F464738
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 208 | 569 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_101713929|Ga0207675_1017139291 |
| Length | 140 |
| Sequence | MSDRNPKLVLDTEKLTDEFFYDSRLLGIMAPVKDYQFCWNLNSTIGLNFRINNDLEIQLTKKKRSYFFTVYEYCEPTRFLSHYVYKNQFDGEYLLPEFKHLDFLWLMKGDEVSDESLQETIQLVLELTNEKIKNKEHLVF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 157 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 161 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 162 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 163 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 164 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 165 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 166 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 167 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 168 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 169 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 170 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 171 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 172 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 173 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 182 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 187 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 188 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 189 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 190 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 191 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 192 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 193 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 194 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 195 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 196 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 197 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 198 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 199 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 0.88 |
| Rhizosphere | 98.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c011568 | 3300000043 | Bacteria | 745 |
| 2 | JGI24751J29686_10030404 | 3300002459 | Bacteria | 1120 |
| 3 | Ga0065704_10390956 | 3300005289 | Bacteria | 756 |
| 4 | Ga0065712_10006450 | 3300005290 | Bacteria | 3475 |
| 5 | Ga0065707_10173646 | 3300005295 | Bacteria | 1466 |
| 6 | Ga0070658_10099518 | 3300005327 | Bacteria | 2402 |
| 7 | Ga0070658_10191348 | 3300005327 | Bacteria | 1724 |
| 8 | Ga0070658_10212501 | 3300005327 | Bacteria | 1634 |
| 9 | Ga0070658_10248127 | 3300005327 | Bacteria | 1510 |
| 10 | Ga0070658_10414876 | 3300005327 | Bacteria | 1157 |
| 11 | Ga0070658_10694432 | 3300005327 | Bacteria | 883 |
| 12 | Ga0070658_10812875 | 3300005327 | Unclassified | 812 |
| 13 | Ga0070683_100296253 | 3300005329 | Bacteria | 1538 |
| 14 | Ga0070683_101072220 | 3300005329 | Bacteria | 774 |
| 15 | Ga0070670_100049006 | 3300005331 | Bacteria | 3634 |
| 16 | Ga0070670_100083450 | 3300005331 | Bacteria | 2745 |
| 17 | Ga0070670_100107240 | 3300005331 | Bacteria | 2407 |
| 18 | Ga0070670_100131111 | 3300005331 | Unclassified | 2164 |
| 19 | Ga0070670_100648856 | 3300005331 | Unclassified | 947 |
| 20 | Ga0070677_10232663 | 3300005333 | Unclassified | 906 |
| 21 | Ga0068869_100024863 | 3300005334 | Bacteria | 4152 |
| 22 | Ga0070680_100009385 | 3300005336 | Bacteria | 7517 |
| 23 | Ga0070680_100031154 | 3300005336 | Bacteria | 4287 |
| 24 | Ga0070680_100039392 | 3300005336 | Bacteria | 3824 |
| 25 | Ga0070680_100081642 | 3300005336 | Bacteria | 2667 |
| 26 | Ga0070680_100204521 | 3300005336 | Bacteria | 1665 |
| 27 | Ga0070682_100357769 | 3300005337 | Bacteria | 1090 |
| 28 | Ga0068868_100039380 | 3300005338 | Unclassified | 3673 |
| 29 | Ga0068868_100620699 | 3300005338 | Bacteria | 960 |
| 30 | Ga0070660_100001935 | 3300005339 | Bacteria | 14274 |
| 31 | Ga0070660_100021641 | 3300005339 | Bacteria | 4745 |
| 32 | Ga0070660_100115862 | 3300005339 | Bacteria | 2136 |
| 33 | Ga0070660_100118855 | 3300005339 | Bacteria | 2108 |
| 34 | Ga0070660_100871534 | 3300005339 | Unclassified | 758 |
| 35 | Ga0070687_100164521 | 3300005343 | Bacteria | 1315 |
| 36 | Ga0070687_100213343 | 3300005343 | Bacteria | 1177 |
| 37 | Ga0070661_100027194 | 3300005344 | Bacteria | 4118 |
| 38 | Ga0070661_100538965 | 3300005344 | Bacteria | 938 |
| 39 | Ga0070692_10141046 | 3300005345 | Unclassified | 1364 |
| 40 | Ga0070692_10249306 | 3300005345 | Bacteria | 1062 |
| 41 | Ga0070668_100814013 | 3300005347 | Bacteria | 830 |
| 42 | Ga0070669_100031912 | 3300005353 | Bacteria | 3805 |
| 43 | Ga0070669_100101392 | 3300005353 | Bacteria | 2172 |
| 44 | Ga0070675_100104298 | 3300005354 | Bacteria | 2392 |
| 45 | Ga0070675_101078991 | 3300005354 | Unclassified | 738 |
| 46 | Ga0070671_100266562 | 3300005355 | Bacteria | 1456 |
| 47 | Ga0070671_100361570 | 3300005355 | Unclassified | 1239 |
| 48 | Ga0070674_100683927 | 3300005356 | Bacteria | 875 |
| 49 | Ga0070673_100074775 | 3300005364 | Bacteria | 2731 |
| 50 | Ga0070673_100607960 | 3300005364 | Bacteria | 998 |
| 51 | Ga0070688_100249801 | 3300005365 | Unclassified | 1262 |
| 52 | Ga0070659_100001791 | 3300005366 | Bacteria | 15465 |
| 53 | Ga0070659_100035067 | 3300005366 | Bacteria | 3904 |
| 54 | Ga0070659_100053397 | 3300005366 | Bacteria | 3180 |
| 55 | Ga0070659_100156709 | 3300005366 | Bacteria | 1860 |
| 56 | Ga0070659_100926344 | 3300005366 | Unclassified | 762 |
| 57 | Ga0070714_100528889 | 3300005435 | Unclassified | 1127 |
| 58 | Ga0070705_100241081 | 3300005440 | Unclassified | 1263 |
| 59 | Ga0070663_100856225 | 3300005455 | Bacteria | 783 |
| 60 | Ga0070678_100822354 | 3300005456 | Bacteria | 845 |
| 61 | Ga0070678_101293502 | 3300005456 | Unclassified | 678 |
| 62 | Ga0070681_10018161 | 3300005458 | Bacteria | 7031 |
| 63 | Ga0070681_10157488 | 3300005458 | Bacteria | 2195 |
| 64 | Ga0070681_10349581 | 3300005458 | Bacteria | 1389 |
| 65 | Ga0070681_10588485 | 3300005458 | Bacteria | 1027 |
| 66 | Ga0070681_11374123 | 3300005458 | Bacteria | 630 |
| 67 | Ga0068867_100581512 | 3300005459 | Bacteria | 974 |
| 68 | Ga0070685_10406834 | 3300005466 | Bacteria | 944 |
| 69 | Ga0070685_10524724 | 3300005466 | Bacteria | 841 |
| 70 | Ga0070685_10886459 | 3300005466 | Bacteria | 663 |
| 71 | Ga0070707_100779394 | 3300005468 | Bacteria | 920 |
| 72 | Ga0070698_100000282 | 3300005471 | Bacteria | 51827 |
| 73 | Ga0070698_100004896 | 3300005471 | Bacteria | 14697 |
| 74 | Ga0070699_100120659 | 3300005518 | Bacteria | 2305 |
| 75 | Ga0070679_100000065 | 3300005530 | Bacteria | 78829 |
| 76 | Ga0070679_100063296 | 3300005530 | Unclassified | 3687 |
| 77 | Ga0070679_100075450 | 3300005530 | Bacteria | 3361 |
| 78 | Ga0070679_100130669 | 3300005530 | Bacteria | 2493 |
| 79 | Ga0070679_100447673 | 3300005530 | Bacteria | 1236 |
| 80 | Ga0070679_100937160 | 3300005530 | Unclassified | 809 |
| 81 | Ga0070679_101208181 | 3300005530 | Bacteria | 701 |
| 82 | Ga0070684_100000793 | 3300005535 | Bacteria | 21959 |
| 83 | Ga0068853_100016566 | 3300005539 | Bacteria | 6070 |
| 84 | Ga0068853_100024373 | 3300005539 | Bacteria | 5072 |
| 85 | Ga0068853_100047906 | 3300005539 | Bacteria | 3669 |
| 86 | Ga0068853_100094190 | 3300005539 | Bacteria | 2638 |
| 87 | Ga0068853_100196313 | 3300005539 | Bacteria | 1836 |
| 88 | Ga0068853_100981828 | 3300005539 | Bacteria | 813 |
| 89 | Ga0068853_101131974 | 3300005539 | Unclassified | 755 |
| 90 | Ga0068853_102180465 | 3300005539 | Bacteria | 537 |
| 91 | Ga0068853_102199387 | 3300005539 | Unclassified | 535 |
| 92 | Ga0070686_100197361 | 3300005544 | Bacteria | 1440 |
| 93 | Ga0070686_101514478 | 3300005544 | Unclassified | 566 |
| 94 | Ga0070696_100092277 | 3300005546 | Bacteria | 2158 |
| 95 | Ga0070696_100698733 | 3300005546 | Bacteria | 827 |
| 96 | Ga0070665_100362186 | 3300005548 | Bacteria | 1456 |
| 97 | Ga0070704_100555263 | 3300005549 | Bacteria | 1004 |
| 98 | Ga0068855_100000189 | 3300005563 | Bacteria | 79227 |
| 99 | Ga0068855_100001235 | 3300005563 | Bacteria | 31705 |
| 100 | Ga0068855_100345673 | 3300005563 | Bacteria | 1639 |
| 101 | Ga0068855_100346249 | 3300005563 | Bacteria | 1638 |
| 102 | Ga0068855_100585614 | 3300005563 | Bacteria | 1205 |
| 103 | Ga0068855_100622397 | 3300005563 | Bacteria | 1162 |
| 104 | Ga0068855_100716470 | 3300005563 | Unclassified | 1069 |
| 105 | Ga0068855_101080551 | 3300005563 | Unclassified | 840 |
| 106 | Ga0068855_101174495 | 3300005563 | Bacteria | 799 |
| 107 | Ga0070664_100152412 | 3300005564 | Bacteria | 2041 |
| 108 | Ga0070664_100361485 | 3300005564 | Unclassified | 1322 |
| 109 | Ga0070664_100463984 | 3300005564 | Unclassified | 1164 |
| 110 | Ga0070664_100722394 | 3300005564 | Unclassified | 929 |
| 111 | Ga0070664_100870843 | 3300005564 | Bacteria | 844 |
| 112 | Ga0068857_100022671 | 3300005577 | Bacteria | 5524 |
| 113 | Ga0068857_100098119 | 3300005577 | Bacteria | 2627 |
| 114 | Ga0068854_100095888 | 3300005578 | Bacteria | 2215 |
| 115 | Ga0068854_100132123 | 3300005578 | Bacteria | 1907 |
| 116 | Ga0068854_100183731 | 3300005578 | Bacteria | 1635 |
| 117 | Ga0068856_100022167 | 3300005614 | Bacteria | 6175 |
| 118 | Ga0068856_100063993 | 3300005614 | Bacteria | 3634 |
| 119 | Ga0068852_100002826 | 3300005616 | Bacteria | 12036 |
| 120 | Ga0068852_100020117 | 3300005616 | Bacteria | 5302 |
| 121 | Ga0068852_100030254 | 3300005616 | Bacteria | 4455 |
| 122 | Ga0068852_100047642 | 3300005616 | Bacteria | 3657 |
| 123 | Ga0068852_100253017 | 3300005616 | Bacteria | 1688 |
| 124 | Ga0068852_100824713 | 3300005616 | Bacteria | 942 |
| 125 | Ga0068852_101109875 | 3300005616 | Bacteria | 811 |
| 126 | Ga0068852_101467786 | 3300005616 | Bacteria | 704 |
| 127 | Ga0068852_102023086 | 3300005616 | Bacteria | 598 |
| 128 | Ga0068852_102689474 | 3300005616 | Unclassified | 517 |
| 129 | Ga0068859_100065142 | 3300005617 | Bacteria | 3678 |
| 130 | Ga0068859_100090394 | 3300005617 | Unclassified | 3113 |
| 131 | Ga0068859_100276220 | 3300005617 | Bacteria | 1773 |
| 132 | Ga0068859_100312158 | 3300005617 | Bacteria | 1666 |
| 133 | Ga0068859_100382481 | 3300005617 | Bacteria | 1503 |
| 134 | Ga0068859_100617796 | 3300005617 | Bacteria | 1176 |
| 135 | Ga0068859_100781245 | 3300005617 | Unclassified | 1043 |
| 136 | Ga0068864_100035197 | 3300005618 | Bacteria | 4263 |
| 137 | Ga0068864_100123836 | 3300005618 | Unclassified | 2314 |
| 138 | Ga0068864_100357915 | 3300005618 | Bacteria | 1379 |
| 139 | Ga0068861_100004473 | 3300005719 | Bacteria | 9382 |
| 140 | Ga0068861_100303297 | 3300005719 | Bacteria | 1384 |
| 141 | Ga0068861_102410844 | 3300005719 | Bacteria | 529 |
| 142 | Ga0068851_10012642 | 3300005834 | Bacteria | 3983 |
| 143 | Ga0068851_10101705 | 3300005834 | Unclassified | 1526 |
| 144 | Ga0068851_10106657 | 3300005834 | Unclassified | 1492 |
| 145 | Ga0068851_10555620 | 3300005834 | Bacteria | 694 |
| 146 | Ga0068851_10959381 | 3300005834 | Unclassified | 538 |
| 147 | Ga0068870_10758166 | 3300005840 | Bacteria | 674 |
| 148 | Ga0068863_100029142 | 3300005841 | Bacteria | 5270 |
| 149 | Ga0068863_100038534 | 3300005841 | Bacteria | 4547 |
| 150 | Ga0068863_100258808 | 3300005841 | Bacteria | 1682 |
| 151 | Ga0068863_100619655 | 3300005841 | Unclassified | 1072 |
| 152 | Ga0068863_100891301 | 3300005841 | Bacteria | 890 |
| 153 | Ga0068858_100388364 | 3300005842 | Bacteria | 1340 |
| 154 | Ga0068860_100013488 | 3300005843 | Bacteria | 8014 |
| 155 | Ga0068860_100479507 | 3300005843 | Bacteria | 1240 |
| 156 | Ga0068860_100516751 | 3300005843 | Bacteria | 1194 |
| 157 | Ga0068860_101000708 | 3300005843 | Unclassified | 854 |
| 158 | Ga0068862_100245586 | 3300005844 | Bacteria | 1629 |
| 159 | Ga0068862_100584045 | 3300005844 | Bacteria | 1071 |
| 160 | Ga0097621_100014286 | 3300006237 | Bacteria | 5938 |
| 161 | Ga0097621_100243572 | 3300006237 | Bacteria | 1572 |
| 162 | Ga0068871_100804610 | 3300006358 | Bacteria | 866 |
| 163 | Ga0068871_100861015 | 3300006358 | Bacteria | 838 |
| 164 | Ga0075428_100014821 | 3300006844 | Bacteria | 8663 |
| 165 | Ga0075428_100048180 | 3300006844 | Bacteria | 4678 |
| 166 | Ga0075428_100132746 | 3300006844 | Bacteria | 2708 |
| 167 | Ga0075428_101817476 | 3300006844 | Bacteria | 634 |
| 168 | Ga0075430_100001793 | 3300006846 | Bacteria | 17561 |
| 169 | Ga0075431_100031975 | 3300006847 | Bacteria | 5422 |
| 170 | Ga0075431_100908330 | 3300006847 | Bacteria | 850 |
| 171 | Ga0075431_101294479 | 3300006847 | Bacteria | 690 |
| 172 | Ga0075429_100000136 | 3300006880 | Bacteria | 44169 |
| 173 | Ga0075429_100589406 | 3300006880 | Bacteria | 974 |
| 174 | Ga0097620_100062773 | 3300006931 | Bacteria | 3745 |
| 175 | Ga0097620_100065142 | 3300006931 | Bacteria | 3678 |
| 176 | Ga0097620_100090395 | 3300006931 | Unclassified | 3113 |
| 177 | Ga0097620_100276205 | 3300006931 | Bacteria | 1773 |
| 178 | Ga0097620_100312157 | 3300006931 | Bacteria | 1666 |
| 179 | Ga0097620_100382492 | 3300006931 | Bacteria | 1503 |
| 180 | Ga0097620_100617801 | 3300006931 | Bacteria | 1176 |
| 181 | Ga0097620_100781049 | 3300006931 | Unclassified | 1043 |
| 182 | Ga0105240_10294577 | 3300009093 | Bacteria | 1859 |
| 183 | Ga0111539_10118607 | 3300009094 | Bacteria | 3101 |
| 184 | Ga0111539_10120160 | 3300009094 | Bacteria | 3079 |
| 185 | Ga0111539_12080550 | 3300009094 | Unclassified | 658 |
| 186 | Ga0105247_10136885 | 3300009101 | Bacteria | 1601 |
| 187 | Ga0114129_12026737 | 3300009147 | Bacteria | 695 |
| 188 | Ga0105243_10621789 | 3300009148 | Bacteria | 1043 |
| 189 | Ga0105243_11457419 | 3300009148 | Bacteria | 707 |
| 190 | Ga0105241_10021632 | 3300009174 | Unclassified | 4757 |
| 191 | Ga0105242_10007396 | 3300009176 | Bacteria | 8457 |
| 192 | Ga0105242_10197772 | 3300009176 | Unclassified | 1784 |
| 193 | Ga0105242_10358502 | 3300009176 | Unclassified | 1349 |
| 194 | Ga0105242_11761951 | 3300009176 | Bacteria | 657 |
| 195 | Ga0105248_11335531 | 3300009177 | Bacteria | 811 |
| 196 | Ga0105237_10108498 | 3300009545 | Bacteria | 2767 |
| 197 | Ga0105237_10571112 | 3300009545 | Unclassified | 1138 |
| 198 | Ga0105249_10001213 | 3300009553 | Bacteria | 22729 |
| 199 | Ga0105249_10001789 | 3300009553 | Bacteria | 18712 |
| 200 | Ga0105249_10164540 | 3300009553 | Bacteria | 2146 |
| 201 | Ga0105249_10168015 | 3300009553 | Bacteria | 2125 |
| 202 | Ga0105249_11916919 | 3300009553 | Bacteria | 665 |
| 203 | Ga0105249_12466618 | 3300009553 | Bacteria | 592 |
| 204 | Ga0105249_12679515 | 3300009553 | Bacteria | 571 |
| 205 | Ga0105239_10038971 | 3300010375 | Bacteria | 5205 |
| 206 | Ga0105246_10375027 | 3300011119 | Bacteria | 1174 |
| 207 | Ga0157373_10001339 | 3300013100 | Bacteria | 18861 |
| 208 | Ga0157373_10035077 | 3300013100 | Unclassified | 3603 |
| 209 | Ga0157373_10043440 | 3300013100 | Bacteria | 3210 |
| 210 | Ga0157373_10048599 | 3300013100 | Bacteria | 3024 |
| 211 | Ga0157373_10379302 | 3300013100 | Bacteria | 1011 |
| 212 | Ga0157373_10387725 | 3300013100 | Unclassified | 1000 |
| 213 | Ga0157373_10617003 | 3300013100 | Bacteria | 790 |
| 214 | Ga0157371_10000326 | 3300013102 | Bacteria | 61810 |
| 215 | Ga0157371_10003758 | 3300013102 | Bacteria | 13588 |
| 216 | Ga0157371_10004714 | 3300013102 | Bacteria | 11787 |
| 217 | Ga0157371_10004797 | 3300013102 | Bacteria | 11645 |
| 218 | Ga0157371_10010426 | 3300013102 | Bacteria | 7239 |
| 219 | Ga0157371_10016890 | 3300013102 | Bacteria | 5434 |
| 220 | Ga0157371_10032682 | 3300013102 | Bacteria | 3743 |
| 221 | Ga0157371_10038313 | 3300013102 | Bacteria | 3430 |
| 222 | Ga0157371_10039550 | 3300013102 | Bacteria | 3372 |
| 223 | Ga0157371_10140511 | 3300013102 | Unclassified | 1720 |
| 224 | Ga0157371_10209806 | 3300013102 | Bacteria | 1397 |
| 225 | Ga0157371_10212440 | 3300013102 | Bacteria | 1389 |
| 226 | Ga0157371_10253519 | 3300013102 | Bacteria | 1267 |
| 227 | Ga0157371_10266039 | 3300013102 | Bacteria | 1237 |
| 228 | Ga0157371_10300213 | 3300013102 | Unclassified | 1162 |
| 229 | Ga0157371_10377573 | 3300013102 | Bacteria | 1035 |
| 230 | Ga0157370_10003774 | 3300013104 | Bacteria | 17678 |
| 231 | Ga0157370_10007491 | 3300013104 | Bacteria | 11857 |
| 232 | Ga0157370_10056533 | 3300013104 | Bacteria | 3734 |
| 233 | Ga0157370_10092662 | 3300013104 | Bacteria | 2836 |
| 234 | Ga0157370_10120438 | 3300013104 | Bacteria | 2450 |
| 235 | Ga0157370_10164225 | 3300013104 | Bacteria | 2066 |
| 236 | Ga0157370_10193227 | 3300013104 | Bacteria | 1889 |
| 237 | Ga0157370_10307372 | 3300013104 | Bacteria | 1463 |
| 238 | Ga0157370_10403959 | 3300013104 | Bacteria | 1257 |
| 239 | Ga0157370_10752516 | 3300013104 | Bacteria | 888 |
| 240 | Ga0157369_10042466 | 3300013105 | Bacteria | 4960 |
| 241 | Ga0157369_10090879 | 3300013105 | Bacteria | 3259 |
| 242 | Ga0157369_10248419 | 3300013105 | Bacteria | 1857 |
| 243 | Ga0157369_10272481 | 3300013105 | Bacteria | 1763 |
| 244 | Ga0157369_10363334 | 3300013105 | Bacteria | 1503 |
| 245 | Ga0157369_10372401 | 3300013105 | Bacteria | 1483 |
| 246 | Ga0157369_10487553 | 3300013105 | Bacteria | 1275 |
| 247 | Ga0157369_10702940 | 3300013105 | Bacteria | 1041 |
| 248 | Ga0157369_10761062 | 3300013105 | Bacteria | 996 |
| 249 | Ga0157369_10986183 | 3300013105 | Bacteria | 863 |
| 250 | Ga0157374_10848542 | 3300013296 | Unclassified | 930 |
| 251 | Ga0157378_10029228 | 3300013297 | Bacteria | 4865 |
| 252 | Ga0157378_10461065 | 3300013297 | Bacteria | 1263 |
| 253 | Ga0157378_10603524 | 3300013297 | Bacteria | 1109 |
| 254 | Ga0157378_10637902 | 3300013297 | Unclassified | 1080 |
| 255 | Ga0157378_10745324 | 3300013297 | Bacteria | 1002 |
| 256 | Ga0157378_11935647 | 3300013297 | Unclassified | 639 |
| 257 | Ga0157378_12463009 | 3300013297 | Unclassified | 572 |
| 258 | Ga0163162_10025727 | 3300013306 | Bacteria | 5819 |
| 259 | Ga0163162_10079613 | 3300013306 | Bacteria | 3343 |
| 260 | Ga0163162_10437185 | 3300013306 | Unclassified | 1440 |
| 261 | Ga0163162_10809341 | 3300013306 | Bacteria | 1054 |
| 262 | Ga0163162_11929064 | 3300013306 | Unclassified | 676 |
| 263 | Ga0157372_10003572 | 3300013307 | Bacteria | 16736 |
| 264 | Ga0157372_10004470 | 3300013307 | Bacteria | 14921 |
| 265 | Ga0157372_10010326 | 3300013307 | Bacteria | 9922 |
| 266 | Ga0157372_10015473 | 3300013307 | Bacteria | 8177 |
| 267 | Ga0157372_10029328 | 3300013307 | Bacteria | 6006 |
| 268 | Ga0157372_10040641 | 3300013307 | Bacteria | 5138 |
| 269 | Ga0157372_10055092 | 3300013307 | Bacteria | 4439 |
| 270 | Ga0157372_10074037 | 3300013307 | Bacteria | 3840 |
| 271 | Ga0157372_10082966 | 3300013307 | Bacteria | 3630 |
| 272 | Ga0157372_10151244 | 3300013307 | Bacteria | 2679 |
| 273 | Ga0157372_10183170 | 3300013307 | Bacteria | 2425 |
| 274 | Ga0157372_10185925 | 3300013307 | Bacteria | 2406 |
| 275 | Ga0157372_10192017 | 3300013307 | Bacteria | 2365 |
| 276 | Ga0157372_10356446 | 3300013307 | Unclassified | 1704 |
| 277 | Ga0157372_10403898 | 3300013307 | Bacteria | 1592 |
| 278 | Ga0157372_10533852 | 3300013307 | Bacteria | 1367 |
| 279 | Ga0157372_10791761 | 3300013307 | Bacteria | 1102 |
| 280 | Ga0157372_10889854 | 3300013307 | Bacteria | 1033 |
| 281 | Ga0157372_10944221 | 3300013307 | Bacteria | 1000 |
| 282 | Ga0157372_11193112 | 3300013307 | Bacteria | 880 |
| 283 | Ga0157372_11246250 | 3300013307 | Bacteria | 859 |
| 284 | Ga0157372_11615305 | 3300013307 | Unclassified | 746 |
| 285 | Ga0157372_12035599 | 3300013307 | Unclassified | 660 |
| 286 | Ga0157372_12273695 | 3300013307 | Bacteria | 623 |
| 287 | Ga0157375_10496111 | 3300013308 | Bacteria | 1385 |
| 288 | Ga0157375_10555888 | 3300013308 | Bacteria | 1309 |
| 289 | Ga0157375_10757597 | 3300013308 | Unclassified | 1122 |
| 290 | Ga0157375_11126062 | 3300013308 | Bacteria | 919 |
| 291 | Ga0157375_12550438 | 3300013308 | Bacteria | 611 |
| 292 | Ga0163163_10014847 | 3300014325 | Bacteria | 7175 |
| 293 | Ga0163163_10054518 | 3300014325 | Bacteria | 3950 |
| 294 | Ga0163163_10289720 | 3300014325 | Bacteria | 1689 |
| 295 | Ga0163163_10587713 | 3300014325 | Unclassified | 1177 |
| 296 | Ga0163163_11369979 | 3300014325 | Bacteria | 769 |
| 297 | Ga0157380_10309721 | 3300014326 | Unclassified | 1459 |
| 298 | Ga0157380_10799381 | 3300014326 | Bacteria | 960 |
| 299 | Ga0157380_11328459 | 3300014326 | Bacteria | 767 |
| 300 | Ga0157377_10014841 | 3300014745 | Bacteria | 3973 |
| 301 | Ga0157377_10398320 | 3300014745 | Unclassified | 937 |
| 302 | Ga0157377_10578622 | 3300014745 | Bacteria | 798 |
| 303 | Ga0157377_10865062 | 3300014745 | Bacteria | 672 |
| 304 | Ga0157379_10203428 | 3300014968 | Bacteria | 1791 |
| 305 | Ga0157379_10212274 | 3300014968 | Bacteria | 1752 |
| 306 | Ga0157379_10257223 | 3300014968 | Bacteria | 1586 |
| 307 | Ga0157376_10018476 | 3300014969 | Bacteria | 5347 |
| 308 | Ga0157376_10052998 | 3300014969 | Unclassified | 3376 |
| 309 | Ga0157376_10218135 | 3300014969 | Unclassified | 1765 |
| 310 | Ga0163161_10041693 | 3300017792 | Bacteria | 3299 |
| 311 | Ga0163161_10123891 | 3300017792 | Bacteria | 1944 |
| 312 | Ga0163161_10153391 | 3300017792 | Unclassified | 1752 |
| 313 | Ga0163161_10242298 | 3300017792 | Bacteria | 1403 |
| 314 | Ga0163161_10633452 | 3300017792 | Bacteria | 885 |
| 315 | Ga0207656_10024735 | 3300025321 | Bacteria | 2431 |
| 316 | Ga0207656_10331771 | 3300025321 | Bacteria | 757 |
| 317 | Ga0207682_10251077 | 3300025893 | Bacteria | 823 |
| 318 | Ga0207710_10093233 | 3300025900 | Bacteria | 1412 |
| 319 | Ga0207647_10000794 | 3300025904 | Bacteria | 24490 |
| 320 | Ga0207647_10215361 | 3300025904 | Unclassified | 1108 |
| 321 | Ga0207643_10094634 | 3300025908 | Unclassified | 1745 |
| 322 | Ga0207643_10326702 | 3300025908 | Bacteria | 959 |
| 323 | Ga0207705_10018694 | 3300025909 | Bacteria | 4958 |
| 324 | Ga0207705_10033790 | 3300025909 | Bacteria | 3655 |
| 325 | Ga0207705_10034314 | 3300025909 | Bacteria | 3627 |
| 326 | Ga0207705_10145824 | 3300025909 | Bacteria | 1771 |
| 327 | Ga0207705_10260844 | 3300025909 | Bacteria | 1323 |
| 328 | Ga0207705_10555070 | 3300025909 | Bacteria | 893 |
| 329 | Ga0207705_11218757 | 3300025909 | Bacteria | 577 |
| 330 | Ga0207654_10831810 | 3300025911 | Bacteria | 668 |
| 331 | Ga0207707_10028000 | 3300025912 | Bacteria | 4926 |
| 332 | Ga0207707_10054406 | 3300025912 | Bacteria | 3484 |
| 333 | Ga0207707_10156587 | 3300025912 | Unclassified | 1993 |
| 334 | Ga0207707_10434401 | 3300025912 | Bacteria | 1124 |
| 335 | Ga0207707_10497331 | 3300025912 | Unclassified | 1040 |
| 336 | Ga0207695_10029182 | 3300025913 | Bacteria | 6102 |
| 337 | Ga0207695_10208817 | 3300025913 | Bacteria | 1864 |
| 338 | Ga0207671_10140689 | 3300025914 | Bacteria | 1859 |
| 339 | Ga0207671_10730316 | 3300025914 | Unclassified | 787 |
| 340 | Ga0207660_10048222 | 3300025917 | Bacteria | 3014 |
| 341 | Ga0207660_10052547 | 3300025917 | Bacteria | 2901 |
| 342 | Ga0207660_10202750 | 3300025917 | Bacteria | 1550 |
| 343 | Ga0207660_10224626 | 3300025917 | Bacteria | 1475 |
| 344 | Ga0207662_10155573 | 3300025918 | Bacteria | 1457 |
| 345 | Ga0207662_10271326 | 3300025918 | Bacteria | 1120 |
| 346 | Ga0207657_10004092 | 3300025919 | Bacteria | 15482 |
| 347 | Ga0207657_10059125 | 3300025919 | Bacteria | 3296 |
| 348 | Ga0207657_10080133 | 3300025919 | Bacteria | 2745 |
| 349 | Ga0207657_10102550 | 3300025919 | Unclassified | 2373 |
| 350 | Ga0207649_10018781 | 3300025920 | Bacteria | 3940 |
| 351 | Ga0207652_10000013 | 3300025921 | Bacteria | 222247 |
| 352 | Ga0207652_10000035 | 3300025921 | Bacteria | 138263 |
| 353 | Ga0207652_10005883 | 3300025921 | Bacteria | 9926 |
| 354 | Ga0207652_10090171 | 3300025921 | Bacteria | 2693 |
| 355 | Ga0207652_10121421 | 3300025921 | Bacteria | 2325 |
| 356 | Ga0207652_10164230 | 3300025921 | Bacteria | 1991 |
| 357 | Ga0207681_10181261 | 3300025923 | Bacteria | 1604 |
| 358 | Ga0207650_10002238 | 3300025925 | Bacteria | 13508 |
| 359 | Ga0207650_10154762 | 3300025925 | Bacteria | 1812 |
| 360 | Ga0207650_10170261 | 3300025925 | Bacteria | 1730 |
| 361 | Ga0207650_10589888 | 3300025925 | Bacteria | 934 |
| 362 | Ga0207650_11541732 | 3300025925 | Bacteria | 564 |
| 363 | Ga0207659_10034673 | 3300025926 | Bacteria | 3482 |
| 364 | Ga0207659_10526338 | 3300025926 | Bacteria | 1003 |
| 365 | Ga0207644_10168473 | 3300025931 | Bacteria | 1708 |
| 366 | Ga0207644_10253780 | 3300025931 | Bacteria | 1404 |
| 367 | Ga0207690_10009384 | 3300025932 | Bacteria | 5811 |
| 368 | Ga0207690_10053726 | 3300025932 | Bacteria | 2705 |
| 369 | Ga0207690_10132347 | 3300025932 | Bacteria | 1827 |
| 370 | Ga0207690_10260084 | 3300025932 | Unclassified | 1344 |
| 371 | Ga0207690_10440370 | 3300025932 | Unclassified | 1046 |
| 372 | Ga0207686_10000709 | 3300025934 | Bacteria | 20683 |
| 373 | Ga0207709_10147068 | 3300025935 | Bacteria | 1627 |
| 374 | Ga0207670_10945769 | 3300025936 | Bacteria | 723 |
| 375 | Ga0207669_11247159 | 3300025937 | Bacteria | 631 |
| 376 | Ga0207691_10134620 | 3300025940 | Unclassified | 2181 |
| 377 | Ga0207691_10488652 | 3300025940 | Bacteria | 1046 |
| 378 | Ga0207689_10034122 | 3300025942 | Bacteria | 4226 |
| 379 | Ga0207689_10155124 | 3300025942 | Bacteria | 1887 |
| 380 | Ga0207689_10246872 | 3300025942 | Unclassified | 1476 |
| 381 | Ga0207661_10086982 | 3300025944 | Bacteria | 2594 |
| 382 | Ga0207661_10187673 | 3300025944 | Unclassified | 1811 |
| 383 | Ga0207661_10933568 | 3300025944 | Bacteria | 799 |
| 384 | Ga0207661_10987944 | 3300025944 | Bacteria | 775 |
| 385 | Ga0207661_11622894 | 3300025944 | Bacteria | 591 |
| 386 | Ga0207679_10048577 | 3300025945 | Bacteria | 3090 |
| 387 | Ga0207679_10179004 | 3300025945 | Bacteria | 1752 |
| 388 | Ga0207679_10814154 | 3300025945 | Bacteria | 852 |
| 389 | Ga0207667_10002703 | 3300025949 | Bacteria | 21943 |
| 390 | Ga0207667_10031804 | 3300025949 | Bacteria | 5693 |
| 391 | Ga0207667_10051249 | 3300025949 | Bacteria | 4352 |
| 392 | Ga0207667_10117582 | 3300025949 | Bacteria | 2740 |
| 393 | Ga0207667_10189696 | 3300025949 | Bacteria | 2109 |
| 394 | Ga0207667_10925665 | 3300025949 | Bacteria | 862 |
| 395 | Ga0207651_10033206 | 3300025960 | Bacteria | 3326 |
| 396 | Ga0207651_10673980 | 3300025960 | Bacteria | 909 |
| 397 | Ga0207651_11230088 | 3300025960 | Unclassified | 673 |
| 398 | Ga0207712_10001032 | 3300025961 | Bacteria | 19728 |
| 399 | Ga0207712_10130810 | 3300025961 | Unclassified | 1912 |
| 400 | Ga0207712_11242735 | 3300025961 | Bacteria | 665 |
| 401 | Ga0207640_10046443 | 3300025981 | Bacteria | 2794 |
| 402 | Ga0207640_10120011 | 3300025981 | Bacteria | 1881 |
| 403 | Ga0207640_10158151 | 3300025981 | Unclassified | 1673 |
| 404 | Ga0207640_10893714 | 3300025981 | Bacteria | 775 |
| 405 | Ga0207677_10097653 | 3300026023 | Bacteria | 2153 |
| 406 | Ga0207639_10027480 | 3300026041 | Bacteria | 4146 |
| 407 | Ga0207639_10082827 | 3300026041 | Unclassified | 2544 |
| 408 | Ga0207639_10273809 | 3300026041 | Unclassified | 1482 |
| 409 | Ga0207639_10538421 | 3300026041 | Bacteria | 1071 |
| 410 | Ga0207639_10942659 | 3300026041 | Bacteria | 807 |
| 411 | Ga0207639_11366981 | 3300026041 | Bacteria | 665 |
| 412 | Ga0207639_11860959 | 3300026041 | Bacteria | 563 |
| 413 | Ga0207708_10179244 | 3300026075 | Unclassified | 1682 |
| 414 | Ga0207702_10055653 | 3300026078 | Bacteria | 3355 |
| 415 | Ga0207702_10948282 | 3300026078 | Bacteria | 853 |
| 416 | Ga0207702_10957846 | 3300026078 | Bacteria | 849 |
| 417 | Ga0207641_10001063 | 3300026088 | Bacteria | 27692 |
| 418 | Ga0207641_10020932 | 3300026088 | Bacteria | 5376 |
| 419 | Ga0207641_10296292 | 3300026088 | Bacteria | 1526 |
| 420 | Ga0207641_10418048 | 3300026088 | Unclassified | 1290 |
| 421 | Ga0207641_10771418 | 3300026088 | Bacteria | 950 |
| 422 | Ga0207641_10830163 | 3300026088 | Bacteria | 915 |
| 423 | Ga0207648_10140172 | 3300026089 | Bacteria | 2131 |
| 424 | Ga0207648_10243328 | 3300026089 | Unclassified | 1602 |
| 425 | Ga0207648_10253113 | 3300026089 | Bacteria | 1570 |
| 426 | Ga0207648_11310616 | 3300026089 | Bacteria | 680 |
| 427 | Ga0207676_10093751 | 3300026095 | Bacteria | 2472 |
| 428 | Ga0207676_10280597 | 3300026095 | Unclassified | 1512 |
| 429 | Ga0207676_10302695 | 3300026095 | Bacteria | 1460 |
| 430 | Ga0207674_10063984 | 3300026116 | Bacteria | 3711 |
| 431 | Ga0207674_10206841 | 3300026116 | Unclassified | 1912 |
| 432 | Ga0207674_10241127 | 3300026116 | Bacteria | 1755 |
| 433 | Ga0207674_10381852 | 3300026116 | Bacteria | 1362 |
| 434 | Ga0207674_11759691 | 3300026116 | Bacteria | 587 |
| 435 | Ga0207675_100005394 | 3300026118 | Bacteria | 12252 |
| 436 | Ga0207675_100791072 | 3300026118 | Bacteria | 961 |
| 437 | Ga0207675_100824289 | 3300026118 | Unclassified | 942 |
| 438 | Ga0207675_101713929 | 3300026118 | Bacteria | 648 |
| 439 | Ga0207683_10282275 | 3300026121 | Bacteria | 1517 |
| 440 | Ga0207683_11770699 | 3300026121 | Unclassified | 567 |
| 441 | Ga0207698_10005633 | 3300026142 | Bacteria | 7752 |
| 442 | Ga0207698_10019044 | 3300026142 | Bacteria | 4690 |
| 443 | Ga0207698_10150853 | 3300026142 | Bacteria | 2017 |
| 444 | Ga0207698_10413026 | 3300026142 | Bacteria | 1293 |
| 445 | Ga0207698_10976008 | 3300026142 | Unclassified | 857 |
| 446 | Ga0207698_11200907 | 3300026142 | Bacteria | 772 |
| 447 | Ga0210000_1082064 | 3300027462 | Unclassified | 529 |
| 448 | Ga0209995_1060740 | 3300027471 | Bacteria | 644 |
| 449 | Ga0209974_10018336 | 3300027876 | Unclassified | 2322 |
| 450 | Ga0207428_10438323 | 3300027907 | Bacteria | 953 |
| 451 | Ga0268266_10330619 | 3300028379 | Bacteria | 1428 |
| 452 | Ga0268265_10055836 | 3300028380 | Bacteria | 3002 |
| 453 | Ga0268265_10586893 | 3300028380 | Bacteria | 1063 |
| 454 | Ga0268265_10675746 | 3300028380 | Bacteria | 995 |
| 455 | Ga0268265_10813085 | 3300028380 | Bacteria | 912 |
| 456 | Ga0268264_10008032 | 3300028381 | Bacteria | 8776 |
| 457 | Ga0268264_10633133 | 3300028381 | Unclassified | 1057 |
| 458 | Ga0268264_11330986 | 3300028381 | Bacteria | 728 |
| 459 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 460 | Ga0307405_10462138 | 3300031731 | Bacteria | 1009 |
| 461 | Ga0307410_11109920 | 3300031852 | Bacteria | 686 |
| 462 | Ga0307410_11944820 | 3300031852 | Unclassified | 524 |
| 463 | Ga0307407_10232499 | 3300031903 | Bacteria | 1253 |
| 464 | Ga0307416_100420738 | 3300032002 | Bacteria | 1380 |
| 465 | Ga0307414_10033768 | 3300032004 | Bacteria | 3385 |
| 466 | Ga0307414_10521056 | 3300032004 | Bacteria | 1055 |
| 467 | Ga0307414_10891633 | 3300032004 | Bacteria | 815 |
| 468 | Ga0307414_12034440 | 3300032004 | Bacteria | 536 |
| 469 | Ga0307411_10758063 | 3300032005 | Bacteria | 851 |
| 470 | Ga0307415_100107217 | 3300032126 | Bacteria | 2064 |
| 471 | Ga0373944_0082765 | 3300035089 | Bacteria | 1062 |
| 472 | Ga0395899_0001073 | 3300037312 | Bacteria | 24679 |
| 473 | Ga0395899_0019583 | 3300037312 | Bacteria | 5139 |
| 474 | Ga0395899_0032073 | 3300037312 | Bacteria | 3946 |
| 475 | Ga0395899_0040164 | 3300037312 | Bacteria | 3499 |
| 476 | Ga0395899_0058033 | 3300037312 | Bacteria | 2855 |
| 477 | Ga0395899_0084451 | 3300037312 | Bacteria | 2308 |
| 478 | Ga0395899_0094263 | 3300037312 | Bacteria | 2166 |
| 479 | Ga0395900_0010637 | 3300037418 | Bacteria | 9409 |
| 480 | Ga0395900_0022979 | 3300037418 | Bacteria | 6381 |
| 481 | Ga0395900_0029293 | 3300037418 | Bacteria | 5648 |
| 482 | Ga0395900_0037380 | 3300037418 | Bacteria | 5006 |
| 483 | Ga0395900_0039345 | 3300037418 | Bacteria | 4872 |
| 484 | Ga0395900_0060587 | 3300037418 | Bacteria | 3894 |
| 485 | Ga0395900_0073817 | 3300037418 | Bacteria | 3507 |
| 486 | Ga0395900_0167963 | 3300037418 | Bacteria | 2235 |
| 487 | Ga0395898_0001155 | 3300037466 | Bacteria | 40306 |
| 488 | Ga0395898_0021921 | 3300037466 | Bacteria | 6471 |
| 489 | Ga0395898_0030751 | 3300037466 | Bacteria | 5371 |
| 490 | Ga0395898_0101190 | 3300037466 | Bacteria | 2767 |
| 491 | Ga0395905_0002707 | 3300037471 | Bacteria | 19419 |
| 492 | Ga0395905_0012996 | 3300037471 | Bacteria | 8002 |
| 493 | Ga0395905_0014307 | 3300037471 | Bacteria | 7583 |
| 494 | Ga0395905_0036792 | 3300037471 | Bacteria | 4598 |
| 495 | Ga0395905_0105325 | 3300037471 | Bacteria | 2648 |
| 496 | Ga0395905_0817382 | 3300037471 | Bacteria | 835 |
| 497 | Ga0395901_0004755 | 3300038443 | Bacteria | 13702 |
| 498 | Ga0395901_0007186 | 3300038443 | Bacteria | 11230 |
| 499 | Ga0395901_0089701 | 3300038443 | Bacteria | 3217 |
| 500 | Ga0395901_0096147 | 3300038443 | Bacteria | 3104 |
| 501 | Ga0395901_0126297 | 3300038443 | Bacteria | 2688 |
| 502 | Ga0395901_0163596 | 3300038443 | Bacteria | 2336 |
| 503 | Ga0439461_0017964 | 3300041410 | Bacteria | 1380 |
| 504 | Ga0451793_0399917 | 3300041452 | Bacteria | 1031 |
| 505 | Ga0451800_1203668 | 3300041459 | Bacteria | 731 |
| 506 | Ga0451800_1386280 | 3300041459 | Bacteria | 1034 |
| 507 | Ga0451802_0109468 | 3300041460 | Unclassified | 694 |
| 508 | Ga0451837_1295369 | 3300041494 | Unclassified | 512 |
| 509 | Ga0451843_0590208 | 3300041509 | Bacteria | 1053 |
| 510 | Ga0451843_1222221 | 3300041509 | Bacteria | 917 |
| 511 | Ga0439443_060414 | 3300042003 | Bacteria | 678 |
| 512 | Ga0439432_141933 | 3300042006 | Bacteria | 706 |
| 513 | Ga0439449_0033477 | 3300042007 | Bacteria | 1914 |
| 514 | Ga0439449_0055837 | 3300042007 | Bacteria | 1459 |
| 515 | Ga0439452_070197 | 3300042010 | Bacteria | 773 |
| 516 | Ga0439462_0172952 | 3300042015 | Bacteria | 611 |
| 517 | Ga0450923_006724 | 3300042125 | Bacteria | 1917 |
| 518 | Ga0439446_0101884 | 3300042156 | Bacteria | 909 |
| 519 | Ga0439434_0007984 | 3300042435 | Bacteria | 3101 |
| 520 | Ga0439444_0079175 | 3300042437 | Unclassified | 716 |
| 521 | Ga0466969_0114639 | 3300044656 | Bacteria | 1259 |
| 522 | Ga0453683_0564577 | 3300044673 | Bacteria | 741 |
| 523 | Ga0453684_0047342 | 3300044712 | Bacteria | 5704 |
| 524 | Ga0453684_0315633 | 3300044712 | Bacteria | 1772 |
| 525 | Ga0466959_0102749 | 3300045049 | Bacteria | 2045 |
| 526 | Ga0466967_0199623 | 3300045976 | Unclassified | 1894 |
| 527 | Ga0495621_0034299 | 3300046539 | Unclassified | 1753 |
| 528 | Ga0495581_0393909 | 3300047315 | Bacteria | 808 |
| 529 | Ga0495672_0024295 | 3300047320 | Bacteria | 3907 |
| 530 | Ga0495672_0284229 | 3300047320 | Bacteria | 789 |
| 531 | Ga0495676_0078176 | 3300047321 | Bacteria | 2520 |
| 532 | Ga0496104_1369514 | 3300048907 | Bacteria | 611 |
| 533 | Ga0501300_061766 | 3300049523 | Bacteria | 594 |
| 534 | Ga0501033_0072796 | 3300049570 | Unclassified | 2523 |
| 535 | Ga0501034_0720378 | 3300049571 | Bacteria | 895 |
| 536 | Ga0501034_0904236 | 3300049571 | Bacteria | 770 |
| 537 | Ga0501047_1025706 | 3300049581 | Unclassified | 638 |
| 538 | Ga0501070_0212762 | 3300049586 | Bacteria | 1586 |
| 539 | Ga0501201_010099 | 3300049651 | Bacteria | 922 |
| 540 | Ga0501202_006825 | 3300049652 | Bacteria | 2052 |
| 541 | Ga0501202_080467 | 3300049652 | Bacteria | 764 |
| 542 | Ga0501227_026653 | 3300049665 | Bacteria | 1364 |
| 543 | Ga0501240_118176 | 3300049673 | Unclassified | 522 |
| 544 | Ga0501250_004954 | 3300049680 | Bacteria | 1348 |
| 545 | Ga0501250_013878 | 3300049680 | Bacteria | 972 |
| 546 | Ga0501252_001409 | 3300049682 | Bacteria | 2212 |
| 547 | Ga0501257_207368 | 3300049686 | Bacteria | 566 |
| 548 | Ga0501259_004751 | 3300049688 | Bacteria | 2155 |
| 549 | Ga0501225_0100467 | 3300049705 | Bacteria | 845 |
| 550 | Ga0501245_000547 | 3300049708 | Bacteria | 4582 |
| 551 | Ga0501266_005308 | 3300049763 | Bacteria | 1604 |
| 552 | Ga0501268_010463 | 3300049765 | Bacteria | 1445 |
| 553 | Ga0501273_029537 | 3300049770 | Unclassified | 775 |
| 554 | Ga0501282_031565 | 3300049778 | Bacteria | 608 |
| 555 | Ga0501044_1138731 | 3300049823 | Unclassified | 649 |
| 556 | Ga0501044_1620327 | 3300049823 | Unclassified | 512 |
| 557 | nmdc:mga0k408_432391_c1 | 3300050493 | Bacteria | 782 |
| 558 | nmdc:mga05p37_255658_c1 | 3300050507 | Bacteria | 2099 |
| 559 | nmdc:mga09592_531488_c1 | 3300050508 | Bacteria | 1011 |
| 560 | nmdc:mga09592_996_c1 | 3300050508 | Bacteria | 22453 |
| 561 | nmdc:mga0qj67_9805_c1 | 3300050509 | Bacteria | 7137 |
| 562 | nmdc:mga06r32_1196595_c1 | 3300050510 | Bacteria | 706 |
| 563 | nmdc:mga06r32_1387683_c1 | 3300050510 | Bacteria | 645 |
| 564 | nmdc:mga06r32_64331_c1 | 3300050510 | Bacteria | 3537 |
| 565 | nmdc:mga08y16_101883_c1 | 3300050511 | Bacteria | 2989 |
| 566 | nmdc:mga08y16_194305_c1 | 3300050511 | Bacteria | 2104 |
| 567 | nmdc:mga08y16_783329_c1 | 3300050511 | Unclassified | 947 |
| 568 | nmdc:mga0n895_954761_c1 | 3300050512 | Bacteria | 840 |
| 569 | Ga0500628_060250 | 3300053129 | Bacteria | 925 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025908 | Ga0207643_10094634 | Ga0207643_100946342 | 126 |
| 2 | 3300005466 | Ga0070685_10886459 | Ga0070685_108864591 | 135 |
| 3 | 3300026118 | Ga0207675_101713929 | Ga0207675_1017139291 | 135 |
| 4 | 3300049652 | Ga0501202_006825 | Ga0501202_006825_278_703 | 141 |
| 5 | 3300000043 | ARcpr5yngRDRAFT_c011568 | ARcpr5yngRDRAFT_0115682 | 144 |
| 6 | 3300002459 | JGI24751J29686_10030404 | JGI24751J29686_100304042 | 144 |
| 7 | 3300005289 | Ga0065704_10390956 | Ga0065704_103909562 | 144 |
| 8 | 3300005290 | Ga0065712_10006450 | Ga0065712_100064504 | 144 |
| 9 | 3300005295 | Ga0065707_10173646 | Ga0065707_101736461 | 144 |
| 10 | 3300005327 | Ga0070658_10099518 | Ga0070658_100995182 | 144 |
| 11 | 3300005327 | Ga0070658_10191348 | Ga0070658_101913483 | 144 |
| 12 | 3300005327 | Ga0070658_10212501 | Ga0070658_102125013 | 144 |
| 13 | 3300005327 | Ga0070658_10248127 | Ga0070658_102481272 | 144 |
| 14 | 3300005327 | Ga0070658_10414876 | Ga0070658_104148762 | 144 |
| 15 | 3300005327 | Ga0070658_10694432 | Ga0070658_106944322 | 144 |
| 16 | 3300005327 | Ga0070658_10812875 | Ga0070658_108128752 | 144 |
| 17 | 3300005329 | Ga0070683_100296253 | Ga0070683_1002962533 | 144 |
| 18 | 3300005329 | Ga0070683_101072220 | Ga0070683_1010722201 | 144 |
| 19 | 3300005331 | Ga0070670_100049006 | Ga0070670_1000490063 | 144 |
| 20 | 3300005331 | Ga0070670_100083450 | Ga0070670_1000834502 | 144 |
| 21 | 3300005331 | Ga0070670_100107240 | Ga0070670_1001072403 | 144 |
| 22 | 3300005331 | Ga0070670_100131111 | Ga0070670_1001311112 | 144 |
| 23 | 3300005331 | Ga0070670_100648856 | Ga0070670_1006488563 | 144 |
| 24 | 3300005333 | Ga0070677_10232663 | Ga0070677_102326632 | 144 |
| 25 | 3300005334 | Ga0068869_100024863 | Ga0068869_1000248632 | 144 |
| 26 | 3300005336 | Ga0070680_100009385 | Ga0070680_1000093856 | 144 |
| 27 | 3300005336 | Ga0070680_100031154 | Ga0070680_1000311545 | 144 |
| 28 | 3300005336 | Ga0070680_100039392 | Ga0070680_1000393922 | 144 |
| 29 | 3300005336 | Ga0070680_100081642 | Ga0070680_1000816424 | 144 |
| 30 | 3300005336 | Ga0070680_100204521 | Ga0070680_1002045212 | 144 |
| 31 | 3300005337 | Ga0070682_100357769 | Ga0070682_1003577692 | 144 |
| 32 | 3300005338 | Ga0068868_100039380 | Ga0068868_1000393802 | 144 |
| 33 | 3300005338 | Ga0068868_100620699 | Ga0068868_1006206991 | 144 |
| 34 | 3300005339 | Ga0070660_100001935 | Ga0070660_1000019357 | 144 |
| 35 | 3300005339 | Ga0070660_100021641 | Ga0070660_1000216415 | 144 |
| 36 | 3300005339 | Ga0070660_100115862 | Ga0070660_1001158624 | 144 |
| 37 | 3300005339 | Ga0070660_100118855 | Ga0070660_1001188554 | 144 |
| 38 | 3300005339 | Ga0070660_100871534 | Ga0070660_1008715341 | 144 |
| 39 | 3300005343 | Ga0070687_100164521 | Ga0070687_1001645212 | 144 |
| 40 | 3300005343 | Ga0070687_100213343 | Ga0070687_1002133432 | 144 |
| 41 | 3300005344 | Ga0070661_100027194 | Ga0070661_1000271946 | 144 |
| 42 | 3300005344 | Ga0070661_100538965 | Ga0070661_1005389653 | 144 |
| 43 | 3300005345 | Ga0070692_10141046 | Ga0070692_101410462 | 144 |
| 44 | 3300005345 | Ga0070692_10249306 | Ga0070692_102493062 | 144 |
| 45 | 3300005347 | Ga0070668_100814013 | Ga0070668_1008140131 | 144 |
| 46 | 3300005353 | Ga0070669_100031912 | Ga0070669_1000319123 | 144 |
| 47 | 3300005353 | Ga0070669_100101392 | Ga0070669_1001013921 | 144 |
| 48 | 3300005354 | Ga0070675_100104298 | Ga0070675_1001042982 | 144 |
| 49 | 3300005354 | Ga0070675_101078991 | Ga0070675_1010789912 | 144 |
| 50 | 3300005355 | Ga0070671_100266562 | Ga0070671_1002665623 | 144 |
| 51 | 3300005355 | Ga0070671_100361570 | Ga0070671_1003615703 | 144 |
| 52 | 3300005356 | Ga0070674_100683927 | Ga0070674_1006839272 | 144 |
| 53 | 3300005364 | Ga0070673_100074775 | Ga0070673_1000747753 | 144 |
| 54 | 3300005364 | Ga0070673_100607960 | Ga0070673_1006079603 | 144 |
| 55 | 3300005365 | Ga0070688_100249801 | Ga0070688_1002498012 | 144 |
| 56 | 3300005366 | Ga0070659_100001791 | Ga0070659_10000179110 | 144 |
| 57 | 3300005366 | Ga0070659_100035067 | Ga0070659_1000350672 | 144 |
| 58 | 3300005366 | Ga0070659_100053397 | Ga0070659_1000533973 | 144 |
| 59 | 3300005366 | Ga0070659_100156709 | Ga0070659_1001567092 | 144 |
| 60 | 3300005366 | Ga0070659_100926344 | Ga0070659_1009263441 | 144 |
| 61 | 3300005435 | Ga0070714_100528889 | Ga0070714_1005288892 | 144 |
| 62 | 3300005440 | Ga0070705_100241081 | Ga0070705_1002410812 | 144 |
| 63 | 3300005455 | Ga0070663_100856225 | Ga0070663_1008562251 | 144 |
| 64 | 3300005456 | Ga0070678_100822354 | Ga0070678_1008223541 | 144 |
| 65 | 3300005456 | Ga0070678_101293502 | Ga0070678_1012935021 | 144 |
| 66 | 3300005458 | Ga0070681_10018161 | Ga0070681_100181616 | 144 |
| 67 | 3300005458 | Ga0070681_10157488 | Ga0070681_101574882 | 144 |
| 68 | 3300005458 | Ga0070681_10349581 | Ga0070681_103495813 | 144 |
| 69 | 3300005458 | Ga0070681_10588485 | Ga0070681_105884851 | 144 |
| 70 | 3300005458 | Ga0070681_11374123 | Ga0070681_113741232 | 144 |
| 71 | 3300005459 | Ga0068867_100581512 | Ga0068867_1005815122 | 144 |
| 72 | 3300005466 | Ga0070685_10406834 | Ga0070685_104068342 | 144 |
| 73 | 3300005466 | Ga0070685_10524724 | Ga0070685_105247242 | 144 |
| 74 | 3300005468 | Ga0070707_100779394 | Ga0070707_1007793941 | 144 |
| 75 | 3300005471 | Ga0070698_100000282 | Ga0070698_1000002827 | 144 |
| 76 | 3300005471 | Ga0070698_100004896 | Ga0070698_1000048962 | 144 |
| 77 | 3300005518 | Ga0070699_100120659 | Ga0070699_1001206592 | 144 |
| 78 | 3300005530 | Ga0070679_100000065 | Ga0070679_10000006528 | 144 |
| 79 | 3300005530 | Ga0070679_100063296 | Ga0070679_1000632962 | 144 |
| 80 | 3300005530 | Ga0070679_100075450 | Ga0070679_1000754505 | 144 |
| 81 | 3300005530 | Ga0070679_100130669 | Ga0070679_1001306694 | 144 |
| 82 | 3300005530 | Ga0070679_100447673 | Ga0070679_1004476731 | 144 |
| 83 | 3300005530 | Ga0070679_100937160 | Ga0070679_1009371602 | 144 |
| 84 | 3300005530 | Ga0070679_101208181 | Ga0070679_1012081811 | 144 |
| 85 | 3300005535 | Ga0070684_100000793 | Ga0070684_1000007933 | 144 |
| 86 | 3300005539 | Ga0068853_100016566 | Ga0068853_1000165662 | 144 |
| 87 | 3300005539 | Ga0068853_100024373 | Ga0068853_1000243733 | 144 |
| 88 | 3300005539 | Ga0068853_100047906 | Ga0068853_1000479063 | 144 |
| 89 | 3300005539 | Ga0068853_100094190 | Ga0068853_1000941902 | 144 |
| 90 | 3300005539 | Ga0068853_100196313 | Ga0068853_1001963132 | 144 |
| 91 | 3300005539 | Ga0068853_100981828 | Ga0068853_1009818281 | 144 |
| 92 | 3300005539 | Ga0068853_101131974 | Ga0068853_1011319742 | 144 |
| 93 | 3300005539 | Ga0068853_102180465 | Ga0068853_1021804651 | 144 |
| 94 | 3300005539 | Ga0068853_102199387 | Ga0068853_1021993871 | 144 |
| 95 | 3300005544 | Ga0070686_100197361 | Ga0070686_1001973614 | 144 |
| 96 | 3300005544 | Ga0070686_101514478 | Ga0070686_1015144781 | 144 |
| 97 | 3300005546 | Ga0070696_100092277 | Ga0070696_1000922774 | 144 |
| 98 | 3300005546 | Ga0070696_100698733 | Ga0070696_1006987331 | 144 |
| 99 | 3300005548 | Ga0070665_100362186 | Ga0070665_1003621862 | 144 |
| 100 | 3300005549 | Ga0070704_100555263 | Ga0070704_1005552632 | 144 |
| 101 | 3300005563 | Ga0068855_100000189 | Ga0068855_10000018923 | 144 |
| 102 | 3300005563 | Ga0068855_100001235 | Ga0068855_1000012351 | 144 |
| 103 | 3300005563 | Ga0068855_100345673 | Ga0068855_1003456733 | 144 |
| 104 | 3300005563 | Ga0068855_100346249 | Ga0068855_1003462493 | 144 |
| 105 | 3300005563 | Ga0068855_100585614 | Ga0068855_1005856142 | 144 |
| 106 | 3300005563 | Ga0068855_100622397 | Ga0068855_1006223973 | 144 |
| 107 | 3300005563 | Ga0068855_100716470 | Ga0068855_1007164703 | 144 |
| 108 | 3300005563 | Ga0068855_101080551 | Ga0068855_1010805512 | 144 |
| 109 | 3300005563 | Ga0068855_101174495 | Ga0068855_1011744951 | 144 |
| 110 | 3300005564 | Ga0070664_100152412 | Ga0070664_1001524122 | 144 |
| 111 | 3300005564 | Ga0070664_100361485 | Ga0070664_1003614852 | 144 |
| 112 | 3300005564 | Ga0070664_100463984 | Ga0070664_1004639842 | 144 |
| 113 | 3300005564 | Ga0070664_100722394 | Ga0070664_1007223942 | 144 |
| 114 | 3300005564 | Ga0070664_100870843 | Ga0070664_1008708432 | 144 |
| 115 | 3300005577 | Ga0068857_100022671 | Ga0068857_1000226714 | 144 |
| 116 | 3300005577 | Ga0068857_100098119 | Ga0068857_1000981194 | 144 |
| 117 | 3300005578 | Ga0068854_100095888 | Ga0068854_1000958882 | 144 |
| 118 | 3300005578 | Ga0068854_100132123 | Ga0068854_1001321234 | 144 |
| 119 | 3300005578 | Ga0068854_100183731 | Ga0068854_1001837312 | 144 |
| 120 | 3300005614 | Ga0068856_100022167 | Ga0068856_1000221674 | 144 |
| 121 | 3300005614 | Ga0068856_100063993 | Ga0068856_1000639935 | 144 |
| 122 | 3300005616 | Ga0068852_100002826 | Ga0068852_1000028269 | 144 |
| 123 | 3300005616 | Ga0068852_100020117 | Ga0068852_1000201174 | 144 |
| 124 | 3300005616 | Ga0068852_100030254 | Ga0068852_1000302544 | 144 |
| 125 | 3300005616 | Ga0068852_100047642 | Ga0068852_1000476422 | 144 |
| 126 | 3300005616 | Ga0068852_100253017 | Ga0068852_1002530172 | 144 |
| 127 | 3300005616 | Ga0068852_100824713 | Ga0068852_1008247131 | 144 |
| 128 | 3300005616 | Ga0068852_101109875 | Ga0068852_1011098751 | 144 |
| 129 | 3300005616 | Ga0068852_101467786 | Ga0068852_1014677862 | 144 |
| 130 | 3300005616 | Ga0068852_102023086 | Ga0068852_1020230861 | 144 |
| 131 | 3300005616 | Ga0068852_102689474 | Ga0068852_1026894741 | 144 |
| 132 | 3300005617 | Ga0068859_100065142 | Ga0068859_1000651422 | 144 |
| 133 | 3300005617 | Ga0068859_100090394 | Ga0068859_1000903942 | 144 |
| 134 | 3300005617 | Ga0068859_100276220 | Ga0068859_1002762201 | 144 |
| 135 | 3300005617 | Ga0068859_100312158 | Ga0068859_1003121583 | 144 |
| 136 | 3300005617 | Ga0068859_100382481 | Ga0068859_1003824813 | 144 |
| 137 | 3300005617 | Ga0068859_100617796 | Ga0068859_1006177962 | 144 |
| 138 | 3300005617 | Ga0068859_100781245 | Ga0068859_1007812452 | 144 |
| 139 | 3300005618 | Ga0068864_100035197 | Ga0068864_1000351973 | 144 |
| 140 | 3300005618 | Ga0068864_100123836 | Ga0068864_1001238363 | 144 |
| 141 | 3300005618 | Ga0068864_100357915 | Ga0068864_1003579152 | 144 |
| 142 | 3300005719 | Ga0068861_100004473 | Ga0068861_1000044733 | 144 |
| 143 | 3300005719 | Ga0068861_100303297 | Ga0068861_1003032972 | 144 |
| 144 | 3300005719 | Ga0068861_102410844 | Ga0068861_1024108442 | 144 |
| 145 | 3300005834 | Ga0068851_10012642 | Ga0068851_100126422 | 144 |
| 146 | 3300005834 | Ga0068851_10101705 | Ga0068851_101017052 | 144 |
| 147 | 3300005834 | Ga0068851_10106657 | Ga0068851_101066571 | 144 |
| 148 | 3300005834 | Ga0068851_10555620 | Ga0068851_105556202 | 144 |
| 149 | 3300005834 | Ga0068851_10959381 | Ga0068851_109593811 | 144 |
| 150 | 3300005840 | Ga0068870_10758166 | Ga0068870_107581662 | 144 |
| 151 | 3300005841 | Ga0068863_100029142 | Ga0068863_1000291425 | 144 |
| 152 | 3300005841 | Ga0068863_100038534 | Ga0068863_1000385343 | 144 |
| 153 | 3300005841 | Ga0068863_100258808 | Ga0068863_1002588083 | 144 |
| 154 | 3300005841 | Ga0068863_100619655 | Ga0068863_1006196552 | 144 |
| 155 | 3300005841 | Ga0068863_100891301 | Ga0068863_1008913012 | 144 |
| 156 | 3300005842 | Ga0068858_100388364 | Ga0068858_1003883641 | 144 |
| 157 | 3300005843 | Ga0068860_100013488 | Ga0068860_1000134885 | 144 |
| 158 | 3300005843 | Ga0068860_100479507 | Ga0068860_1004795073 | 144 |
| 159 | 3300005843 | Ga0068860_100516751 | Ga0068860_1005167513 | 144 |
| 160 | 3300005843 | Ga0068860_101000708 | Ga0068860_1010007082 | 144 |
| 161 | 3300005844 | Ga0068862_100245586 | Ga0068862_1002455862 | 144 |
| 162 | 3300005844 | Ga0068862_100584045 | Ga0068862_1005840452 | 144 |
| 163 | 3300006237 | Ga0097621_100014286 | Ga0097621_1000142867 | 144 |
| 164 | 3300006237 | Ga0097621_100243572 | Ga0097621_1002435722 | 144 |
| 165 | 3300006358 | Ga0068871_100804610 | Ga0068871_1008046102 | 144 |
| 166 | 3300006358 | Ga0068871_100861015 | Ga0068871_1008610152 | 144 |
| 167 | 3300006844 | Ga0075428_100014821 | Ga0075428_1000148215 | 144 |
| 168 | 3300006844 | Ga0075428_100048180 | Ga0075428_1000481803 | 144 |
| 169 | 3300006844 | Ga0075428_100132746 | Ga0075428_1001327462 | 144 |
| 170 | 3300006844 | Ga0075428_101817476 | Ga0075428_1018174762 | 144 |
| 171 | 3300006846 | Ga0075430_100001793 | Ga0075430_10000179315 | 144 |
| 172 | 3300006847 | Ga0075431_100031975 | Ga0075431_1000319753 | 144 |
| 173 | 3300006847 | Ga0075431_100908330 | Ga0075431_1009083301 | 144 |
| 174 | 3300006847 | Ga0075431_101294479 | Ga0075431_1012944791 | 144 |
| 175 | 3300006880 | Ga0075429_100000136 | Ga0075429_10000013638 | 144 |
| 176 | 3300006880 | Ga0075429_100589406 | Ga0075429_1005894063 | 144 |
| 177 | 3300006931 | Ga0097620_100062773 | Ga0097620_1000627736 | 144 |
| 178 | 3300006931 | Ga0097620_100065142 | Ga0097620_1000651425 | 144 |
| 179 | 3300006931 | Ga0097620_100090395 | Ga0097620_1000903952 | 144 |
| 180 | 3300006931 | Ga0097620_100276205 | Ga0097620_1002762051 | 144 |
| 181 | 3300006931 | Ga0097620_100312157 | Ga0097620_1003121573 | 144 |
| 182 | 3300006931 | Ga0097620_100382492 | Ga0097620_1003824922 | 144 |
| 183 | 3300006931 | Ga0097620_100617801 | Ga0097620_1006178012 | 144 |
| 184 | 3300006931 | Ga0097620_100781049 | Ga0097620_1007810493 | 144 |
| 185 | 3300009093 | Ga0105240_10294577 | Ga0105240_102945773 | 144 |
| 186 | 3300009094 | Ga0111539_10118607 | Ga0111539_101186073 | 144 |
| 187 | 3300009094 | Ga0111539_10120160 | Ga0111539_101201602 | 144 |
| 188 | 3300009094 | Ga0111539_12080550 | Ga0111539_120805502 | 144 |
| 189 | 3300009101 | Ga0105247_10136885 | Ga0105247_101368852 | 144 |
| 190 | 3300009147 | Ga0114129_12026737 | Ga0114129_120267372 | 144 |
| 191 | 3300009148 | Ga0105243_10621789 | Ga0105243_106217891 | 144 |
| 192 | 3300009148 | Ga0105243_11457419 | Ga0105243_114574192 | 144 |
| 193 | 3300009174 | Ga0105241_10021632 | Ga0105241_100216323 | 144 |
| 194 | 3300009176 | Ga0105242_10007396 | Ga0105242_100073964 | 144 |
| 195 | 3300009176 | Ga0105242_10197772 | Ga0105242_101977723 | 144 |
| 196 | 3300009176 | Ga0105242_10358502 | Ga0105242_103585022 | 144 |
| 197 | 3300009176 | Ga0105242_11761951 | Ga0105242_117619511 | 144 |
| 198 | 3300009177 | Ga0105248_11335531 | Ga0105248_113355311 | 144 |
| 199 | 3300009545 | Ga0105237_10108498 | Ga0105237_101084982 | 144 |
| 200 | 3300009545 | Ga0105237_10571112 | Ga0105237_105711122 | 144 |
| 201 | 3300009553 | Ga0105249_10001213 | Ga0105249_1000121315 | 144 |
| 202 | 3300009553 | Ga0105249_10001789 | Ga0105249_1000178913 | 144 |
| 203 | 3300009553 | Ga0105249_10164540 | Ga0105249_101645402 | 144 |
| 204 | 3300009553 | Ga0105249_10168015 | Ga0105249_101680153 | 144 |
| 205 | 3300009553 | Ga0105249_11916919 | Ga0105249_119169191 | 144 |
| 206 | 3300009553 | Ga0105249_12466618 | Ga0105249_124666181 | 144 |
| 207 | 3300009553 | Ga0105249_12679515 | Ga0105249_126795151 | 144 |
| 208 | 3300010375 | Ga0105239_10038971 | Ga0105239_100389713 | 144 |
| 209 | 3300011119 | Ga0105246_10375027 | Ga0105246_103750271 | 144 |
| 210 | 3300013100 | Ga0157373_10001339 | Ga0157373_100013398 | 144 |
| 211 | 3300013100 | Ga0157373_10035077 | Ga0157373_100350772 | 144 |
| 212 | 3300013100 | Ga0157373_10043440 | Ga0157373_100434404 | 144 |
| 213 | 3300013100 | Ga0157373_10048599 | Ga0157373_100485993 | 144 |
| 214 | 3300013100 | Ga0157373_10379302 | Ga0157373_103793021 | 144 |
| 215 | 3300013100 | Ga0157373_10387725 | Ga0157373_103877252 | 144 |
| 216 | 3300013100 | Ga0157373_10617003 | Ga0157373_106170032 | 144 |
| 217 | 3300013102 | Ga0157371_10000326 | Ga0157371_1000032645 | 144 |
| 218 | 3300013102 | Ga0157371_10003758 | Ga0157371_100037584 | 144 |
| 219 | 3300013102 | Ga0157371_10004714 | Ga0157371_100047149 | 144 |
| 220 | 3300013102 | Ga0157371_10004797 | Ga0157371_1000479712 | 144 |
| 221 | 3300013102 | Ga0157371_10010426 | Ga0157371_100104266 | 144 |
| 222 | 3300013102 | Ga0157371_10016890 | Ga0157371_100168904 | 144 |
| 223 | 3300013102 | Ga0157371_10032682 | Ga0157371_100326823 | 144 |
| 224 | 3300013102 | Ga0157371_10038313 | Ga0157371_100383136 | 144 |
| 225 | 3300013102 | Ga0157371_10039550 | Ga0157371_100395503 | 144 |
| 226 | 3300013102 | Ga0157371_10140511 | Ga0157371_101405112 | 144 |
| 227 | 3300013102 | Ga0157371_10209806 | Ga0157371_102098062 | 144 |
| 228 | 3300013102 | Ga0157371_10212440 | Ga0157371_102124402 | 144 |
| 229 | 3300013102 | Ga0157371_10253519 | Ga0157371_102535193 | 144 |
| 230 | 3300013102 | Ga0157371_10266039 | Ga0157371_102660393 | 144 |
| 231 | 3300013102 | Ga0157371_10300213 | Ga0157371_103002132 | 144 |
| 232 | 3300013102 | Ga0157371_10377573 | Ga0157371_103775732 | 144 |
| 233 | 3300013104 | Ga0157370_10003774 | Ga0157370_100037743 | 144 |
| 234 | 3300013104 | Ga0157370_10007491 | Ga0157370_100074918 | 144 |
| 235 | 3300013104 | Ga0157370_10056533 | Ga0157370_100565334 | 144 |
| 236 | 3300013104 | Ga0157370_10092662 | Ga0157370_100926621 | 144 |
| 237 | 3300013104 | Ga0157370_10120438 | Ga0157370_101204382 | 144 |
| 238 | 3300013104 | Ga0157370_10164225 | Ga0157370_101642252 | 144 |
| 239 | 3300013104 | Ga0157370_10193227 | Ga0157370_101932274 | 144 |
| 240 | 3300013104 | Ga0157370_10307372 | Ga0157370_103073724 | 144 |
| 241 | 3300013104 | Ga0157370_10403959 | Ga0157370_104039593 | 144 |
| 242 | 3300013104 | Ga0157370_10752516 | Ga0157370_107525163 | 144 |
| 243 | 3300013105 | Ga0157369_10042466 | Ga0157369_100424663 | 144 |
| 244 | 3300013105 | Ga0157369_10090879 | Ga0157369_100908793 | 144 |
| 245 | 3300013105 | Ga0157369_10248419 | Ga0157369_102484192 | 144 |
| 246 | 3300013105 | Ga0157369_10272481 | Ga0157369_102724813 | 144 |
| 247 | 3300013105 | Ga0157369_10363334 | Ga0157369_103633342 | 144 |
| 248 | 3300013105 | Ga0157369_10372401 | Ga0157369_103724013 | 144 |
| 249 | 3300013105 | Ga0157369_10487553 | Ga0157369_104875532 | 144 |
| 250 | 3300013105 | Ga0157369_10702940 | Ga0157369_107029402 | 144 |
| 251 | 3300013105 | Ga0157369_10761062 | Ga0157369_107610621 | 144 |
| 252 | 3300013105 | Ga0157369_10986183 | Ga0157369_109861832 | 144 |
| 253 | 3300013296 | Ga0157374_10848542 | Ga0157374_108485421 | 144 |
| 254 | 3300013297 | Ga0157378_10029228 | Ga0157378_100292283 | 144 |
| 255 | 3300013297 | Ga0157378_10461065 | Ga0157378_104610651 | 144 |
| 256 | 3300013297 | Ga0157378_10603524 | Ga0157378_106035242 | 144 |
| 257 | 3300013297 | Ga0157378_10637902 | Ga0157378_106379023 | 144 |
| 258 | 3300013297 | Ga0157378_10745324 | Ga0157378_107453242 | 144 |
| 259 | 3300013297 | Ga0157378_11935647 | Ga0157378_119356472 | 144 |
| 260 | 3300013297 | Ga0157378_12463009 | Ga0157378_124630091 | 144 |
| 261 | 3300013306 | Ga0163162_10025727 | Ga0163162_100257277 | 144 |
| 262 | 3300013306 | Ga0163162_10079613 | Ga0163162_100796135 | 144 |
| 263 | 3300013306 | Ga0163162_10437185 | Ga0163162_104371851 | 144 |
| 264 | 3300013306 | Ga0163162_10809341 | Ga0163162_108093412 | 144 |
| 265 | 3300013306 | Ga0163162_11929064 | Ga0163162_119290642 | 144 |
| 266 | 3300013307 | Ga0157372_10003572 | Ga0157372_1000357211 | 144 |
| 267 | 3300013307 | Ga0157372_10004470 | Ga0157372_100044705 | 144 |
| 268 | 3300013307 | Ga0157372_10010326 | Ga0157372_100103267 | 144 |
| 269 | 3300013307 | Ga0157372_10015473 | Ga0157372_100154732 | 144 |
| 270 | 3300013307 | Ga0157372_10029328 | Ga0157372_100293284 | 144 |
| 271 | 3300013307 | Ga0157372_10040641 | Ga0157372_100406417 | 144 |
| 272 | 3300013307 | Ga0157372_10055092 | Ga0157372_100550922 | 144 |
| 273 | 3300013307 | Ga0157372_10074037 | Ga0157372_100740372 | 144 |
| 274 | 3300013307 | Ga0157372_10082966 | Ga0157372_100829665 | 144 |
| 275 | 3300013307 | Ga0157372_10151244 | Ga0157372_101512443 | 144 |
| 276 | 3300013307 | Ga0157372_10183170 | Ga0157372_101831702 | 144 |
| 277 | 3300013307 | Ga0157372_10185925 | Ga0157372_101859254 | 144 |
| 278 | 3300013307 | Ga0157372_10192017 | Ga0157372_101920174 | 144 |
| 279 | 3300013307 | Ga0157372_10356446 | Ga0157372_103564463 | 144 |
| 280 | 3300013307 | Ga0157372_10403898 | Ga0157372_104038982 | 144 |
| 281 | 3300013307 | Ga0157372_10533852 | Ga0157372_105338523 | 144 |
| 282 | 3300013307 | Ga0157372_10791761 | Ga0157372_107917612 | 144 |
| 283 | 3300013307 | Ga0157372_10889854 | Ga0157372_108898541 | 144 |
| 284 | 3300013307 | Ga0157372_10944221 | Ga0157372_109442211 | 144 |
| 285 | 3300013307 | Ga0157372_11193112 | Ga0157372_111931122 | 144 |
| 286 | 3300013307 | Ga0157372_11246250 | Ga0157372_112462501 | 144 |
| 287 | 3300013307 | Ga0157372_11615305 | Ga0157372_116153052 | 144 |
| 288 | 3300013307 | Ga0157372_12035599 | Ga0157372_120355992 | 144 |
| 289 | 3300013307 | Ga0157372_12273695 | Ga0157372_122736951 | 144 |
| 290 | 3300013308 | Ga0157375_10496111 | Ga0157375_104961112 | 144 |
| 291 | 3300013308 | Ga0157375_10555888 | Ga0157375_105558882 | 144 |
| 292 | 3300013308 | Ga0157375_10757597 | Ga0157375_107575973 | 144 |
| 293 | 3300013308 | Ga0157375_11126062 | Ga0157375_111260622 | 144 |
| 294 | 3300013308 | Ga0157375_12550438 | Ga0157375_125504381 | 144 |
| 295 | 3300014325 | Ga0163163_10014847 | Ga0163163_100148476 | 144 |
| 296 | 3300014325 | Ga0163163_10054518 | Ga0163163_100545184 | 144 |
| 297 | 3300014325 | Ga0163163_10289720 | Ga0163163_102897202 | 144 |
| 298 | 3300014325 | Ga0163163_10587713 | Ga0163163_105877131 | 144 |
| 299 | 3300014325 | Ga0163163_11369979 | Ga0163163_113699792 | 144 |
| 300 | 3300014326 | Ga0157380_10309721 | Ga0157380_103097213 | 144 |
| 301 | 3300014326 | Ga0157380_10799381 | Ga0157380_107993812 | 144 |
| 302 | 3300014326 | Ga0157380_11328459 | Ga0157380_113284591 | 144 |
| 303 | 3300014745 | Ga0157377_10014841 | Ga0157377_100148414 | 144 |
| 304 | 3300014745 | Ga0157377_10398320 | Ga0157377_103983201 | 144 |
| 305 | 3300014745 | Ga0157377_10578622 | Ga0157377_105786222 | 144 |
| 306 | 3300014745 | Ga0157377_10865062 | Ga0157377_108650621 | 144 |
| 307 | 3300014968 | Ga0157379_10203428 | Ga0157379_102034282 | 144 |
| 308 | 3300014968 | Ga0157379_10212274 | Ga0157379_102122743 | 144 |
| 309 | 3300014968 | Ga0157379_10257223 | Ga0157379_102572231 | 144 |
| 310 | 3300014969 | Ga0157376_10018476 | Ga0157376_100184762 | 144 |
| 311 | 3300014969 | Ga0157376_10052998 | Ga0157376_100529982 | 144 |
| 312 | 3300014969 | Ga0157376_10218135 | Ga0157376_102181352 | 144 |
| 313 | 3300017792 | Ga0163161_10041693 | Ga0163161_100416933 | 144 |
| 314 | 3300017792 | Ga0163161_10123891 | Ga0163161_101238914 | 144 |
| 315 | 3300017792 | Ga0163161_10153391 | Ga0163161_101533913 | 144 |
| 316 | 3300017792 | Ga0163161_10242298 | Ga0163161_102422982 | 144 |
| 317 | 3300017792 | Ga0163161_10633452 | Ga0163161_106334521 | 144 |
| 318 | 3300025321 | Ga0207656_10024735 | Ga0207656_100247353 | 144 |
| 319 | 3300025321 | Ga0207656_10331771 | Ga0207656_103317712 | 144 |
| 320 | 3300025893 | Ga0207682_10251077 | Ga0207682_102510771 | 144 |
| 321 | 3300025900 | Ga0207710_10093233 | Ga0207710_100932333 | 144 |
| 322 | 3300025904 | Ga0207647_10000794 | Ga0207647_1000079419 | 144 |
| 323 | 3300025904 | Ga0207647_10215361 | Ga0207647_102153613 | 144 |
| 324 | 3300025908 | Ga0207643_10326702 | Ga0207643_103267022 | 144 |
| 325 | 3300025909 | Ga0207705_10018694 | Ga0207705_100186943 | 144 |
| 326 | 3300025909 | Ga0207705_10033790 | Ga0207705_100337902 | 144 |
| 327 | 3300025909 | Ga0207705_10034314 | Ga0207705_100343143 | 144 |
| 328 | 3300025909 | Ga0207705_10145824 | Ga0207705_101458242 | 144 |
| 329 | 3300025909 | Ga0207705_10260844 | Ga0207705_102608442 | 144 |
| 330 | 3300025909 | Ga0207705_10555070 | Ga0207705_105550702 | 144 |
| 331 | 3300025909 | Ga0207705_11218757 | Ga0207705_112187572 | 144 |
| 332 | 3300025911 | Ga0207654_10831810 | Ga0207654_108318102 | 144 |
| 333 | 3300025912 | Ga0207707_10028000 | Ga0207707_100280003 | 144 |
| 334 | 3300025912 | Ga0207707_10054406 | Ga0207707_100544063 | 144 |
| 335 | 3300025912 | Ga0207707_10156587 | Ga0207707_101565873 | 144 |
| 336 | 3300025912 | Ga0207707_10434401 | Ga0207707_104344012 | 144 |
| 337 | 3300025912 | Ga0207707_10497331 | Ga0207707_104973311 | 144 |
| 338 | 3300025913 | Ga0207695_10029182 | Ga0207695_100291823 | 144 |
| 339 | 3300025913 | Ga0207695_10208817 | Ga0207695_102088172 | 144 |
| 340 | 3300025914 | Ga0207671_10140689 | Ga0207671_101406893 | 144 |
| 341 | 3300025914 | Ga0207671_10730316 | Ga0207671_107303162 | 144 |
| 342 | 3300025917 | Ga0207660_10048222 | Ga0207660_100482222 | 144 |
| 343 | 3300025917 | Ga0207660_10052547 | Ga0207660_100525472 | 144 |
| 344 | 3300025917 | Ga0207660_10202750 | Ga0207660_102027503 | 144 |
| 345 | 3300025917 | Ga0207660_10224626 | Ga0207660_102246262 | 144 |
| 346 | 3300025918 | Ga0207662_10155573 | Ga0207662_101555732 | 144 |
| 347 | 3300025918 | Ga0207662_10271326 | Ga0207662_102713262 | 144 |
| 348 | 3300025919 | Ga0207657_10004092 | Ga0207657_1000409213 | 144 |
| 349 | 3300025919 | Ga0207657_10059125 | Ga0207657_100591253 | 144 |
| 350 | 3300025919 | Ga0207657_10080133 | Ga0207657_100801332 | 144 |
| 351 | 3300025919 | Ga0207657_10102550 | Ga0207657_101025503 | 144 |
| 352 | 3300025920 | Ga0207649_10018781 | Ga0207649_100187812 | 144 |
| 353 | 3300025921 | Ga0207652_10000013 | Ga0207652_1000001395 | 144 |
| 354 | 3300025921 | Ga0207652_10000035 | Ga0207652_100000355 | 144 |
| 355 | 3300025921 | Ga0207652_10005883 | Ga0207652_100058836 | 144 |
| 356 | 3300025921 | Ga0207652_10090171 | Ga0207652_100901711 | 144 |
| 357 | 3300025921 | Ga0207652_10121421 | Ga0207652_101214211 | 144 |
| 358 | 3300025921 | Ga0207652_10164230 | Ga0207652_101642302 | 144 |
| 359 | 3300025923 | Ga0207681_10181261 | Ga0207681_101812613 | 144 |
| 360 | 3300025925 | Ga0207650_10002238 | Ga0207650_100022383 | 144 |
| 361 | 3300025925 | Ga0207650_10154762 | Ga0207650_101547622 | 144 |
| 362 | 3300025925 | Ga0207650_10170261 | Ga0207650_101702612 | 144 |
| 363 | 3300025925 | Ga0207650_10589888 | Ga0207650_105898882 | 144 |
| 364 | 3300025925 | Ga0207650_11541732 | Ga0207650_115417321 | 144 |
| 365 | 3300025926 | Ga0207659_10034673 | Ga0207659_100346732 | 144 |
| 366 | 3300025926 | Ga0207659_10526338 | Ga0207659_105263382 | 144 |
| 367 | 3300025931 | Ga0207644_10168473 | Ga0207644_101684733 | 144 |
| 368 | 3300025931 | Ga0207644_10253780 | Ga0207644_102537802 | 144 |
| 369 | 3300025932 | Ga0207690_10009384 | Ga0207690_100093844 | 144 |
| 370 | 3300025932 | Ga0207690_10053726 | Ga0207690_100537262 | 144 |
| 371 | 3300025932 | Ga0207690_10132347 | Ga0207690_101323472 | 144 |
| 372 | 3300025932 | Ga0207690_10260084 | Ga0207690_102600842 | 144 |
| 373 | 3300025932 | Ga0207690_10440370 | Ga0207690_104403703 | 144 |
| 374 | 3300025934 | Ga0207686_10000709 | Ga0207686_100007095 | 144 |
| 375 | 3300025935 | Ga0207709_10147068 | Ga0207709_101470682 | 144 |
| 376 | 3300025936 | Ga0207670_10945769 | Ga0207670_109457692 | 144 |
| 377 | 3300025937 | Ga0207669_11247159 | Ga0207669_112471592 | 144 |
| 378 | 3300025940 | Ga0207691_10134620 | Ga0207691_101346203 | 144 |
| 379 | 3300025940 | Ga0207691_10488652 | Ga0207691_104886523 | 144 |
| 380 | 3300025942 | Ga0207689_10034122 | Ga0207689_100341224 | 144 |
| 381 | 3300025942 | Ga0207689_10155124 | Ga0207689_101551242 | 144 |
| 382 | 3300025942 | Ga0207689_10246872 | Ga0207689_102468723 | 144 |
| 383 | 3300025944 | Ga0207661_10086982 | Ga0207661_100869823 | 144 |
| 384 | 3300025944 | Ga0207661_10187673 | Ga0207661_101876733 | 144 |
| 385 | 3300025944 | Ga0207661_10933568 | Ga0207661_109335682 | 144 |
| 386 | 3300025944 | Ga0207661_10987944 | Ga0207661_109879441 | 144 |
| 387 | 3300025944 | Ga0207661_11622894 | Ga0207661_116228941 | 144 |
| 388 | 3300025945 | Ga0207679_10048577 | Ga0207679_100485774 | 144 |
| 389 | 3300025945 | Ga0207679_10179004 | Ga0207679_101790042 | 144 |
| 390 | 3300025945 | Ga0207679_10814154 | Ga0207679_108141542 | 144 |
| 391 | 3300025949 | Ga0207667_10002703 | Ga0207667_100027033 | 144 |
| 392 | 3300025949 | Ga0207667_10031804 | Ga0207667_100318044 | 144 |
| 393 | 3300025949 | Ga0207667_10051249 | Ga0207667_100512491 | 144 |
| 394 | 3300025949 | Ga0207667_10117582 | Ga0207667_101175824 | 144 |
| 395 | 3300025949 | Ga0207667_10189696 | Ga0207667_101896963 | 144 |
| 396 | 3300025949 | Ga0207667_10925665 | Ga0207667_109256652 | 144 |
| 397 | 3300025960 | Ga0207651_10033206 | Ga0207651_100332062 | 144 |
| 398 | 3300025960 | Ga0207651_10673980 | Ga0207651_106739802 | 144 |
| 399 | 3300025960 | Ga0207651_11230088 | Ga0207651_112300882 | 144 |
| 400 | 3300025961 | Ga0207712_10001032 | Ga0207712_100010327 | 144 |
| 401 | 3300025961 | Ga0207712_10130810 | Ga0207712_101308102 | 144 |
| 402 | 3300025961 | Ga0207712_11242735 | Ga0207712_112427351 | 144 |
| 403 | 3300025981 | Ga0207640_10046443 | Ga0207640_100464432 | 144 |
| 404 | 3300025981 | Ga0207640_10120011 | Ga0207640_101200112 | 144 |
| 405 | 3300025981 | Ga0207640_10158151 | Ga0207640_101581513 | 144 |
| 406 | 3300025981 | Ga0207640_10893714 | Ga0207640_108937142 | 144 |
| 407 | 3300026023 | Ga0207677_10097653 | Ga0207677_100976532 | 144 |
| 408 | 3300026041 | Ga0207639_10027480 | Ga0207639_100274803 | 144 |
| 409 | 3300026041 | Ga0207639_10082827 | Ga0207639_100828272 | 144 |
| 410 | 3300026041 | Ga0207639_10273809 | Ga0207639_102738092 | 144 |
| 411 | 3300026041 | Ga0207639_10538421 | Ga0207639_105384212 | 144 |
| 412 | 3300026041 | Ga0207639_10942659 | Ga0207639_109426592 | 144 |
| 413 | 3300026041 | Ga0207639_11366981 | Ga0207639_113669811 | 144 |
| 414 | 3300026041 | Ga0207639_11860959 | Ga0207639_118609591 | 144 |
| 415 | 3300026075 | Ga0207708_10179244 | Ga0207708_101792443 | 144 |
| 416 | 3300026078 | Ga0207702_10055653 | Ga0207702_100556534 | 144 |
| 417 | 3300026078 | Ga0207702_10948282 | Ga0207702_109482822 | 144 |
| 418 | 3300026078 | Ga0207702_10957846 | Ga0207702_109578462 | 144 |
| 419 | 3300026088 | Ga0207641_10001063 | Ga0207641_1000106315 | 144 |
| 420 | 3300026088 | Ga0207641_10020932 | Ga0207641_100209322 | 144 |
| 421 | 3300026088 | Ga0207641_10296292 | Ga0207641_102962922 | 144 |
| 422 | 3300026088 | Ga0207641_10418048 | Ga0207641_104180482 | 144 |
| 423 | 3300026088 | Ga0207641_10771418 | Ga0207641_107714182 | 144 |
| 424 | 3300026088 | Ga0207641_10830163 | Ga0207641_108301632 | 144 |
| 425 | 3300026089 | Ga0207648_10140172 | Ga0207648_101401723 | 144 |
| 426 | 3300026089 | Ga0207648_10243328 | Ga0207648_102433282 | 144 |
| 427 | 3300026089 | Ga0207648_10253113 | Ga0207648_102531133 | 144 |
| 428 | 3300026089 | Ga0207648_11310616 | Ga0207648_113106162 | 144 |
| 429 | 3300026095 | Ga0207676_10093751 | Ga0207676_100937512 | 144 |
| 430 | 3300026095 | Ga0207676_10280597 | Ga0207676_102805973 | 144 |
| 431 | 3300026095 | Ga0207676_10302695 | Ga0207676_103026953 | 144 |
| 432 | 3300026116 | Ga0207674_10063984 | Ga0207674_100639843 | 144 |
| 433 | 3300026116 | Ga0207674_10206841 | Ga0207674_102068412 | 144 |
| 434 | 3300026116 | Ga0207674_10241127 | Ga0207674_102411273 | 144 |
| 435 | 3300026116 | Ga0207674_10381852 | Ga0207674_103818522 | 144 |
| 436 | 3300026116 | Ga0207674_11759691 | Ga0207674_117596912 | 144 |
| 437 | 3300026118 | Ga0207675_100005394 | Ga0207675_1000053949 | 144 |
| 438 | 3300026118 | Ga0207675_100791072 | Ga0207675_1007910722 | 144 |
| 439 | 3300026118 | Ga0207675_100824289 | Ga0207675_1008242893 | 144 |
| 440 | 3300026121 | Ga0207683_10282275 | Ga0207683_102822752 | 144 |
| 441 | 3300026121 | Ga0207683_11770699 | Ga0207683_117706991 | 144 |
| 442 | 3300026142 | Ga0207698_10005633 | Ga0207698_100056334 | 144 |
| 443 | 3300026142 | Ga0207698_10019044 | Ga0207698_100190443 | 144 |
| 444 | 3300026142 | Ga0207698_10150853 | Ga0207698_101508532 | 144 |
| 445 | 3300026142 | Ga0207698_10413026 | Ga0207698_104130262 | 144 |
| 446 | 3300026142 | Ga0207698_10976008 | Ga0207698_109760082 | 144 |
| 447 | 3300026142 | Ga0207698_11200907 | Ga0207698_112009071 | 144 |
| 448 | 3300027462 | Ga0210000_1082064 | Ga0210000_10820641 | 144 |
| 449 | 3300027471 | Ga0209995_1060740 | Ga0209995_10607401 | 144 |
| 450 | 3300027876 | Ga0209974_10018336 | Ga0209974_100183363 | 144 |
| 451 | 3300027907 | Ga0207428_10438323 | Ga0207428_104383231 | 144 |
| 452 | 3300028379 | Ga0268266_10330619 | Ga0268266_103306193 | 144 |
| 453 | 3300028380 | Ga0268265_10055836 | Ga0268265_100558364 | 144 |
| 454 | 3300028380 | Ga0268265_10586893 | Ga0268265_105868932 | 144 |
| 455 | 3300028380 | Ga0268265_10675746 | Ga0268265_106757463 | 144 |
| 456 | 3300028380 | Ga0268265_10813085 | Ga0268265_108130852 | 144 |
| 457 | 3300028381 | Ga0268264_10008032 | Ga0268264_100080324 | 144 |
| 458 | 3300028381 | Ga0268264_10633133 | Ga0268264_106331332 | 144 |
| 459 | 3300028381 | Ga0268264_11330986 | Ga0268264_113309861 | 144 |
| 460 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012731 | 144 |
| 461 | 3300031731 | Ga0307405_10462138 | Ga0307405_104621382 | 144 |
| 462 | 3300031852 | Ga0307410_11109920 | Ga0307410_111099201 | 144 |
| 463 | 3300031852 | Ga0307410_11944820 | Ga0307410_119448201 | 144 |
| 464 | 3300031903 | Ga0307407_10232499 | Ga0307407_102324992 | 144 |
| 465 | 3300032002 | Ga0307416_100420738 | Ga0307416_1004207382 | 144 |
| 466 | 3300032004 | Ga0307414_10033768 | Ga0307414_100337683 | 144 |
| 467 | 3300032004 | Ga0307414_10521056 | Ga0307414_105210562 | 144 |
| 468 | 3300032004 | Ga0307414_10891633 | Ga0307414_108916331 | 144 |
| 469 | 3300032004 | Ga0307414_12034440 | Ga0307414_120344401 | 144 |
| 470 | 3300032005 | Ga0307411_10758063 | Ga0307411_107580632 | 144 |
| 471 | 3300032126 | Ga0307415_100107217 | Ga0307415_1001072171 | 144 |
| 472 | 3300035089 | Ga0373944_0082765 | Ga0373944_0082765_513_947 | 144 |
| 473 | 3300037312 | Ga0395899_0001073 | Ga0395899_0001073_22888_23322 | 144 |
| 474 | 3300037312 | Ga0395899_0019583 | Ga0395899_0019583_1016_1450 | 144 |
| 475 | 3300037312 | Ga0395899_0032073 | Ga0395899_0032073_1061_1495 | 144 |
| 476 | 3300037312 | Ga0395899_0040164 | Ga0395899_0040164_2063_2497 | 144 |
| 477 | 3300037312 | Ga0395899_0058033 | Ga0395899_0058033_1399_1833 | 144 |
| 478 | 3300037312 | Ga0395899_0084451 | Ga0395899_0084451_203_637 | 144 |
| 479 | 3300037312 | Ga0395899_0094263 | Ga0395899_0094263_185_619 | 144 |
| 480 | 3300037418 | Ga0395900_0010637 | Ga0395900_0010637_552_986 | 144 |
| 481 | 3300037418 | Ga0395900_0022979 | Ga0395900_0022979_4431_4865 | 144 |
| 482 | 3300037418 | Ga0395900_0029293 | Ga0395900_0029293_3157_3591 | 144 |
| 483 | 3300037418 | Ga0395900_0037380 | Ga0395900_0037380_817_1251 | 144 |
| 484 | 3300037418 | Ga0395900_0039345 | Ga0395900_0039345_4249_4683 | 144 |
| 485 | 3300037418 | Ga0395900_0060587 | Ga0395900_0060587_3173_3607 | 144 |
| 486 | 3300037418 | Ga0395900_0073817 | Ga0395900_0073817_1125_1559 | 144 |
| 487 | 3300037418 | Ga0395900_0167963 | Ga0395900_0167963_636_1070 | 144 |
| 488 | 3300037466 | Ga0395898_0001155 | Ga0395898_0001155_8422_8856 | 144 |
| 489 | 3300037466 | Ga0395898_0021921 | Ga0395898_0021921_1245_1679 | 144 |
| 490 | 3300037466 | Ga0395898_0030751 | Ga0395898_0030751_1403_1837 | 144 |
| 491 | 3300037466 | Ga0395898_0101190 | Ga0395898_0101190_997_1431 | 144 |
| 492 | 3300037471 | Ga0395905_0002707 | Ga0395905_0002707_16920_17354 | 144 |
| 493 | 3300037471 | Ga0395905_0012996 | Ga0395905_0012996_4480_4914 | 144 |
| 494 | 3300037471 | Ga0395905_0014307 | Ga0395905_0014307_2083_2517 | 144 |
| 495 | 3300037471 | Ga0395905_0036792 | Ga0395905_0036792_4096_4530 | 144 |
| 496 | 3300037471 | Ga0395905_0105325 | Ga0395905_0105325_1240_1674 | 144 |
| 497 | 3300037471 | Ga0395905_0817382 | Ga0395905_0817382_67_501 | 144 |
| 498 | 3300038443 | Ga0395901_0004755 | Ga0395901_0004755_3517_3951 | 144 |
| 499 | 3300038443 | Ga0395901_0007186 | Ga0395901_0007186_2579_3013 | 144 |
| 500 | 3300038443 | Ga0395901_0089701 | Ga0395901_0089701_549_983 | 144 |
| 501 | 3300038443 | Ga0395901_0096147 | Ga0395901_0096147_2180_2614 | 144 |
| 502 | 3300038443 | Ga0395901_0126297 | Ga0395901_0126297_343_777 | 144 |
| 503 | 3300038443 | Ga0395901_0163596 | Ga0395901_0163596_1879_2313 | 144 |
| 504 | 3300041410 | Ga0439461_0017964 | Ga0439461_0017964_677_1126 | 144 |
| 505 | 3300041452 | Ga0451793_0399917 | Ga0451793_0399917_12_461 | 144 |
| 506 | 3300041459 | Ga0451800_1203668 | Ga0451800_1203668_97_531 | 144 |
| 507 | 3300041459 | Ga0451800_1386280 | Ga0451800_1386280_527_967 | 144 |
| 508 | 3300041460 | Ga0451802_0109468 | Ga0451802_0109468_41_529 | 144 |
| 509 | 3300041494 | Ga0451837_1295369 | Ga0451837_1295369_11_445 | 144 |
| 510 | 3300041509 | Ga0451843_0590208 | Ga0451843_0590208_141_575 | 144 |
| 511 | 3300041509 | Ga0451843_1222221 | Ga0451843_1222221_288_737 | 144 |
| 512 | 3300042003 | Ga0439443_060414 | Ga0439443_060414_92_529 | 144 |
| 513 | 3300042006 | Ga0439432_141933 | Ga0439432_141933_91_540 | 144 |
| 514 | 3300042007 | Ga0439449_0033477 | Ga0439449_0033477_1093_1527 | 144 |
| 515 | 3300042007 | Ga0439449_0055837 | Ga0439449_0055837_672_1121 | 144 |
| 516 | 3300042010 | Ga0439452_070197 | Ga0439452_070197_101_550 | 144 |
| 517 | 3300042015 | Ga0439462_0172952 | Ga0439462_0172952_67_501 | 144 |
| 518 | 3300042125 | Ga0450923_006724 | Ga0450923_006724_17_454 | 144 |
| 519 | 3300042156 | Ga0439446_0101884 | Ga0439446_0101884_38_472 | 144 |
| 520 | 3300042435 | Ga0439434_0007984 | Ga0439434_0007984_885_1334 | 144 |
| 521 | 3300042437 | Ga0439444_0079175 | Ga0439444_0079175_215_652 | 144 |
| 522 | 3300044656 | Ga0466969_0114639 | Ga0466969_0114639_202_636 | 144 |
| 523 | 3300044673 | Ga0453683_0564577 | Ga0453683_0564577_261_698 | 144 |
| 524 | 3300044712 | Ga0453684_0047342 | Ga0453684_0047342_2722_3156 | 144 |
| 525 | 3300044712 | Ga0453684_0315633 | Ga0453684_0315633_772_1206 | 144 |
| 526 | 3300045049 | Ga0466959_0102749 | Ga0466959_0102749_754_1266 | 144 |
| 527 | 3300045976 | Ga0466967_0199623 | Ga0466967_0199623_1072_1506 | 144 |
| 528 | 3300046539 | Ga0495621_0034299 | Ga0495621_0034299_409_846 | 144 |
| 529 | 3300047315 | Ga0495581_0393909 | Ga0495581_0393909_11_445 | 144 |
| 530 | 3300047320 | Ga0495672_0024295 | Ga0495672_0024295_337_786 | 144 |
| 531 | 3300047320 | Ga0495672_0284229 | Ga0495672_0284229_191_640 | 144 |
| 532 | 3300047321 | Ga0495676_0078176 | Ga0495676_0078176_1313_1747 | 144 |
| 533 | 3300048907 | Ga0496104_1369514 | Ga0496104_1369514_54_488 | 144 |
| 534 | 3300049523 | Ga0501300_061766 | Ga0501300_061766_77_511 | 144 |
| 535 | 3300049570 | Ga0501033_0072796 | Ga0501033_0072796_274_708 | 144 |
| 536 | 3300049571 | Ga0501034_0720378 | Ga0501034_0720378_351_785 | 144 |
| 537 | 3300049571 | Ga0501034_0904236 | Ga0501034_0904236_198_632 | 144 |
| 538 | 3300049581 | Ga0501047_1025706 | Ga0501047_1025706_145_579 | 144 |
| 539 | 3300049586 | Ga0501070_0212762 | Ga0501070_0212762_365_802 | 144 |
| 540 | 3300049651 | Ga0501201_010099 | Ga0501201_010099_183_719 | 144 |
| 541 | 3300049652 | Ga0501202_080467 | Ga0501202_080467_43_477 | 144 |
| 542 | 3300049665 | Ga0501227_026653 | Ga0501227_026653_145_681 | 144 |
| 543 | 3300049673 | Ga0501240_118176 | Ga0501240_118176_71_505 | 144 |
| 544 | 3300049680 | Ga0501250_004954 | Ga0501250_004954_654_1088 | 144 |
| 545 | 3300049680 | Ga0501250_013878 | Ga0501250_013878_215_649 | 144 |
| 546 | 3300049682 | Ga0501252_001409 | Ga0501252_001409_1568_2104 | 144 |
| 547 | 3300049686 | Ga0501257_207368 | Ga0501257_207368_119_553 | 144 |
| 548 | 3300049688 | Ga0501259_004751 | Ga0501259_004751_1470_2006 | 144 |
| 549 | 3300049705 | Ga0501225_0100467 | Ga0501225_0100467_188_622 | 144 |
| 550 | 3300049708 | Ga0501245_000547 | Ga0501245_000547_2322_2858 | 144 |
| 551 | 3300049763 | Ga0501266_005308 | Ga0501266_005308_193_729 | 144 |
| 552 | 3300049765 | Ga0501268_010463 | Ga0501268_010463_717_1151 | 144 |
| 553 | 3300049770 | Ga0501273_029537 | Ga0501273_029537_193_627 | 144 |
| 554 | 3300049778 | Ga0501282_031565 | Ga0501282_031565_34_468 | 144 |
| 555 | 3300049823 | Ga0501044_1138731 | Ga0501044_1138731_124_558 | 144 |
| 556 | 3300049823 | Ga0501044_1620327 | Ga0501044_1620327_60_494 | 144 |
| 557 | 3300050493 | nmdc:mga0k408_432391_c1 | nmdc:mga0k408_432391_c1_49_498 | 144 |
| 558 | 3300050507 | nmdc:mga05p37_255658_c1 | nmdc:mga05p37_255658_c1_136_573 | 144 |
| 559 | 3300050508 | nmdc:mga09592_531488_c1 | nmdc:mga09592_531488_c1_484_921 | 144 |
| 560 | 3300050508 | nmdc:mga09592_996_c1 | nmdc:mga09592_996_c1_16328_16819 | 144 |
| 561 | 3300050509 | nmdc:mga0qj67_9805_c1 | nmdc:mga0qj67_9805_c1_3233_3724 | 144 |
| 562 | 3300050510 | nmdc:mga06r32_1196595_c1 | nmdc:mga06r32_1196595_c1_154_591 | 144 |
| 563 | 3300050510 | nmdc:mga06r32_1387683_c1 | nmdc:mga06r32_1387683_c1_13_450 | 144 |
| 564 | 3300050510 | nmdc:mga06r32_64331_c1 | nmdc:mga06r32_64331_c1_740_1177 | 144 |
| 565 | 3300050511 | nmdc:mga08y16_101883_c1 | nmdc:mga08y16_101883_c1_1012_1452 | 144 |
| 566 | 3300050511 | nmdc:mga08y16_194305_c1 | nmdc:mga08y16_194305_c1_46_483 | 144 |
| 567 | 3300050511 | nmdc:mga08y16_783329_c1 | nmdc:mga08y16_783329_c1_156_596 | 144 |
| 568 | 3300050512 | nmdc:mga0n895_954761_c1 | nmdc:mga0n895_954761_c1_209_643 | 144 |
| 569 | 3300053129 | Ga0500628_060250 | Ga0500628_060250_80_529 | 144 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ibw-assembly1.cif.gz_B | crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a | 0.6327 | 18 | 131 |
| 6u9d-assembly2.cif.gz_W-2 | saccharomyces cerevisiae acetohydroxyacid synthase | 0.6109 | 18 | 133 |
| 6u9d-assembly2.cif.gz_S-2 | saccharomyces cerevisiae acetohydroxyacid synthase | 0.6037 | 17 | 133 |
| 3ibw-assembly1.cif.gz_B | crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a | 0.6036 | 18 | 131 |
| 2djw-assembly1.cif.gz_F | crystal structure of ttha0845 from thermus thermophilus hb8 | 0.5991 | 18 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2djwE01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.6443 | 18 | 131 | 3.30.70.920 |
| af_Q2FXU1_650_729_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.6098 | 18 | 133 | 3.30.70.260 |
| 2jsxA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.6086 | 18 | 131 | 3.30.70.920 |
| af_P9WHG9_657_737_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.6081 | 18 | 133 | 3.30.70.260 |
| 2djwE01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.6079 | 18 | 131 | 3.30.70.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522DE82-F1-model_v4 | IPExxxVDY family protein | 0.9507 | 65 | 144 |
|
| AF-A0A4Q5R5J3-F1-model_v4 | IPExxxVDY family protein | 0.9407 | 1 | 144 |
|
| AF-A0A4Q5TIS7-F1-model_v4 | IPExxxVDY family protein | 0.9396 | 22 | 144 |
|
| AF-A0A522DE82-F1-model_v4 | IPExxxVDY family protein | 0.9395 | 65 | 144 |
|
| AF-A0A4Q5R5J3-F1-model_v4 | IPExxxVDY family protein | 0.9344 | 1 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar