101368852 144
190 3300009147 Ga0114129_12026737 Ga0114129_120267372 144
191 3300009148 Ga0105243_10621789 Ga0105243_106217891 144
192 3300009148 Ga0105243_11457419 Ga0105243_114574192 144
193 3300009174 Ga0105241_10021632 Ga0105241_100216323 144
194 3300009176 Ga0105242_10007396 Ga0105242_100073964 144
195 3300009176 Ga0105242_10197772 Ga0105242_101977723 144
196 3300009176 Ga0105242_10358502 Ga0105242_103585022 144
197 3300009176 Ga0105242_11761951 Ga0105242_117619511 144
198 3300009177 Ga0105248_11335531 Ga0105248_113355311 144
199 3300009545 Ga0105237_10108498 Ga0105237_101084982 144
200 3300009545 Ga0105237_10571112 Ga0105237_105711122 144
201 3300009553 Ga0105249_10001213 Ga0105249_1000121315 144
202 3300009553 Ga0105249_10001789 Ga0105249_1000178913 144
203 3300009553 Ga0105249_10164540 Ga0105249_101645402 144
204 3300009553 Ga0105249_10168015 Ga0105249_101680153 144
205 3300009553 Ga0105249_11916919 Ga0105249_119169191 144
206 3300009553 Ga0105249_12466618 Ga0105249_124666181 144
207 3300009553 Ga0105249_12679515 Ga0105249_126795151 144
208 3300010375 Ga0105239_10038971 Ga0105239_100389713 144
209 3300011119 Ga0105246_10375027 Ga0105246_103750271 144
210 3300013100 Ga0157373_10001339 Ga0157373_100013398 144
211 3300013100 Ga0157373_10035077 Ga0157373_100350772 144
212 3300013100 Ga0157373_10043440 Ga0157373_100434404 144
213 3300013100 Ga0157373_10048599 Ga0157373_100485993 144
214 3300013100 Ga0157373_10379302 Ga0157373_103793021 144
215 3300013100 Ga0157373_10387725 Ga0157373_103877252 144
216 3300013100 Ga0157373_10617003 Ga0157373_106170032 144
217 3300013102 Ga0157371_10000326 Ga0157371_1000032645 144
218 3300013102 Ga0157371_10003758 Ga0157371_100037584 144
219 3300013102 Ga0157371_10004714 Ga0157371_100047149 144
220 3300013102 Ga0157371_10004797 Ga0157371_1000479712 144
221 3300013102 Ga0157371_10010426 Ga0157371_100104266 144
222 3300013102 Ga0157371_10016890 Ga0157371_100168904 144
223 3300013102 Ga0157371_10032682 Ga0157371_100326823 144
224 3300013102 Ga0157371_10038313 Ga0157371_100383136 144
225 3300013102 Ga0157371_10039550 Ga0157371_100395503 144
226 3300013102 Ga0157371_10140511 Ga0157371_101405112 144
227 3300013102 Ga0157371_10209806 Ga0157371_102098062 144
228 3300013102 Ga0157371_10212440 Ga0157371_102124402 144
229 3300013102 Ga0157371_10253519 Ga0157371_102535193 144
230 3300013102 Ga0157371_10266039 Ga0157371_102660393 144
231 3300013102 Ga0157371_10300213 Ga0157371_103002132 144
232 3300013102 Ga0157371_10377573 Ga0157371_103775732 144
233 3300013104 Ga0157370_10003774 Ga0157370_100037743 144
234 3300013104 Ga0157370_10007491 Ga0157370_100074918 144
235 3300013104 Ga0157370_10056533 Ga0157370_100565334 144
236 3300013104 Ga0157370_10092662 Ga0157370_100926621 144
237 3300013104 Ga0157370_10120438 Ga0157370_101204382 144
238 3300013104 Ga0157370_10164225 Ga0157370_101642252 144
239 3300013104 Ga0157370_10193227 Ga0157370_101932274 144
240 3300013104 Ga0157370_10307372 Ga0157370_103073724 144
241 3300013104 Ga0157370_10403959 Ga0157370_104039593 144
242 3300013104 Ga0157370_10752516 Ga0157370_107525163 144
243 3300013105 Ga0157369_10042466 Ga0157369_100424663 144
244 3300013105 Ga0157369_10090879 Ga0157369_100908793 144
245 3300013105 Ga0157369_10248419 Ga0157369_102484192 144
246 3300013105 Ga0157369_10272481 Ga0157369_102724813 144
247 3300013105 Ga0157369_10363334 Ga0157369_103633342 144
248 3300013105 Ga0157369_10372401 Ga0157369_103724013 144
249 3300013105 Ga0157369_10487553 Ga0157369_104875532 144
250 3300013105 Ga0157369_10702940 Ga0157369_107029402 144
251 3300013105 Ga0157369_10761062 Ga0157369_107610621 144
252 3300013105 Ga0157369_10986183 Ga0157369_109861832 144
253 3300013296 Ga0157374_10848542 Ga0157374_108485421 144
254 3300013297 Ga0157378_10029228 Ga0157378_100292283 144
255 3300013297 Ga0157378_10461065 Ga0157378_104610651 144
256 3300013297 Ga0157378_10603524 Ga0157378_106035242 144
257 3300013297 Ga0157378_10637902 Ga0157378_106379023 144
258 3300013297 Ga0157378_10745324 Ga0157378_107453242 144
259 3300013297 Ga0157378_11935647 Ga0157378_119356472 144
260 3300013297 Ga0157378_12463009 Ga0157378_124630091 144
261 3300013306 Ga0163162_10025727 Ga0163162_100257277 144
262 3300013306 Ga0163162_10079613 Ga0163162_100796135 144
263 3300013306 Ga0163162_10437185 Ga0163162_104371851 144
264 3300013306 Ga0163162_10809341 Ga0163162_108093412 144
265 3300013306 Ga0163162_11929064 Ga0163162_119290642 144
266 3300013307 Ga0157372_10003572 Ga0157372_1000357211 144
267 3300013307 Ga0157372_10004470 Ga0157372_100044705 144
268 3300013307 Ga0157372_10010326 Ga0157372_100103267 144
269 3300013307 Ga0157372_10015473 Ga0157372_100154732 144
270 3300013307 Ga0157372_10029328 Ga0157372_100293284 144
271 3300013307 Ga0157372_10040641 Ga0157372_100406417 144
272 3300013307 Ga0157372_10055092 Ga0157372_100550922 144
273 3300013307 Ga0157372_10074037 Ga0157372_100740372 144
274 3300013307 Ga0157372_10082966 Ga0157372_100829665 144
275 3300013307 Ga0157372_10151244 Ga0157372_101512443 144
276 3300013307 Ga0157372_10183170 Ga0157372_101831702 144
277 3300013307 Ga0157372_10185925 Ga0157372_101859254 144
278 3300013307 Ga0157372_10192017 Ga0157372_101920174 144
279 3300013307 Ga0157372_10356446 Ga0157372_103564463 144
280 3300013307 Ga0157372_10403898 Ga0157372_104038982 144
281 3300013307 Ga0157372_10533852 Ga0157372_105338523 144
282 3300013307 Ga0157372_10791761 Ga0157372_107917612 144
283 3300013307 Ga0157372_10889854 Ga0157372_108898541 144
284 3300013307 Ga0157372_10944221 Ga0157372_109442211 144
285 3300013307 Ga0157372_11193112 Ga0157372_111931122 144
286 3300013307 Ga0157372_11246250 Ga0157372_112462501 144
287 3300013307 Ga0157372_11615305 Ga0157372_116153052 144
288 3300013307 Ga0157372_12035599 Ga0157372_120355992 144
289 3300013307 Ga0157372_12273695 Ga0157372_122736951 144
290 3300013308 Ga0157375_10496111 Ga0157375_104961112 144
291 3300013308 Ga0157375_10555888 Ga0157375_105558882 144
292 3300013308 Ga0157375_10757597 Ga0157375_107575973 144
293 3300013308 Ga0157375_11126062 Ga0157375_111260622 144
294 3300013308 Ga0157375_12550438 Ga0157375_125504381 144
295 3300014325 Ga0163163_10014847 Ga0163163_100148476 144
296 3300014325 Ga0163163_10054518 Ga0163163_100545184 144
297 3300014325 Ga0163163_10289720 Ga0163163_102897202 144
298 3300014325 Ga0163163_10587713 Ga0163163_105877131 144
299 3300014325 Ga0163163_11369979 Ga0163163_113699792 144
300 3300014326 Ga0157380_10309721 Ga0157380_103097213 144
301 3300014326 Ga0157380_10799381 Ga0157380_107993812 144
302 3300014326 Ga0157380_11328459 Ga0157380_113284591 144
303 3300014745 Ga0157377_10014841 Ga0157377_100148414 144
304 3300014745 Ga0157377_10398320 Ga0157377_103983201 144
305 3300014745 Ga0157377_10578622 Ga0157377_105786222 144
306 3300014745 Ga0157377_10865062 Ga0157377_108650621 144
307 3300014968 Ga0157379_10203428 Ga0157379_102034282 144
308 3300014968 Ga0157379_10212274 Ga0157379_102122743 144
309 3300014968 Ga0157379_10257223 Ga0157379_102572231 144
310 3300014969 Ga0157376_10018476 Ga0157376_100184762 144
311 3300014969 Ga0157376_10052998 Ga0157376_100529982 144
312 3300014969 Ga0157376_10218135 Ga0157376_102181352 144
313 3300017792 Ga0163161_10041693 Ga0163161_100416933 144
314 3300017792 Ga0163161_10123891 Ga0163161_101238914 144
315 3300017792 Ga0163161_10153391 Ga0163161_101533913 144
316 3300017792 Ga0163161_10242298 Ga0163161_102422982 144
317 3300017792 Ga0163161_10633452 Ga0163161_106334521 144
318 3300025321 Ga0207656_10024735 Ga0207656_100247353 144
319 3300025321 Ga0207656_10331771 Ga0207656_103317712 144
320 3300025893 Ga0207682_10251077 Ga0207682_102510771 144
321 3300025900 Ga0207710_10093233 Ga0207710_100932333 144
322 3300025904 Ga0207647_10000794 Ga0207647_1000079419 144
323 3300025904 Ga0207647_10215361 Ga0207647_102153613 144
324 3300025908 Ga0207643_10326702 Ga0207643_103267022 144
325 3300025909 Ga0207705_10018694 Ga0207705_100186943 144
326 3300025909 Ga0207705_10033790 Ga0207705_100337902 144
327 3300025909 Ga0207705_10034314 Ga0207705_100343143 144
328 3300025909 Ga0207705_10145824 Ga0207705_101458242 144
329 3300025909 Ga0207705_10260844 Ga0207705_102608442 144
330 3300025909 Ga0207705_10555070 Ga0207705_105550702 144
331 3300025909 Ga0207705_11218757 Ga0207705_112187572 144
332 3300025911 Ga0207654_10831810 Ga0207654_108318102 144
333 3300025912 Ga0207707_10028000 Ga0207707_100280003 144
334 3300025912 Ga0207707_10054406 Ga0207707_100544063 144
335 3300025912 Ga0207707_10156587 Ga0207707_101565873 144
336 3300025912 Ga0207707_10434401 Ga0207707_104344012 144
337 3300025912 Ga0207707_10497331 Ga0207707_104973311 144
338 3300025913 Ga0207695_10029182 Ga0207695_100291823 144
339 3300025913 Ga0207695_10208817 Ga0207695_102088172 144
340 3300025914 Ga0207671_10140689 Ga0207671_101406893 144
341 3300025914 Ga0207671_10730316 Ga0207671_107303162 144
342 3300025917 Ga0207660_10048222 Ga0207660_100482222 144
343 3300025917 Ga0207660_10052547 Ga0207660_100525472 144
344 3300025917 Ga0207660_10202750 Ga0207660_102027503 144
345 3300025917 Ga0207660_10224626 Ga0207660_102246262 144
346 3300025918 Ga0207662_10155573 Ga0207662_101555732 144
347 3300025918 Ga0207662_10271326 Ga0207662_102713262 144
348 3300025919 Ga0207657_10004092 Ga0207657_1000409213 144
349 3300025919 Ga0207657_10059125 Ga0207657_100591253 144
350 3300025919 Ga0207657_10080133 Ga0207657_100801332 144
351 3300025919 Ga0207657_10102550 Ga0207657_101025503 144
352 3300025920 Ga0207649_10018781 Ga0207649_100187812 144
353 3300025921 Ga0207652_10000013 Ga0207652_1000001395 144
354 3300025921 Ga0207652_10000035 Ga0207652_100000355 144
355 3300025921 Ga0207652_10005883 Ga0207652_100058836 144
356 3300025921 Ga0207652_10090171 Ga0207652_100901711 144
357 3300025921 Ga0207652_10121421 Ga0207652_101214211 144
358 3300025921 Ga0207652_10164230 Ga0207652_101642302 144
359 3300025923 Ga0207681_10181261 Ga0207681_101812613 144
360 3300025925 Ga0207650_10002238 Ga0207650_100022383 144
361 3300025925 Ga0207650_10154762 Ga0207650_101547622 144
362 3300025925 Ga0207650_10170261 Ga0207650_101702612 144
363 3300025925 Ga0207650_10589888 Ga0207650_105898882 144
364 3300025925 Ga0207650_11541732 Ga0207650_115417321 144
365 3300025926 Ga0207659_10034673 Ga0207659_100346732 144
366 3300025926 Ga0207659_10526338 Ga0207659_105263382 144
367 3300025931 Ga0207644_10168473 Ga0207644_101684733 144
368 3300025931 Ga0207644_10253780 Ga0207644_102537802 144
369 3300025932 Ga0207690_10009384 Ga0207690_100093844 144
370 3300025932 Ga0207690_10053726 Ga0207690_100537262 144
371 3300025932 Ga0207690_10132347 Ga0207690_101323472 144
372 3300025932 Ga0207690_10260084 Ga0207690_102600842 144
373 3300025932 Ga0207690_10440370 Ga0207690_104403703 144
374 3300025934 Ga0207686_10000709 Ga0207686_100007095 144
375 3300025935 Ga0207709_10147068 Ga0207709_101470682 144
376 3300025936 Ga0207670_10945769 Ga0207670_109457692 144
377 3300025937 Ga0207669_11247159 Ga0207669_112471592 144
378 3300025940 Ga0207691_10134620 Ga0207691_101346203 144
379 3300025940 Ga0207691_10488652 Ga0207691_104886523 144
380 3300025942 Ga0207689_10034122 Ga0207689_100341224 144
381 3300025942 Ga0207689_10155124 Ga0207689_101551242 144
382 3300025942 Ga0207689_10246872 Ga0207689_102468723 144
383 3300025944 Ga0207661_10086982 Ga0207661_100869823 144
384 3300025944 Ga0207661_10187673 Ga0207661_101876733 144
385 3300025944 Ga0207661_10933568 Ga0207661_109335682 144
386 3300025944 Ga0207661_10987944 Ga0207661_109879441 144
387 3300025944 Ga0207661_11622894 Ga0207661_116228941 144
388 3300025945 Ga0207679_10048577 Ga0207679_100485774 144
389 3300025945 Ga0207679_10179004 Ga0207679_101790042 144
390 3300025945 Ga0207679_10814154 Ga0207679_108141542 144
391 3300025949 Ga0207667_10002703 Ga0207667_100027033 144
392 3300025949 Ga0207667_10031804 Ga0207667_100318044 144
393 3300025949 Ga0207667_10051249 Ga0207667_100512491 144
394 3300025949 Ga0207667_10117582 Ga0207667_101175824 144
395 3300025949 Ga0207667_10189696 Ga0207667_101896963 144
396 3300025949 Ga0207667_10925665 Ga0207667_109256652 144
397 3300025960 Ga0207651_10033206 Ga0207651_100332062 144
398 3300025960 Ga0207651_10673980 Ga0207651_106739802 144
399 3300025960 Ga0207651_11230088 Ga0207651_112300882 144
400 3300025961 Ga0207712_10001032 Ga0207712_100010327 144
401 3300025961 Ga0207712_10130810 Ga0207712_101308102 144
402 3300025961 Ga0207712_11242735 Ga0207712_112427351 144
403 3300025981 Ga0207640_10046443 Ga0207640_100464432 144
404 3300025981 Ga0207640_10120011 Ga0207640_101200112 144
405 3300025981 Ga0207640_10158151 Ga0207640_101581513 144
406 3300025981 Ga0207640_10893714 Ga0207640_108937142 144
407 3300026023 Ga0207677_10097653 Ga0207677_100976532 144
408 3300026041 Ga0207639_10027480 Ga0207639_100274803 144
409 3300026041 Ga0207639_10082827 Ga0207639_100828272 144
410 3300026041 Ga0207639_10273809 Ga0207639_102738092 144
411 3300026041 Ga0207639_10538421 Ga0207639_105384212 144
412 3300026041 Ga0207639_10942659 Ga0207639_109426592 144
413 3300026041 Ga0207639_11366981 Ga0207639_113669811 144
414 3300026041 Ga0207639_11860959 Ga0207639_118609591 144
415 3300026075 Ga0207708_10179244 Ga0207708_101792443 144
416 3300026078 Ga0207702_10055653 Ga0207702_100556534 144
417 3300026078 Ga0207702_10948282 Ga0207702_109482822 144
418 3300026078 Ga0207702_10957846 Ga0207702_109578462 144
419 3300026088 Ga0207641_10001063 Ga0207641_1000106315 144
420 3300026088 Ga0207641_10020932 Ga0207641_100209322 144
421 3300026088 Ga0207641_10296292 Ga0207641_102962922 144
422 3300026088 Ga0207641_10418048 Ga0207641_104180482 144
423 3300026088 Ga0207641_10771418 Ga0207641_107714182 144
424 3300026088 Ga0207641_10830163 Ga0207641_108301632 144
425 3300026089 Ga0207648_10140172 Ga0207648_101401723 144
426 3300026089 Ga0207648_10243328 Ga0207648_102433282 144
427 3300026089 Ga0207648_10253113 Ga0207648_102531133 144
428 3300026089 Ga0207648_11310616 Ga0207648_113106162 144
429 3300026095 Ga0207676_10093751 Ga0207676_100937512 144
430 3300026095 Ga0207676_10280597 Ga0207676_102805973 144
431 3300026095 Ga0207676_10302695 Ga0207676_103026953 144
432 3300026116 Ga0207674_10063984 Ga0207674_100639843 144
433 3300026116 Ga0207674_10206841 Ga0207674_102068412 144
434 3300026116 Ga0207674_10241127 Ga0207674_102411273 144
435 3300026116 Ga0207674_10381852 Ga0207674_103818522 144
436 3300026116 Ga0207674_11759691 Ga0207674_117596912 144
437 3300026118 Ga0207675_100005394 Ga0207675_1000053949 144
438 3300026118 Ga0207675_100791072 Ga0207675_1007910722 144
439 3300026118 Ga0207675_100824289 Ga0207675_1008242893 144
440 3300026121 Ga0207683_10282275 Ga0207683_102822752 144
441 3300026121 Ga0207683_11770699 Ga0207683_117706991 144
442 3300026142 Ga0207698_10005633 Ga0207698_100056334 144
443 3300026142 Ga0207698_10019044 Ga0207698_100190443 144
444 3300026142 Ga0207698_10150853 Ga0207698_101508532 144
445 3300026142 Ga0207698_10413026 Ga0207698_104130262 144
446 3300026142 Ga0207698_10976008 Ga0207698_109760082 144
447 3300026142 Ga0207698_11200907 Ga0207698_112009071 144
448 3300027462 Ga0210000_1082064 Ga0210000_10820641 144
449 3300027471 Ga0209995_1060740 Ga0209995_10607401 144
450 3300027876 Ga0209974_10018336 Ga0209974_100183363 144
451 3300027907 Ga0207428_10438323 Ga0207428_104383231 144
452 3300028379 Ga0268266_10330619 Ga0268266_103306193 144
453 3300028380 Ga0268265_10055836 Ga0268265_100558364 144
454 3300028380 Ga0268265_10586893 Ga0268265_105868932 144
455 3300028380 Ga0268265_10675746 Ga0268265_106757463 144
456 3300028380 Ga0268265_10813085 Ga0268265_108130852 144
457 3300028381 Ga0268264_10008032 Ga0268264_100080324 144
458 3300028381 Ga0268264_10633133 Ga0268264_106331332 144
459 3300028381 Ga0268264_11330986 Ga0268264_113309861 144
460 3300028794 Ga0307515_10000001 Ga0307515_100000012731 144
461 3300031731 Ga0307405_10462138 Ga0307405_104621382 144
462 3300031852 Ga0307410_11109920 Ga0307410_111099201 144
463 3300031852 Ga0307410_11944820 Ga0307410_119448201 144
464 3300031903 Ga0307407_10232499 Ga0307407_102324992 144
465 3300032002 Ga0307416_100420738 Ga0307416_1004207382 144
466 3300032004 Ga0307414_10033768 Ga0307414_100337683 144
467 3300032004 Ga0307414_10521056 Ga0307414_105210562 144
468 3300032004 Ga0307414_10891633 Ga0307414_108916331 144
469 3300032004 Ga0307414_12034440 Ga0307414_120344401 144
470 3300032005 Ga0307411_10758063 Ga0307411_107580632 144
471 3300032126 Ga0307415_100107217 Ga0307415_1001072171 144
472 3300035089 Ga0373944_0082765 Ga0373944_0082765_513_947 144
473 3300037312 Ga0395899_0001073 Ga0395899_0001073_22888_23322 144
474 3300037312 Ga0395899_0019583 Ga0395899_0019583_1016_1450 144
475 3300037312 Ga0395899_0032073 Ga0395899_0032073_1061_1495 144
476 3300037312 Ga0395899_0040164 Ga0395899_0040164_2063_2497 144
477 3300037312 Ga0395899_0058033 Ga0395899_0058033_1399_1833 144
478 3300037312 Ga0395899_0084451 Ga0395899_0084451_203_637 144
479 3300037312 Ga0395899_0094263 Ga0395899_0094263_185_619 144
480 3300037418 Ga0395900_0010637 Ga0395900_0010637_552_986 144
481 3300037418 Ga0395900_0022979 Ga0395900_0022979_4431_4865 144
482 3300037418 Ga0395900_0029293 Ga0395900_0029293_3157_3591 144
483 3300037418 Ga0395900_0037380 Ga0395900_0037380_817_1251 144
484 3300037418 Ga0395900_0039345 Ga0395900_0039345_4249_4683 144
485 3300037418 Ga0395900_0060587 Ga0395900_0060587_3173_3607 144
486 3300037418 Ga0395900_0073817 Ga0395900_0073817_1125_1559 144
487 3300037418 Ga0395900_0167963 Ga0395900_0167963_636_1070 144
488 3300037466 Ga0395898_0001155 Ga0395898_0001155_8422_8856 144
489 3300037466 Ga0395898_0021921 Ga0395898_0021921_1245_1679 144
490 3300037466 Ga0395898_0030751 Ga0395898_0030751_1403_1837 144
491 3300037466 Ga0395898_0101190 Ga0395898_0101190_997_1431 144
492 3300037471 Ga0395905_0002707 Ga0395905_0002707_16920_17354 144
493 3300037471 Ga0395905_0012996 Ga0395905_0012996_4480_4914 144
494 3300037471 Ga0395905_0014307 Ga0395905_0014307_2083_2517 144
495 3300037471 Ga0395905_0036792 Ga0395905_0036792_4096_4530 144
496 3300037471 Ga0395905_0105325 Ga0395905_0105325_1240_1674 144
497 3300037471 Ga0395905_0817382 Ga0395905_0817382_67_501 144
498 3300038443 Ga0395901_0004755 Ga0395901_0004755_3517_3951 144
499 3300038443 Ga0395901_0007186 Ga0395901_0007186_2579_3013 144
500 3300038443 Ga0395901_0089701 Ga0395901_0089701_549_983 144
501 3300038443 Ga0395901_0096147 Ga0395901_0096147_2180_2614 144
502 3300038443 Ga0395901_0126297 Ga0395901_0126297_343_777 144
503 3300038443 Ga0395901_0163596 Ga0395901_0163596_1879_2313 144
504 3300041410 Ga0439461_0017964 Ga0439461_0017964_677_1126 144
505 3300041452 Ga0451793_0399917 Ga0451793_0399917_12_461 144
506 3300041459 Ga0451800_1203668 Ga0451800_1203668_97_531 144
507 3300041459 Ga0451800_1386280 Ga0451800_1386280_527_967 144
508 3300041460 Ga0451802_0109468 Ga0451802_0109468_41_529 144
509 3300041494 Ga0451837_1295369 Ga0451837_1295369_11_445 144
510 3300041509 Ga0451843_0590208 Ga0451843_0590208_141_575 144
511 3300041509 Ga0451843_1222221 Ga0451843_1222221_288_737 144
512 3300042003 Ga0439443_060414 Ga0439443_060414_92_529 144
513 3300042006 Ga0439432_141933 Ga0439432_141933_91_540 144
514 3300042007 Ga0439449_0033477 Ga0439449_0033477_1093_1527 144
515 3300042007 Ga0439449_0055837 Ga0439449_0055837_672_1121 144
516 3300042010 Ga0439452_070197 Ga0439452_070197_101_550 144
517 3300042015 Ga0439462_0172952 Ga0439462_0172952_67_501 144
518 3300042125 Ga0450923_006724 Ga0450923_006724_17_454 144
519 3300042156 Ga0439446_0101884 Ga0439446_0101884_38_472 144
520 3300042435 Ga0439434_0007984 Ga0439434_0007984_885_1334 144
521 3300042437 Ga0439444_0079175 Ga0439444_0079175_215_652 144
522 3300044656 Ga0466969_0114639 Ga0466969_0114639_202_636 144
523 3300044673 Ga0453683_0564577 Ga0453683_0564577_261_698 144
524 3300044712 Ga0453684_0047342 Ga0453684_0047342_2722_3156 144
525 3300044712 Ga0453684_0315633 Ga0453684_0315633_772_1206 144
526 3300045049 Ga0466959_0102749 Ga0466959_0102749_754_1266 144
527 3300045976 Ga0466967_0199623 Ga0466967_0199623_1072_1506 144
528 3300046539 Ga0495621_0034299 Ga0495621_0034299_409_846 144
529 3300047315 Ga0495581_0393909 Ga0495581_0393909_11_445 144
530 3300047320 Ga0495672_0024295 Ga0495672_0024295_337_786 144
531 3300047320 Ga0495672_0284229 Ga0495672_0284229_191_640 144
532 3300047321 Ga0495676_0078176 Ga0495676_0078176_1313_1747 144
533 3300048907 Ga0496104_1369514 Ga0496104_1369514_54_488 144
534 3300049523 Ga0501300_061766 Ga0501300_061766_77_511 144
535 3300049570 Ga0501033_0072796 Ga0501033_0072796_274_708 144
536 3300049571 Ga0501034_0720378 Ga0501034_0720378_351_785 144
537 3300049571 Ga0501034_0904236 Ga0501034_0904236_198_632 144
538 3300049581 Ga0501047_1025706 Ga0501047_1025706_145_579 144
539 3300049586 Ga0501070_0212762 Ga0501070_0212762_365_802 144
540 3300049651 Ga0501201_010099 Ga0501201_010099_183_719 144
541 3300049652 Ga0501202_080467 Ga0501202_080467_43_477 144
542 3300049665 Ga0501227_026653 Ga0501227_026653_145_681 144
543 3300049673 Ga0501240_118176 Ga0501240_118176_71_505 144
544 3300049680 Ga0501250_004954 Ga0501250_004954_654_1088 144
545 3300049680 Ga0501250_013878 Ga0501250_013878_215_649 144
546 3300049682 Ga0501252_001409 Ga0501252_001409_1568_2104 144
547 3300049686 Ga0501257_207368 Ga0501257_207368_119_553 144
548 3300049688 Ga0501259_004751 Ga0501259_004751_1470_2006 144
549 3300049705 Ga0501225_0100467 Ga0501225_0100467_188_622 144
550 3300049708 Ga0501245_000547 Ga0501245_000547_2322_2858 144
551 3300049763 Ga0501266_005308 Ga0501266_005308_193_729 144
552 3300049765 Ga0501268_010463 Ga0501268_010463_717_1151 144
553 3300049770 Ga0501273_029537 Ga0501273_029537_193_627 144
554 3300049778 Ga0501282_031565 Ga0501282_031565_34_468 144
555 3300049823 Ga0501044_1138731 Ga0501044_1138731_124_558 144
556 3300049823 Ga0501044_1620327 Ga0501044_1620327_60_494 144
557 3300050493 nmdc:mga0k408_432391_c1 nmdc:mga0k408_432391_c1_49_498 144
558 3300050507 nmdc:mga05p37_255658_c1 nmdc:mga05p37_255658_c1_136_573 144
559 3300050508 nmdc:mga09592_531488_c1 nmdc:mga09592_531488_c1_484_921 144
560 3300050508 nmdc:mga09592_996_c1 nmdc:mga09592_996_c1_16328_16819 144
561 3300050509 nmdc:mga0qj67_9805_c1 nmdc:mga0qj67_9805_c1_3233_3724 144
562 3300050510 nmdc:mga06r32_1196595_c1 nmdc:mga06r32_1196595_c1_154_591 144
563 3300050510 nmdc:mga06r32_1387683_c1 nmdc:mga06r32_1387683_c1_13_450 144
564 3300050510 nmdc:mga06r32_64331_c1 nmdc:mga06r32_64331_c1_740_1177 144
565 3300050511 nmdc:mga08y16_101883_c1 nmdc:mga08y16_101883_c1_1012_1452 144
566 3300050511 nmdc:mga08y16_194305_c1 nmdc:mga08y16_194305_c1_46_483 144
567 3300050511 nmdc:mga08y16_783329_c1 nmdc:mga08y16_783329_c1_156_596 144
568 3300050512 nmdc:mga0n895_954761_c1 nmdc:mga0n895_954761_c1_209_643 144
569 3300053129 Ga0500628_060250 Ga0500628_060250_80_529 144

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ibw-assembly1.cif.gz_B crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a 0.6327 18 131
6u9d-assembly2.cif.gz_W-2 saccharomyces cerevisiae acetohydroxyacid synthase 0.6109 18 133
6u9d-assembly2.cif.gz_S-2 saccharomyces cerevisiae acetohydroxyacid synthase 0.6037 17 133
3ibw-assembly1.cif.gz_B crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a 0.6036 18 131
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.5991 18 131
ID Description Score Start End Superfamily
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6443 18 131 3.30.70.920
af_Q2FXU1_650_729_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6098 18 133 3.30.70.260
2jsxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6086 18 131 3.30.70.920
af_P9WHG9_657_737_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6081 18 133 3.30.70.260
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6079 18 131 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A522DE82-F1-model_v4 IPExxxVDY family protein 0.9507 65 144
AF-A0A4Q5R5J3-F1-model_v4 IPExxxVDY family protein 0.9407 1 144
AF-A0A4Q5TIS7-F1-model_v4 IPExxxVDY family protein 0.9396 22 144
AF-A0A522DE82-F1-model_v4 IPExxxVDY family protein 0.9395 65 144
AF-A0A4Q5R5J3-F1-model_v4 IPExxxVDY family protein 0.9344 1 144

Feature Viewer

pLDDT pTM Quality
84.6 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map