F464721

General Info

Members Datasets Scaffolds Average Seq Length
569 345 566 226

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10113280|Ga0114129_101132803
Length 266
Sequence LADAIVSWQSPCVLYRKEICMAERMNDLAGRVALVTGASRGIGKAVALXXXEXGADVAVNYRERGEEARVVAEVIAAFGRRSAAVRGDVADSEAVRKMVATVEHDIGPVDILVNNAGIAIRRGLDDLTEADFDRTVAVNLKSAFLCTQAVLPHMRAQRWGRVINISSGAARGFGIVGLHYNASKAGLEGLTRGYATRVVKEGITVNAVAPTLIETDMVTASPELAARVPLGRMGRSEEVAQAVLMVIGNAYMTGQTIQVNGGTHFI

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
337 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.18
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.75
Nodule 1.05
Rhizoplane 7.73
Rhizosphere 83.13
Stem 0
Stem Tuber 0
Unclassified 3.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10008419 3300003322 Bacteria 9888
2 Ga0055525_1000025 3300003759 Bacteria 347582
3 Ga0065715_10227956 3300005293 Bacteria 1234
4 Ga0070658_10050929 3300005327 Bacteria 3356
5 Ga0070658_10286647 3300005327 Bacteria 1403
6 Ga0070683_100015345 3300005329 Bacteria 6725
7 Ga0070683_100142631 3300005329 Bacteria 2269
8 Ga0070683_100279086 3300005329 Bacteria 1589
9 Ga0070683_100659229 3300005329 Bacteria 1002
10 Ga0070666_10208809 3300005335 Bacteria 1375
11 Ga0070680_100054166 3300005336 Bacteria 3274
12 Ga0070682_100064479 3300005337 Bacteria 2325
13 Ga0070660_100122216 3300005339 Bacteria 2078
14 Ga0070660_100241275 3300005339 Bacteria 1472
15 Ga0070689_100532399 3300005340 Bacteria 1010
16 Ga0070661_100180662 3300005344 Bacteria 1605
17 Ga0070675_100603499 3300005354 Bacteria 995
18 Ga0070671_100014371 3300005355 Bacteria 6395
19 Ga0070674_100036608 3300005356 Bacteria 3295
20 Ga0070659_100059218 3300005366 Bacteria 3024
21 Ga0070659_100103993 3300005366 Bacteria 2287
22 Ga0070709_10308735 3300005434 Bacteria 1157
23 Ga0070714_100139653 3300005435 Bacteria 2173
24 Ga0070713_100491640 3300005436 Bacteria 1157
25 Ga0070711_100002557 3300005439 Bacteria 10418
26 Ga0070705_100212756 3300005440 Bacteria 1334
27 Ga0070708_100176298 3300005445 Bacteria 1997
28 Ga0070708_100221465 3300005445 Bacteria 1774
29 Ga0070663_100012086 3300005455 Bacteria 5448
30 Ga0070663_100063240 3300005455 Bacteria 2671
31 Ga0070678_100011840 3300005456 Bacteria 5397
32 Ga0070678_100041478 3300005456 Bacteria 3263
33 Ga0070681_10145748 3300005458 Bacteria 2297
34 Ga0070681_10198307 3300005458 Bacteria 1926
35 Ga0068867_100009412 3300005459 Bacteria 6892
36 Ga0068867_100215356 3300005459 Bacteria 1545
37 Ga0070706_100027664 3300005467 Bacteria 5216
38 Ga0070707_100005034 3300005468 Bacteria 12391
39 Ga0070707_100239127 3300005468 Bacteria 1767
40 Ga0070698_100145423 3300005471 Bacteria 2320
41 Ga0070699_100581979 3300005518 Bacteria 1020
42 Ga0070679_100023383 3300005530 Bacteria 6049
43 Ga0070679_100083175 3300005530 Bacteria 3190
44 Ga0070684_100024248 3300005535 Bacteria 5086
45 Ga0070684_100153804 3300005535 Bacteria 2085
46 Ga0070684_100179971 3300005535 Bacteria 1922
47 Ga0070697_100087829 3300005536 Bacteria 2567
48 Ga0070697_100414836 3300005536 Unclassified 1170
49 Ga0070672_100331743 3300005543 Bacteria 1294
50 Ga0068855_100013239 3300005563 Bacteria 9948
51 Ga0068855_100055309 3300005563 Bacteria 4662
52 Ga0070664_100008099 3300005564 Bacteria 8494
53 Ga0068856_100000050 3300005614 Bacteria 108220
54 Ga0068856_100126034 3300005614 Bacteria 2564
55 Ga0068856_100175834 3300005614 Bacteria 2153
56 Ga0068856_100226003 3300005614 Bacteria 1887
57 Ga0068856_100305322 3300005614 Bacteria 1609
58 Ga0070702_100220132 3300005615 Bacteria 1269
59 Ga0068852_100038503 3300005616 Bacteria 4019
60 Ga0068864_100708691 3300005618 Bacteria 984
61 Ga0068861_100098000 3300005719 Bacteria 2326
62 Ga0068858_100350079 3300005842 Bacteria 1415
63 Ga0068860_100001542 3300005843 Bacteria 24802
64 Ga0068860_100196291 3300005843 Bacteria 1955
65 Ga0068862_100555275 3300005844 Bacteria 1097
66 Ga0081455_10000156 3300005937 Bacteria 82406
67 Ga0081455_10014081 3300005937 Bacteria 7861
68 Ga0081455_10019461 3300005937 Bacteria 6422
69 Ga0081455_10035073 3300005937 Bacteria 4488
70 Ga0081540_1010442 3300005983 Bacteria 6289
71 Ga0081539_10000220 3300005985 Bacteria 133834
72 Ga0070717_10170081 3300006028 Bacteria 1895
73 Ga0070717_10286119 3300006028 Bacteria 1463
74 Ga0070717_10409383 3300006028 Bacteria 1219
75 Ga0075365_10179135 3300006038 Bacteria 1481
76 Ga0075365_10261830 3300006038 Bacteria 1216
77 Ga0075432_10047710 3300006058 Bacteria 1506
78 Ga0070715_10145995 3300006163 Bacteria 1154
79 Ga0070716_100007511 3300006173 Bacteria 5372
80 Ga0070712_100260100 3300006175 Bacteria 1390
81 Ga0070712_100415473 3300006175 Unclassified 1114
82 Ga0075362_10010175 3300006177 Bacteria 3664
83 Ga0075362_10126289 3300006177 Bacteria 1214
84 Ga0075367_10343471 3300006178 Bacteria 942
85 Ga0075369_10096155 3300006186 Bacteria 1325
86 Ga0075428_100003218 3300006844 Bacteria 17867
87 Ga0075430_100183303 3300006846 Bacteria 1741
88 Ga0075431_100015919 3300006847 Bacteria 7629
89 Ga0075431_100087695 3300006847 Bacteria 3211
90 Ga0075431_100098758 3300006847 Bacteria 3014
91 Ga0075433_10016728 3300006852 Bacteria 6055
92 Ga0075434_100016586 3300006871 Bacteria 7083
93 Ga0075429_100001278 3300006880 Bacteria 20473
94 Ga0075429_100008235 3300006880 Bacteria 9064
95 Ga0075429_100026318 3300006880 Bacteria 5050
96 Ga0068865_100017220 3300006881 Bacteria 4644
97 Ga0099824_1011059 3300006942 Bacteria 10373
98 Ga0099822_1012158 3300006943 Bacteria 10347
99 Ga0075435_100252580 3300007076 Bacteria 1501
100 Ga0099795_10038100 3300007788 Bacteria 1695
101 Ga0099795_10154354 3300007788 Bacteria 942
102 Ga0105240_10018029 3300009093 Bacteria 9495
103 Ga0105240_10023440 3300009093 Bacteria 8160
104 Ga0105240_10243085 3300009093 Bacteria 2086
105 Ga0111539_10000530 3300009094 Bacteria 48418
106 Ga0111539_10065332 3300009094 Bacteria 4299
107 Ga0111539_10284131 3300009094 Bacteria 1926
108 Ga0105245_10013572 3300009098 Bacteria 7096
109 Ga0114129_10020594 3300009147 Bacteria 9379
110 Ga0114129_10113280 3300009147 Bacteria 3740
111 Ga0114129_10120587 3300009147 Bacteria 3611
112 Ga0114129_10124504 3300009147 Bacteria 3545
113 Ga0114129_10350211 3300009147 Bacteria 1957
114 Ga0105243_10021057 3300009148 Bacteria 4948
115 Ga0105242_10095956 3300009176 Bacteria 2504
116 Ga0105248_10042929 3300009177 Bacteria 5070
117 Ga0105248_10554102 3300009177 Bacteria 1297
118 Ga0105237_10219025 3300009545 Bacteria 1904
119 Ga0105237_10630826 3300009545 Bacteria 1079
120 Ga0105238_10008261 3300009551 Bacteria 10412
121 Ga0105238_10809571 3300009551 Bacteria 953
122 Ga0105249_10296036 3300009553 Bacteria 1621
123 Ga0105239_10061849 3300010375 Bacteria 4110
124 Ga0105239_10194302 3300010375 Bacteria 2272
125 Ga0157371_10132671 3300013102 Bacteria 1772
126 Ga0157370_10069454 3300013104 Bacteria 3327
127 Ga0157370_10147564 3300013104 Bacteria 2190
128 Ga0157369_10004231 3300013105 Bacteria 17000
129 Ga0157369_10663744 3300013105 Bacteria 1075
130 Ga0157374_10010696 3300013296 Bacteria 7905
131 Ga0157374_10031921 3300013296 Bacteria 4791
132 Ga0157378_10379265 3300013297 Bacteria 1388
133 Ga0163162_10015679 3300013306 Bacteria 7405
134 Ga0163162_10574513 3300013306 Bacteria 1254
135 Ga0157372_10231336 3300013307 Bacteria 2143
136 Ga0157375_10012064 3300013308 Bacteria 7654
137 Ga0157375_10264048 3300013308 Bacteria 1883
138 Ga0157375_10820172 3300013308 Bacteria 1078
139 Ga0163163_10006895 3300014325 Bacteria 9971
140 Ga0163163_10020344 3300014325 Bacteria 6248
141 Ga0163163_10866652 3300014325 Bacteria 966
142 Ga0157376_10008083 3300014969 Bacteria 7560
143 Ga0163161_10056138 3300017792 Bacteria 2860
144 Ga0206356_11686928 3300020070 Bacteria 828
145 Ga0213873_10074665 3300021358 Bacteria 940
146 Ga0213872_10029234 3300021361 Bacteria 2527
147 Ga0213872_10037684 3300021361 Unclassified 2208
148 Ga0213876_10009013 3300021384 Bacteria 5375
149 Ga0209563_100003 3300025230 Bacteria 1932942
150 Ga0209148_1000590 3300025254 Bacteria 33089
151 Ga0209233_1004497 3300025261 Bacteria 4731
152 Ga0207642_10278613 3300025899 Bacteria 961
153 Ga0207688_10032968 3300025901 Bacteria 2863
154 Ga0207688_10149582 3300025901 Bacteria 1378
155 Ga0207680_10180597 3300025903 Bacteria 1427
156 Ga0207699_10462260 3300025906 Bacteria 912
157 Ga0207705_10017941 3300025909 Bacteria 5062
158 Ga0207684_10010041 3300025910 Bacteria 8341
159 Ga0207684_10053380 3300025910 Bacteria 3431
160 Ga0207684_10281335 3300025910 Bacteria 1434
161 Ga0207707_10083857 3300025912 Bacteria 2783
162 Ga0207707_10090526 3300025912 Bacteria 2674
163 Ga0207695_10194253 3300025913 Bacteria 1946
164 Ga0207695_10274461 3300025913 Bacteria 1581
165 Ga0207671_10136388 3300025914 Bacteria 1887
166 Ga0207693_10362025 3300025915 Unclassified 1135
167 Ga0207660_10082639 3300025917 Bacteria 2363
168 Ga0207657_10019370 3300025919 Bacteria 6464
169 Ga0207657_10441184 3300025919 Bacteria 1022
170 Ga0207657_10543259 3300025919 Bacteria 909
171 Ga0207649_10220795 3300025920 Bacteria 1350
172 Ga0207649_10323198 3300025920 Bacteria 1134
173 Ga0207652_10014990 3300025921 Bacteria 6288
174 Ga0207652_10085603 3300025921 Bacteria 2762
175 Ga0207646_10002435 3300025922 Bacteria 21941
176 Ga0207646_10091778 3300025922 Bacteria 2718
177 Ga0207646_10201272 3300025922 Bacteria 1799
178 Ga0207646_10224389 3300025922 Unclassified 1697
179 Ga0207646_10337707 3300025922 Bacteria 1361
180 Ga0207650_10868217 3300025925 Bacteria 766
181 Ga0207659_10373069 3300025926 Bacteria 1188
182 Ga0207687_10039946 3300025927 Bacteria 3214
183 Ga0207700_10424045 3300025928 Bacteria 1169
184 Ga0207700_10547359 3300025928 Bacteria 1027
185 Ga0207664_10055565 3300025929 Bacteria 3142
186 Ga0207664_10120601 3300025929 Bacteria 2194
187 Ga0207664_10707892 3300025929 Bacteria 906
188 Ga0207644_10049690 3300025931 Bacteria 3004
189 Ga0207706_10024502 3300025933 Bacteria 5409
190 Ga0207686_10274860 3300025934 Bacteria 1241
191 Ga0207709_10011139 3300025935 Bacteria 4958
192 Ga0207709_10026119 3300025935 Bacteria 3351
193 Ga0207670_10332880 3300025936 Bacteria 1198
194 Ga0207669_10015538 3300025937 Bacteria 3841
195 Ga0207704_10004400 3300025938 Bacteria 6445
196 Ga0207704_10259696 3300025938 Bacteria 1309
197 Ga0207704_10486344 3300025938 Bacteria 992
198 Ga0207665_10063591 3300025939 Bacteria 2507
199 Ga0207665_10069236 3300025939 Bacteria 2406
200 Ga0207665_10162031 3300025939 Bacteria 1609
201 Ga0207665_10280905 3300025939 Bacteria 1239
202 Ga0207691_10297276 3300025940 Bacteria 1387
203 Ga0207691_10438690 3300025940 Bacteria 1112
204 Ga0207711_10164945 3300025941 Bacteria 2007
205 Ga0207689_10061064 3300025942 Bacteria 3099
206 Ga0207661_10000190 3300025944 Bacteria 39991
207 Ga0207661_10233963 3300025944 Bacteria 1628
208 Ga0207661_10315798 3300025944 Bacteria 1404
209 Ga0207679_10029891 3300025945 Bacteria 3798
210 Ga0207679_10065299 3300025945 Bacteria 2723
211 Ga0207667_10014052 3300025949 Bacteria 9139
212 Ga0207667_10024575 3300025949 Bacteria 6611
213 Ga0207651_10723985 3300025960 Bacteria 878
214 Ga0207651_10815254 3300025960 Bacteria 828
215 Ga0207668_10219227 3300025972 Bacteria 1527
216 Ga0207640_10091096 3300025981 Bacteria 2112
217 Ga0207677_10051431 3300026023 Bacteria 2794
218 Ga0207677_10543270 3300026023 Bacteria 1012
219 Ga0207678_10012679 3300026067 Bacteria 7407
220 Ga0207708_10567274 3300026075 Bacteria 959
221 Ga0207702_10000197 3300026078 Bacteria 71667
222 Ga0207702_10145220 3300026078 Bacteria 2152
223 Ga0207702_10235214 3300026078 Bacteria 1714
224 Ga0207702_10235293 3300026078 Bacteria 1714
225 Ga0207648_10038090 3300026089 Bacteria 4232
226 Ga0207648_10377994 3300026089 Bacteria 1281
227 Ga0207648_10622707 3300026089 Bacteria 996
228 Ga0207674_10147103 3300026116 Bacteria 2314
229 Ga0207674_10320848 3300026116 Bacteria 1498
230 Ga0207674_10333033 3300026116 Bacteria 1468
231 Ga0207675_100193789 3300026118 Bacteria 1950
232 Ga0207683_10045001 3300026121 Bacteria 3859
233 Ga0207683_10370128 3300026121 Bacteria 1316
234 Ga0207698_10010543 3300026142 Bacteria 5948
235 Ga0207698_10136945 3300026142 Bacteria 2102
236 Ga0209589_1000006 3300027357 Bacteria 436292
237 Ga0209489_100007 3300027361 Bacteria 436292
238 Ga0209700_100008 3300027363 Bacteria 436292
239 Ga0209588_1063288 3300027671 Bacteria 1196
240 Ga0209971_1032374 3300027682 Bacteria 1255
241 Ga0207428_10004136 3300027907 Bacteria 13912
242 Ga0207428_10006011 3300027907 Bacteria 11239
243 Ga0207428_10201582 3300027907 Bacteria 1497
244 Ga0268266_10239671 3300028379 Bacteria 1673
245 Ga0265319_1071362 3300028563 Bacteria 1113
246 Ga0265318_10018048 3300028577 Bacteria 2886
247 Ga0265322_10007102 3300028654 Bacteria 3282
248 Ga0265338_10013244 3300028800 Bacteria 9332
249 Ga0265320_10023737 3300031240 Bacteria 3257
250 Ga0265320_10095617 3300031240 Bacteria 1372
251 Ga0265340_10023806 3300031247 Bacteria 3118
252 Ga0265339_10021860 3300031249 Bacteria 3713
253 Ga0265327_10000493 3300031251 Bacteria 69042
254 Ga0265316_10025605 3300031344 Bacteria 4921
255 Ga0307509_10084453 3300031507 Bacteria 3270
256 Ga0307408_100006290 3300031548 Bacteria 7882
257 Ga0265313_10015356 3300031595 Bacteria 4465
258 Ga0307508_10067571 3300031616 Bacteria 3144
259 Ga0265314_10005339 3300031711 Bacteria 11618
260 Ga0265314_10223287 3300031711 Bacteria 1098
261 Ga0265342_10073470 3300031712 Bacteria 1989
262 Ga0307405_10026086 3300031731 Bacteria 3366
263 Ga0307410_10509933 3300031852 Bacteria 991
264 Ga0307406_10028243 3300031901 Bacteria 3388
265 Ga0307406_10616402 3300031901 Bacteria 897
266 Ga0307412_10023279 3300031911 Bacteria 3809
267 Ga0307412_10298363 3300031911 Bacteria 1272
268 Ga0307416_100114688 3300032002 Bacteria 2384
269 Ga0307411_10569420 3300032005 Bacteria 969
270 Ga0307415_100226691 3300032126 Bacteria 1502
271 Ga0373929_0027011 3300035085 Bacteria 1203
272 Ga0373923_0092553 3300035111 Bacteria 1324
273 Ga0373932_0047869 3300035112 Bacteria 1258
274 Ga0373936_0000007 3300035113 Bacteria 290641
275 Ga0373954_0000659 3300035118 Bacteria 13205
276 Ga0373954_0164926 3300035118 Bacteria 1084
277 Ga0373956_0004523 3300035119 Bacteria 5554
278 Ga0373957_0011611 3300035120 Bacteria 2946
279 Ga0373943_0237717 3300035170 Bacteria 1020
280 Ga0373955_0000335 3300035172 Bacteria 19651
281 Ga0373955_0399800 3300035172 Bacteria 835
282 Ga0373924_0012720 3300035410 Bacteria 3148
283 Ga0373931_0022655 3300035691 Bacteria 3163
284 Ga0373935_0304710 3300035692 Archaea 1127
285 Ga0373927_0191853 3300035695 Bacteria 1340
286 Ga0373927_0205395 3300035695 Bacteria 1293
287 Ga0373933_0030121 3300035724 Bacteria 3141
288 Ga0373937_0026361 3300036401 Bacteria 5252
289 Ga0373937_0974171 3300036401 Bacteria 797
290 Ga0316582_0202904 3300036647 Bacteria 1353
291 Ga0373925_0091969 3300037068 Unclassified 2320
292 Ga0395899_0004477 3300037312 Bacteria 10891
293 Ga0395899_0015816 3300037312 Bacteria 5752
294 Ga0395899_0030051 3300037312 Bacteria 4088
295 Ga0395899_0049891 3300037312 Bacteria 3109
296 Ga0395899_0110937 3300037312 Bacteria 1972
297 Ga0395899_0121071 3300037312 Bacteria 1874
298 Ga0395900_0000324 3300037418 Bacteria 70682
299 Ga0395900_0002902 3300037418 Bacteria 18675
300 Ga0395900_0016248 3300037418 Bacteria 7584
301 Ga0395900_0026991 3300037418 Bacteria 5878
302 Ga0395900_0031469 3300037418 Bacteria 5452
303 Ga0395900_0092391 3300037418 Bacteria 3109
304 Ga0395900_0214356 3300037418 Bacteria 1943
305 Ga0395900_0251278 3300037418 Bacteria 1769
306 Ga0395898_0044475 3300037466 Bacteria 4370
307 Ga0395898_0117142 3300037466 Bacteria 2552
308 Ga0395898_0158119 3300037466 Bacteria 2167
309 Ga0395898_0776067 3300037466 Bacteria 899
310 Ga0395905_0024811 3300037471 Bacteria 5658
311 Ga0395905_0138645 3300037471 Bacteria 2288
312 Ga0395905_0172813 3300037471 Bacteria 2029
313 Ga0395905_0265970 3300037471 Bacteria 1600
314 Ga0395905_0502888 3300037471 Bacteria 1112
315 Ga0395901_0000089 3300038443 Bacteria 124305
316 Ga0395901_0005708 3300038443 Bacteria 12596
317 Ga0395901_0237764 3300038443 Bacteria 1900
318 Ga0395901_0240222 3300038443 Bacteria 1889
319 Ga0395901_0267278 3300038443 Bacteria 1779
320 Ga0395901_0917669 3300038443 Bacteria 856
321 Ga0436365_1420650 3300039437 Bacteria 46154
322 Ga0436365_1600738 3300039437 Bacteria 1404
323 Ga0436361_0002710 3300039447 Bacteria 4140
324 Ga0436361_0457489 3300039447 Bacteria 1256
325 Ga0436362_0886852 3300039453 Bacteria 909
326 Ga0436362_0910589 3300039453 Bacteria 1507
327 Ga0439448_0000868 3300042005 Bacteria 7386
328 Ga0439435_0055683 3300042436 Bacteria 1141
329 Ga0439464_0022775 3300042439 Bacteria 1727
330 Ga0466969_0168002 3300044656 Bacteria 1006
331 Ga0466972_0088655 3300044658 Bacteria 1468
332 Ga0466965_0024013 3300044683 Bacteria 2947
333 Ga0466966_0032666 3300044684 Bacteria 3371
334 Ga0466966_0127733 3300044684 Bacteria 1558
335 Ga0466966_0171335 3300044684 Bacteria 1319
336 Ga0466961_0081668 3300044693 Bacteria 2045
337 Ga0466961_0128439 3300044693 Bacteria 1589
338 Ga0466963_0124760 3300044694 Bacteria 1774
339 Ga0466963_0183189 3300044694 Bacteria 1462
340 Ga0466964_0110619 3300044706 Bacteria 1224
341 Ga0453684_0615778 3300044712 Bacteria 1188
342 Ga0466971_0037692 3300044719 Bacteria 2168
343 Ga0466970_0052452 3300044765 Bacteria 2177
344 Ga0466970_0270032 3300044765 Bacteria 955
345 Ga0466957_0003950 3300044842 Bacteria 8195
346 Ga0466957_0107601 3300044842 Bacteria 1765
347 Ga0466957_0114060 3300044842 Bacteria 1716
348 Ga0466957_0148365 3300044842 Bacteria 1515
349 Ga0466960_0191651 3300044901 Bacteria 1113
350 Ga0466959_0007083 3300045049 Bacteria 7842
351 Ga0466959_0047268 3300045049 Bacteria 3165
352 Ga0466959_0175690 3300045049 Bacteria 1500
353 Ga0451576_1276630 3300045051 Bacteria 766
354 Ga0466958_0020701 3300045836 Bacteria 3838
355 Ga0466967_0026810 3300045976 Bacteria 4781
356 Ga0466967_0416412 3300045976 Bacteria 1309
357 Ga0466967_0631746 3300045976 Bacteria 1058
358 Ga0495592_0006367 3300046454 Bacteria 8792
359 Ga0495603_0057292 3300046455 Archaea 2306
360 Ga0495603_0092775 3300046455 Bacteria 1765
361 Ga0495603_0168875 3300046455 Bacteria 1267
362 Ga0495629_0002353 3300046459 Bacteria 14564
363 Ga0495629_0045702 3300046459 Bacteria 3072
364 Ga0495629_0112536 3300046459 Bacteria 1897
365 Ga0495653_0041016 3300046463 Bacteria 3615
366 Ga0495580_0127670 3300046472 Bacteria 1765
367 Ga0495582_0025264 3300046473 Bacteria 3254
368 Ga0495605_0000117 3300046474 Bacteria 103262
369 Ga0495605_0003312 3300046474 Bacteria 9648
370 Ga0495639_0018676 3300046475 Bacteria 3020
371 Ga0495639_0028217 3300046475 Bacteria 2486
372 Ga0495664_0129836 3300046477 Archaea 1525
373 Ga0495594_0084734 3300046499 Archaea 1772
374 Ga0495607_0001221 3300046501 Bacteria 23080
375 Ga0495607_0002442 3300046501 Bacteria 15135
376 Ga0495606_0216465 3300046507 Bacteria 1082
377 Ga0495608_0005147 3300046511 Bacteria 9345
378 Ga0495608_0095340 3300046511 Bacteria 1922
379 Ga0495608_0286525 3300046511 Bacteria 1021
380 Ga0495628_0163656 3300046516 Bacteria 1689
381 Ga0495630_0108049 3300046517 Archaea 2107
382 Ga0495632_0057182 3300046519 Bacteria 1905
383 Ga0495632_0187665 3300046519 Bacteria 945
384 Ga0495643_0000263 3300046522 Bacteria 76248
385 Ga0495666_0090833 3300046526 Archaea 1441
386 Ga0495642_0000907 3300046528 Bacteria 13909
387 Ga0495652_0148607 3300046529 Bacteria 1833
388 Ga0495665_0127794 3300046531 Archaea 1331
389 Ga0495640_0004127 3300046533 Bacteria 11621
390 Ga0495640_0080365 3300046533 Archaea 2168
391 Ga0495586_0035768 3300046535 Archaea 2668
392 Ga0495609_0000001 3300046538 Bacteria 1060094
393 Ga0495656_0001980 3300046615 Bacteria 6746
394 Ga0495656_0002791 3300046615 Bacteria 5839
395 Ga0495656_0015039 3300046615 Bacteria 2913
396 Ga0495668_0273560 3300046616 Bacteria 925
397 Ga0495635_0050435 3300046663 Bacteria 2868
398 Ga0495635_0065696 3300046663 Bacteria 2489
399 Ga0495635_0245052 3300046663 Bacteria 1209
400 Ga0495661_0000663 3300046665 Bacteria 34526
401 Ga0495661_0002221 3300046665 Bacteria 15090
402 Ga0495657_0066317 3300046675 Bacteria 2371
403 Ga0495599_0006109 3300046678 Bacteria 7253
404 Ga0495599_0058003 3300046678 Bacteria 2422
405 Ga0495623_0027760 3300046679 Bacteria 3644
406 Ga0495647_0016646 3300046681 Bacteria 2591
407 Ga0495658_0073406 3300046683 Archaea 1991
408 Ga0495658_0359373 3300046683 Bacteria 926
409 Ga0495669_0006435 3300046684 Bacteria 4904
410 Ga0495613_0040882 3300046689 Bacteria 3434
411 Ga0495613_0049001 3300046689 Bacteria 3118
412 Ga0495624_0243800 3300046690 Archaea 1087
413 Ga0495589_0000027 3300046794 Bacteria 181084
414 Ga0495589_0000974 3300046794 Bacteria 17471
415 Ga0495600_0088311 3300046809 Bacteria 2022
416 Ga0495660_0000054 3300046810 Bacteria 135325
417 Ga0495660_0076901 3300046810 Bacteria 1757
418 Ga0495581_0039677 3300047315 Bacteria 2726
419 Ga0495581_0079912 3300047315 Archaea 1892
420 Ga0495604_0150309 3300047317 Bacteria 1655
421 Ga0495604_0340351 3300047317 Bacteria 999
422 Ga0495674_0076014 3300047319 Unclassified 2889
423 Ga0495674_0410375 3300047319 Bacteria 1092
424 Ga0495672_0001329 3300047320 Bacteria 24574
425 Ga0495676_0089104 3300047321 Bacteria 2312
426 Ga0495680_0034539 3300047322 Bacteria 4081
427 Ga0495687_000019 3300047443 Bacteria 341756
428 Ga0495687_000287 3300047443 Bacteria 66402
429 Ga0495675_0003409 3300047444 Bacteria 9576
430 Ga0495677_0000020 3300047445 Bacteria 107093
431 Ga0495677_0000779 3300047445 Bacteria 12855
432 Ga0495673_0046634 3300047469 Bacteria 1919
433 Ga0495681_0099164 3300047470 Bacteria 1276
434 Ga0495684_0013598 3300047471 Bacteria 6267
435 Ga0495684_0080936 3300047471 Unclassified 2465
436 Ga0495686_0000054 3300047472 Bacteria 259400
437 Ga0495686_0120156 3300047472 Bacteria 1567
438 Ga0495593_0001736 3300047673 Bacteria 12917
439 Ga0495602_0099423 3300048088 Bacteria 2391
440 Ga0495614_0006299 3300048089 Bacteria 5333
441 Ga0495626_0000800 3300048091 Bacteria 28478
442 Ga0495626_0001889 3300048091 Bacteria 15658
443 Ga0496100_0045950 3300048903 Bacteria 2805
444 Ga0496100_0199378 3300048903 Bacteria 1458
445 Ga0496100_0421853 3300048903 Bacteria 1019
446 Ga0496100_0640046 3300048903 Bacteria 827
447 Ga0496101_0006299 3300048904 Bacteria 7640
448 Ga0496101_0007388 3300048904 Bacteria 7117
449 Ga0496101_0072062 3300048904 Bacteria 2535
450 Ga0496101_0276325 3300048904 Archaea 1312
451 Ga0496101_0393548 3300048904 Bacteria 1091
452 Ga0496102_0001495 3300048905 Bacteria 20650
453 Ga0496102_0087694 3300048905 Bacteria 2875
454 Ga0496103_0051764 3300048906 Bacteria 2542
455 Ga0496104_0110188 3300048907 Bacteria 2639
456 Ga0496104_0266192 3300048907 Bacteria 1626
457 Ga0496104_0618028 3300048907 Bacteria 993
458 Ga0496105_0013499 3300048908 Bacteria 6486
459 Ga0496105_0132893 3300048908 Bacteria 2050
460 Ga0496105_0138712 3300048908 Bacteria 2002
461 Ga0496105_0170645 3300048908 Bacteria 1783
462 Ga0496105_0565669 3300048908 Bacteria 886
463 Ga0496105_0706237 3300048908 Bacteria 774
464 Ga0496106_0024986 3300048909 Bacteria 4444
465 Ga0496106_0283797 3300048909 Bacteria 1327
466 Ga0496107_0016292 3300048910 Bacteria 5216
467 Ga0496108_0309099 3300048911 Bacteria 1377
468 Ga0496109_0085811 3300048912 Bacteria 2907
469 Ga0496109_0141375 3300048912 Bacteria 2250
470 Ga0496110_0222294 3300048913 Bacteria 1717
471 Ga0496110_0391035 3300048913 Bacteria 1268
472 Ga0496110_0460812 3300048913 Bacteria 1158
473 Ga0496111_0029884 3300048914 Bacteria 3872
474 Ga0496111_0060590 3300048914 Bacteria 2743
475 Ga0496111_0233289 3300048914 Bacteria 1367
476 Ga0496111_0623152 3300048914 Bacteria 789
477 Ga0496112_0004295 3300048915 Bacteria 12036
478 Ga0496112_0650197 3300048915 Bacteria 984
479 Ga0496113_0018959 3300048916 Bacteria 4803
480 Ga0496113_0343649 3300048916 Bacteria 1197
481 Ga0496114_0019092 3300048917 Bacteria 5555
482 Ga0496114_0070783 3300048917 Bacteria 2930
483 Ga0496114_0158625 3300048917 Bacteria 1966
484 Ga0496114_0210769 3300048917 Bacteria 1704
485 Ga0496115_0001988 3300048918 Bacteria 14603
486 Ga0496115_0261308 3300048918 Bacteria 1424
487 Ga0496119_0118951 3300048922 Bacteria 1455
488 Ga0496122_0002445 3300048925 Bacteria 26295
489 Ga0496122_0028323 3300048925 Bacteria 4758
490 Ga0496123_0001793 3300048926 Bacteria 28269
491 Ga0496123_0094998 3300048926 Bacteria 1755
492 Ga0496123_0219192 3300048926 Bacteria 961
493 Ga0496124_0004606 3300048927 Bacteria 15973
494 Ga0496124_0012480 3300048927 Bacteria 8385
495 Ga0496124_0133677 3300048927 Bacteria 1967
496 Ga0496126_0048866 3300048929 Bacteria 3863
497 Ga0496126_0211855 3300048929 Bacteria 1631
498 Ga0501031_0006301 3300049568 Bacteria 7734
499 Ga0501032_0000320 3300049569 Bacteria 40199
500 Ga0501033_0000968 3300049570 Bacteria 26054
501 Ga0501034_0000058 3300049571 Bacteria 198554
502 Ga0501036_0001143 3300049572 Bacteria 20195
503 Ga0501037_0000700 3300049573 Bacteria 25505
504 Ga0501038_0000059 3300049574 Bacteria 92319
505 Ga0501039_0001176 3300049575 Bacteria 19201
506 Ga0501040_0481625 3300049576 Bacteria 894
507 Ga0501041_0332608 3300049577 Bacteria 959
508 Ga0501043_0007372 3300049579 Bacteria 8728
509 Ga0501046_0002041 3300049580 Bacteria 19193
510 Ga0501047_0000022 3300049581 Bacteria 249062
511 Ga0501048_0001669 3300049582 Bacteria 16903
512 Ga0501067_0003092 3300049583 Bacteria 9187
513 Ga0501068_0015136 3300049584 Bacteria 4425
514 Ga0501070_0001070 3300049586 Bacteria 24549
515 Ga0501070_0042133 3300049586 Bacteria 3802
516 Ga0501073_0000604 3300049589 Bacteria 25323
517 Ga0501073_0345807 3300049589 Bacteria 1027
518 Ga0501074_0000028 3300049590 Bacteria 67595
519 Ga0501076_0160357 3300049592 Bacteria 1832
520 Ga0501076_0416660 3300049592 Bacteria 1105
521 Ga0501079_0001041 3300049741 Bacteria 19211
522 Ga0501080_0001713 3300049742 Bacteria 18728
523 Ga0501080_0059875 3300049742 Bacteria 3544
524 Ga0501080_0179275 3300049742 Bacteria 1950
525 Ga0501083_0001278 3300049744 Bacteria 17040
526 Ga0501035_0000240 3300049822 Bacteria 65635
527 Ga0501044_0025135 3300049823 Bacteria 6315
528 Ga0501044_0234513 3300049823 Bacteria 1781
529 Ga0501045_0007836 3300049824 Bacteria 7430
530 nmdc:mga03683_150150_c1 3300050489 Bacteria 1051
531 nmdc:mga03683_2041_c1 3300050489 Bacteria 6185
532 nmdc:mga0yw44_140863_c1 3300050492 Bacteria 1567
533 nmdc:mga0yw44_216580_c1 3300050492 Bacteria 1268
534 nmdc:mga0k408_55170_c1 3300050493 Bacteria 2303
535 nmdc:mga06z11_68282_c1 3300050494 Bacteria 1873
536 nmdc:mga07m45_17594_c3 3300050496 Bacteria 1011
537 nmdc:mga07m45_213717_c1 3300050496 Bacteria 1122
538 nmdc:mga05p37_313149_c1 3300050507 Bacteria 1860
539 nmdc:mga05p37_382_c1 3300050507 Bacteria 47795
540 nmdc:mga05p37_42707_c1 3300050507 Bacteria 5573
541 nmdc:mga05p37_50988_c1 3300050507 Bacteria 5089
542 nmdc:mga09592_12628_c1 3300050508 Bacteria 6886
543 nmdc:mga09592_3218_c1 3300050508 Bacteria 13223
544 nmdc:mga09592_6583_c1 3300050508 Bacteria 9462
545 nmdc:mga0qj67_168329_c1 3300050509 Bacteria 1779
546 nmdc:mga06r32_1110_c1 3300050510 Bacteria 24142
547 nmdc:mga08y16_5292_c1 3300050511 Bacteria 13496
548 nmdc:mga08y16_768_c1 3300050511 Bacteria 30549
549 nmdc:mga08y16_796031_c1 3300050511 Bacteria 938
550 nmdc:mga0n895_14188_c1 3300050512 Bacteria 7226
551 nmdc:mga0rr50_25988_c1 3300050513 Bacteria 1501
552 nmdc:mga0a205_18236_c1 3300050515 Bacteria 6594
553 nmdc:mga0a205_945903_c1 3300050515 Bacteria 708
554 nmdc:mga0sz30_86766_c1 3300050516 Bacteria 1359
555 Ga0495601_0118081 3300053077 Bacteria 1721
556 Ga0495595_0003363 3300053084 Bacteria 6349
557 Ga0500646_0039680 3300053090 Bacteria 1322
558 Ga0500555_036849 3300053103 Bacteria 1371
559 Ga0500562_021658 3300053108 Bacteria 1674
560 Ga0500595_000602 3300053119 Bacteria 21451
561 Ga0500595_002200 3300053119 Bacteria 9908
562 Ga0500616_0001188 3300053153 Bacteria 26456
563 Ga0500622_0039492 3300053156 Bacteria 2460
564 Ga0500552_001098 3300053733 Bacteria 2557
565 Ga0501084_0021521 3300054114 Bacteria 5375
566 Ga0501082_0000428 3300060353 Bacteria 37284

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035111 Ga0373923_0092553 Ga0373923_0092553_664_1251 158
2 3300046454 Ga0495592_0006367 Ga0495592_0006367_5303_5890 158
3 3300048916 Ga0496113_0018959 Ga0496113_0018959_4241_4789 158
4 3300050496 nmdc:mga07m45_213717_c1 nmdc:mga07m45_213717_c1_542_1099 158
5 3300039453 Ga0436362_0886852 Ga0436362_0886852_13_573 159
6 3300046511 Ga0495608_0286525 Ga0495608_0286525_54_605 159
7 3300009553 Ga0105249_10296036 Ga0105249_102960362 165
8 3300031240 Ga0265320_10023737 Ga0265320_100237374 168
9 3300042436 Ga0439435_0055683 Ga0439435_0055683_90_791 168
10 3300025935 Ga0207709_10011139 Ga0207709_100111394 169
11 3300025981 Ga0207640_10091096 Ga0207640_100910962 169
12 3300005455 Ga0070663_100063240 Ga0070663_1000632402 170
13 3300009147 Ga0114129_10124504 Ga0114129_101245042 170
14 3300050507 nmdc:mga05p37_42707_c1 nmdc:mga05p37_42707_c1_2643_3344 170
15 3300050515 nmdc:mga0a205_18236_c1 nmdc:mga0a205_18236_c1_3794_4495 170
16 3300050515 nmdc:mga0a205_945903_c1 nmdc:mga0a205_945903_c1_34_663 170
17 3300048908 Ga0496105_0706237 Ga0496105_0706237_89_742 171
18 3300006028 Ga0070717_10286119 Ga0070717_102861192 173
19 3300026142 Ga0207698_10010543 Ga0207698_100105433 173
20 3300025929 Ga0207664_10055565 Ga0207664_100555654 174
21 3300044901 Ga0466960_0191651 Ga0466960_0191651_145_879 175
22 3300050496 nmdc:mga07m45_17594_c3 nmdc:mga07m45_17594_c3_14_682 175
23 3300005329 Ga0070683_100015345 Ga0070683_1000153456 176
24 3300005456 Ga0070678_100041478 Ga0070678_1000414783 176
25 3300005458 Ga0070681_10145748 Ga0070681_101457482 176
26 3300005458 Ga0070681_10198307 Ga0070681_101983073 176
27 3300005535 Ga0070684_100024248 Ga0070684_1000242484 176
28 3300025901 Ga0207688_10032968 Ga0207688_100329682 176
29 3300025912 Ga0207707_10083857 Ga0207707_100838572 176
30 3300025912 Ga0207707_10090526 Ga0207707_100905264 176
31 3300025939 Ga0207665_10063591 Ga0207665_100635912 176
32 3300025944 Ga0207661_10000190 Ga0207661_100001909 176
33 3300031247 Ga0265340_10023806 Ga0265340_100238062 176
34 3300031616 Ga0307508_10067571 Ga0307508_100675712 176
35 3300031711 Ga0265314_10223287 Ga0265314_102232872 176
36 3300037466 Ga0395898_0776067 Ga0395898_0776067_22_786 176
37 3300048929 Ga0496126_0211855 Ga0496126_0211855_393_1130 176
38 3300005329 Ga0070683_100142631 Ga0070683_1001426311 177
39 3300005336 Ga0070680_100054166 Ga0070680_1000541664 177
40 3300005344 Ga0070661_100180662 Ga0070661_1001806622 177
41 3300005530 Ga0070679_100023383 Ga0070679_1000233835 177
42 3300005563 Ga0068855_100055309 Ga0068855_1000553091 177
43 3300005614 Ga0068856_100126034 Ga0068856_1001260345 177
44 3300005618 Ga0068864_100708691 Ga0068864_1007086911 177
45 3300006058 Ga0075432_10047710 Ga0075432_100477102 177
46 3300006175 Ga0070712_100260100 Ga0070712_1002601001 177
47 3300009093 Ga0105240_10018029 Ga0105240_100180298 177
48 3300009098 Ga0105245_10013572 Ga0105245_100135726 177
49 3300009176 Ga0105242_10095956 Ga0105242_100959562 177
50 3300009177 Ga0105248_10554102 Ga0105248_105541022 177
51 3300010375 Ga0105239_10194302 Ga0105239_101943022 177
52 3300013102 Ga0157371_10132671 Ga0157371_101326712 177
53 3300013104 Ga0157370_10069454 Ga0157370_100694544 177
54 3300013105 Ga0157369_10663744 Ga0157369_106637442 177
55 3300013296 Ga0157374_10031921 Ga0157374_100319212 177
56 3300013306 Ga0163162_10015679 Ga0163162_100156798 177
57 3300014325 Ga0163163_10020344 Ga0163163_100203444 177
58 3300014969 Ga0157376_10008083 Ga0157376_100080835 177
59 3300025901 Ga0207688_10149582 Ga0207688_101495821 177
60 3300025913 Ga0207695_10274461 Ga0207695_102744612 177
61 3300025920 Ga0207649_10323198 Ga0207649_103231982 177
62 3300025921 Ga0207652_10085603 Ga0207652_100856032 177
63 3300025927 Ga0207687_10039946 Ga0207687_100399463 177
64 3300025928 Ga0207700_10547359 Ga0207700_105473591 177
65 3300025949 Ga0207667_10014052 Ga0207667_100140526 177
66 3300025960 Ga0207651_10815254 Ga0207651_108152541 177
67 3300026023 Ga0207677_10051431 Ga0207677_100514313 177
68 3300026067 Ga0207678_10012679 Ga0207678_100126798 177
69 3300026078 Ga0207702_10235293 Ga0207702_102352932 177
70 3300031711 Ga0265314_10005339 Ga0265314_100053396 177
71 3300035118 Ga0373954_0000659 Ga0373954_0000659_11430_12167 177
72 3300035119 Ga0373956_0004523 Ga0373956_0004523_4288_5025 177
73 3300035120 Ga0373957_0011611 Ga0373957_0011611_1359_2096 177
74 3300035172 Ga0373955_0000335 Ga0373955_0000335_11366_12103 177
75 3300035410 Ga0373924_0012720 Ga0373924_0012720_1036_1773 177
76 3300035695 Ga0373927_0191853 Ga0373927_0191853_223_960 177
77 3300035724 Ga0373933_0030121 Ga0373933_0030121_735_1472 177
78 3300036401 Ga0373937_0026361 Ga0373937_0026361_3506_4243 177
79 3300046459 Ga0495629_0002353 Ga0495629_0002353_5878_6615 177
80 3300046463 Ga0495653_0041016 Ga0495653_0041016_1655_2392 177
81 3300046511 Ga0495608_0095340 Ga0495608_0095340_1138_1875 177
82 3300046516 Ga0495628_0163656 Ga0495628_0163656_326_1063 177
83 3300046529 Ga0495652_0148607 Ga0495652_0148607_320_1057 177
84 3300046533 Ga0495640_0004127 Ga0495640_0004127_10256_10993 177
85 3300046663 Ga0495635_0050435 Ga0495635_0050435_1235_1972 177
86 3300046675 Ga0495657_0066317 Ga0495657_0066317_897_1634 177
87 3300046678 Ga0495599_0058003 Ga0495599_0058003_834_1571 177
88 3300046679 Ga0495623_0027760 Ga0495623_0027760_2643_3380 177
89 3300046689 Ga0495613_0040882 Ga0495613_0040882_851_1588 177
90 3300046809 Ga0495600_0088311 Ga0495600_0088311_752_1489 177
91 3300047317 Ga0495604_0150309 Ga0495604_0150309_842_1579 177
92 3300047319 Ga0495674_0410375 Ga0495674_0410375_104_841 177
93 3300047322 Ga0495680_0034539 Ga0495680_0034539_852_1589 177
94 3300047444 Ga0495675_0003409 Ga0495675_0003409_6497_7234 177
95 3300047469 Ga0495673_0046634 Ga0495673_0046634_1135_1872 177
96 3300047471 Ga0495684_0013598 Ga0495684_0013598_1138_1875 177
97 3300047673 Ga0495593_0001736 Ga0495593_0001736_11357_12094 177
98 3300048088 Ga0495602_0099423 Ga0495602_0099423_127_864 177
99 3300048904 Ga0496101_0007388 Ga0496101_0007388_2677_3414 177
100 3300048905 Ga0496102_0001495 Ga0496102_0001495_15669_16406 177
101 3300048906 Ga0496103_0051764 Ga0496103_0051764_1428_2165 177
102 3300048909 Ga0496106_0024986 Ga0496106_0024986_3473_4210 177
103 3300048913 Ga0496110_0222294 Ga0496110_0222294_870_1607 177
104 3300048914 Ga0496111_0060590 Ga0496111_0060590_1225_1962 177
105 3300048915 Ga0496112_0004295 Ga0496112_0004295_3664_4401 177
106 3300048917 Ga0496114_0019092 Ga0496114_0019092_3090_3827 177
107 3300048918 Ga0496115_0001988 Ga0496115_0001988_9515_10252 177
108 3300049568 Ga0501031_0006301 Ga0501031_0006301_1212_1946 177
109 3300049569 Ga0501032_0000320 Ga0501032_0000320_8379_9113 177
110 3300049570 Ga0501033_0000968 Ga0501033_0000968_8400_9134 177
111 3300049571 Ga0501034_0000058 Ga0501034_0000058_189421_190155 177
112 3300049572 Ga0501036_0001143 Ga0501036_0001143_8725_9459 177
113 3300049573 Ga0501037_0000700 Ga0501037_0000700_8400_9134 177
114 3300049574 Ga0501038_0000059 Ga0501038_0000059_75144_75878 177
115 3300049575 Ga0501039_0001176 Ga0501039_0001176_10068_10802 177
116 3300049579 Ga0501043_0007372 Ga0501043_0007372_2681_3415 177
117 3300049580 Ga0501046_0002041 Ga0501046_0002041_10308_11042 177
118 3300049581 Ga0501047_0000022 Ga0501047_0000022_96828_97562 177
119 3300049582 Ga0501048_0001669 Ga0501048_0001669_8769_9503 177
120 3300049583 Ga0501067_0003092 Ga0501067_0003092_5444_6178 177
121 3300049584 Ga0501068_0015136 Ga0501068_0015136_1047_1781 177
122 3300049586 Ga0501070_0001070 Ga0501070_0001070_7095_7829 177
123 3300049589 Ga0501073_0000604 Ga0501073_0000604_16936_17670 177
124 3300049590 Ga0501074_0000028 Ga0501074_0000028_58462_59196 177
125 3300049592 Ga0501076_0160357 Ga0501076_0160357_1014_1748 177
126 3300049741 Ga0501079_0001041 Ga0501079_0001041_10088_10822 177
127 3300049742 Ga0501080_0001713 Ga0501080_0001713_3702_4436 177
128 3300049744 Ga0501083_0001278 Ga0501083_0001278_7708_8442 177
129 3300049822 Ga0501035_0000240 Ga0501035_0000240_48776_49510 177
130 3300049823 Ga0501044_0025135 Ga0501044_0025135_2901_3635 177
131 3300049824 Ga0501045_0007836 Ga0501045_0007836_5809_6543 177
132 3300053084 Ga0495595_0003363 Ga0495595_0003363_3561_4298 177
133 3300054114 Ga0501084_0021521 Ga0501084_0021521_702_1436 177
134 3300005293 Ga0065715_10227956 Ga0065715_102279561 178
135 3300005337 Ga0070682_100064479 Ga0070682_1000644792 178
136 3300005355 Ga0070671_100014371 Ga0070671_1000143713 178
137 3300005439 Ga0070711_100002557 Ga0070711_1000025579 178
138 3300005455 Ga0070663_100012086 Ga0070663_1000120863 178
139 3300006028 Ga0070717_10170081 Ga0070717_101700812 178
140 3300006163 Ga0070715_10145995 Ga0070715_101459951 178
141 3300006844 Ga0075428_100003218 Ga0075428_1000032185 178
142 3300006847 Ga0075431_100015919 Ga0075431_1000159196 178
143 3300006871 Ga0075434_100016586 Ga0075434_1000165864 178
144 3300006880 Ga0075429_100001278 Ga0075429_10000127810 178
145 3300006880 Ga0075429_100008235 Ga0075429_1000082352 178
146 3300007076 Ga0075435_100252580 Ga0075435_1002525801 178
147 3300009094 Ga0111539_10000530 Ga0111539_1000053038 178
148 3300009147 Ga0114129_10020594 Ga0114129_100205943 178
149 3300009147 Ga0114129_10120587 Ga0114129_101205873 178
150 3300013307 Ga0157372_10231336 Ga0157372_102313362 178
151 3300013308 Ga0157375_10012064 Ga0157375_100120646 178
152 3300025906 Ga0207699_10462260 Ga0207699_104622601 178
153 3300025931 Ga0207644_10049690 Ga0207644_100496902 178
154 3300025940 Ga0207691_10438690 Ga0207691_104386901 178
155 3300026121 Ga0207683_10370128 Ga0207683_103701282 178
156 3300027671 Ga0209588_1063288 Ga0209588_10632882 178
157 3300027907 Ga0207428_10004136 Ga0207428_100041362 178
158 3300028563 Ga0265319_1071362 Ga0265319_10713621 178
159 3300028577 Ga0265318_10018048 Ga0265318_100180485 178
160 3300028654 Ga0265322_10007102 Ga0265322_100071022 178
161 3300028800 Ga0265338_10013244 Ga0265338_100132446 178
162 3300031240 Ga0265320_10095617 Ga0265320_100956172 178
163 3300031344 Ga0265316_10025605 Ga0265316_100256054 178
164 3300031548 Ga0307408_100006290 Ga0307408_1000062908 178
165 3300031712 Ga0265342_10073470 Ga0265342_100734702 178
166 3300031731 Ga0307405_10026086 Ga0307405_100260865 178
167 3300031901 Ga0307406_10028243 Ga0307406_100282433 178
168 3300031911 Ga0307412_10023279 Ga0307412_100232793 178
169 3300032005 Ga0307411_10569420 Ga0307411_105694201 178
170 3300039447 Ga0436361_0002710 Ga0436361_0002710_1406_2143 178
171 3300039447 Ga0436361_0457489 Ga0436361_0457489_237_974 178
172 3300042439 Ga0439464_0022775 Ga0439464_0022775_741_1496 178
173 3300046507 Ga0495606_0216465 Ga0495606_0216465_189_926 178
174 3300048908 Ga0496105_0013499 Ga0496105_0013499_3291_4028 178
175 3300050507 nmdc:mga05p37_382_c1 nmdc:mga05p37_382_c1_31711_32466 178
176 3300050508 nmdc:mga09592_12628_c1 nmdc:mga09592_12628_c1_3360_4115 178
177 3300050508 nmdc:mga09592_6583_c1 nmdc:mga09592_6583_c1_3577_4332 178
178 3300050510 nmdc:mga06r32_1110_c1 nmdc:mga06r32_1110_c1_22735_23490 178
179 3300050511 nmdc:mga08y16_5292_c1 nmdc:mga08y16_5292_c1_7914_8669 178
180 3300050511 nmdc:mga08y16_796031_c1 nmdc:mga08y16_796031_c1_147_890 178
181 3300050512 nmdc:mga0n895_14188_c1 nmdc:mga0n895_14188_c1_1331_2068 178
182 3300050513 nmdc:mga0rr50_25988_c1 nmdc:mga0rr50_25988_c1_284_1021 178
183 3300053119 Ga0500595_002200 Ga0500595_002200_5119_5856 178
184 3300060353 Ga0501082_0000428 Ga0501082_0000428_26984_27766 178
185 3300005339 Ga0070660_100241275 Ga0070660_1002412751 179
186 3300005340 Ga0070689_100532399 Ga0070689_1005323991 179
187 3300005543 Ga0070672_100331743 Ga0070672_1003317432 179
188 3300005614 Ga0068856_100226003 Ga0068856_1002260032 179
189 3300005844 Ga0068862_100555275 Ga0068862_1005552752 179
190 3300025919 Ga0207657_10543259 Ga0207657_105432591 179
191 3300025936 Ga0207670_10332880 Ga0207670_103328801 179
192 3300026078 Ga0207702_10235214 Ga0207702_102352142 179
193 3300026116 Ga0207674_10333033 Ga0207674_103330331 179
194 3300027682 Ga0209971_1032374 Ga0209971_10323742 179
195 3300031249 Ga0265339_10021860 Ga0265339_100218602 179
196 3300031595 Ga0265313_10015356 Ga0265313_100153562 179
197 3300031911 Ga0307412_10298363 Ga0307412_102983632 179
198 3300032002 Ga0307416_100114688 Ga0307416_1001146882 179
199 3300032126 Ga0307415_100226691 Ga0307415_1002266912 179
200 3300048915 Ga0496112_0650197 Ga0496112_0650197_155_895 179
201 3300053733 Ga0500552_001098 Ga0500552_001098_1106_1837 179
202 3300005530 Ga0070679_100083175 Ga0070679_1000831753 180
203 3300006852 Ga0075433_10016728 Ga0075433_100167282 180
204 3300025921 Ga0207652_10014990 Ga0207652_100149904 180
205 3300044694 Ga0466963_0183189 Ga0466963_0183189_396_1127 180
206 3300046663 Ga0495635_0065696 Ga0495635_0065696_1226_2014 180
207 3300046678 Ga0495599_0006109 Ga0495599_0006109_3408_4148 180
208 3300048922 Ga0496119_0118951 Ga0496119_0118951_87_827 180
209 3300005436 Ga0070713_100491640 Ga0070713_1004916402 181
210 3300005615 Ga0070702_100220132 Ga0070702_1002201322 181
211 3300006177 Ga0075362_10010175 Ga0075362_100101752 181
212 3300025903 Ga0207680_10180597 Ga0207680_101805972 181
213 3300025928 Ga0207700_10424045 Ga0207700_104240452 181
214 3300049592 Ga0501076_0416660 Ga0501076_0416660_176_907 181
215 3300050489 nmdc:mga03683_2041_c1 nmdc:mga03683_2041_c1_3178_3912 181
216 3300005440 Ga0070705_100212756 Ga0070705_1002127562 182
217 3300005535 Ga0070684_100153804 Ga0070684_1001538042 182
218 3300005614 Ga0068856_100175834 Ga0068856_1001758342 182
219 3300009093 Ga0105240_10023440 Ga0105240_100234403 182
220 3300014325 Ga0163163_10866652 Ga0163163_108666522 182
221 3300025913 Ga0207695_10194253 Ga0207695_101942532 182
222 3300026078 Ga0207702_10145220 Ga0207702_101452202 182
223 3300037418 Ga0395900_0031469 Ga0395900_0031469_801_1538 182
224 3300037466 Ga0395898_0117142 Ga0395898_0117142_1397_2134 182
225 3300048908 Ga0496105_0170645 Ga0496105_0170645_751_1458 182
226 3300048912 Ga0496109_0141375 Ga0496109_0141375_1374_2081 182
227 3300044684 Ga0466966_0127733 Ga0466966_0127733_127_903 183
228 3300044712 Ga0453684_0615778 Ga0453684_0615778_212_952 183
229 3300006943 Ga0099822_1012158 Ga0099822_101215812 184
230 3300035112 Ga0373932_0047869 Ga0373932_0047869_445_1179 184
231 3300026075 Ga0207708_10567274 Ga0207708_105672741 185
232 3300031507 Ga0307509_10084453 Ga0307509_100844533 185
233 3300046455 Ga0495603_0168875 Ga0495603_0168875_101_838 185
234 3300047470 Ga0495681_0099164 Ga0495681_0099164_262_999 185
235 3300049742 Ga0501080_0179275 Ga0501080_0179275_195_932 185
236 3300053156 Ga0500622_0039492 Ga0500622_0039492_110_832 185
237 3300005329 Ga0070683_100279086 Ga0070683_1002790862 186
238 3300005842 Ga0068858_100350079 Ga0068858_1003500791 186
239 3300025925 Ga0207650_10868217 Ga0207650_108682171 186
240 3300025944 Ga0207661_10233963 Ga0207661_102339632 186
241 3300035113 Ga0373936_0000007 Ga0373936_0000007_268548_269297 186
242 3300045051 Ga0451576_1276630 Ga0451576_1276630_12_749 186
243 3300048929 Ga0496126_0048866 Ga0496126_0048866_1413_2147 186
244 3300009094 Ga0111539_10284131 Ga0111539_102841312 187
245 3300047315 Ga0495581_0039677 Ga0495581_0039677_1802_2539 187
246 3300050509 nmdc:mga0qj67_168329_c1 nmdc:mga0qj67_168329_c1_859_1659 187
247 3300053103 Ga0500555_036849 Ga0500555_036849_52_789 187
248 3300053108 Ga0500562_021658 Ga0500562_021658_136_873 187
249 3300005937 Ga0081455_10035073 Ga0081455_100350732 188
250 3300009551 Ga0105238_10809571 Ga0105238_108095712 188
251 3300013308 Ga0157375_10264048 Ga0157375_102640482 188
252 3300049576 Ga0501040_0481625 Ga0501040_0481625_60_803 188
253 3300049577 Ga0501041_0332608 Ga0501041_0332608_98_841 188
254 3300005329 Ga0070683_100659229 Ga0070683_1006592292 189
255 3300005335 Ga0070666_10208809 Ga0070666_102088092 189
256 3300005354 Ga0070675_100603499 Ga0070675_1006034991 189
257 3300005356 Ga0070674_100036608 Ga0070674_1000366082 189
258 3300005456 Ga0070678_100011840 Ga0070678_1000118405 189
259 3300005459 Ga0068867_100009412 Ga0068867_1000094123 189
260 3300005535 Ga0070684_100179971 Ga0070684_1001799712 189
261 3300005719 Ga0068861_100098000 Ga0068861_1000980003 189
262 3300006881 Ga0068865_100017220 Ga0068865_1000172204 189
263 3300013104 Ga0157370_10147564 Ga0157370_101475642 189
264 3300013105 Ga0157369_10004231 Ga0157369_1000423116 189
265 3300017792 Ga0163161_10056138 Ga0163161_100561381 189
266 3300020070 Ga0206356_11686928 Ga0206356_116869281 189
267 3300025899 Ga0207642_10278613 Ga0207642_102786131 189
268 3300025926 Ga0207659_10373069 Ga0207659_103730692 189
269 3300025937 Ga0207669_10015538 Ga0207669_100155382 189
270 3300025938 Ga0207704_10004400 Ga0207704_100044004 189
271 3300025940 Ga0207691_10297276 Ga0207691_102972762 189
272 3300026089 Ga0207648_10038090 Ga0207648_100380904 189
273 3300026118 Ga0207675_100193789 Ga0207675_1001937892 189
274 3300046615 Ga0495656_0002791 Ga0495656_0002791_485_1222 189
275 3300046616 Ga0495668_0273560 Ga0495668_0273560_10_747 189
276 3300046684 Ga0495669_0006435 Ga0495669_0006435_3762_4499 189
277 3300048903 Ga0496100_0640046 Ga0496100_0640046_39_776 189
278 3300048904 Ga0496101_0072062 Ga0496101_0072062_1501_2238 189
279 3300035118 Ga0373954_0164926 Ga0373954_0164926_105_842 190
280 3300045976 Ga0466967_0416412 Ga0466967_0416412_177_914 190
281 3300046455 Ga0495603_0092775 Ga0495603_0092775_669_1406 190
282 3300046475 Ga0495639_0028217 Ga0495639_0028217_384_1121 190
283 3300053077 Ga0495601_0118081 Ga0495601_0118081_695_1432 190
284 3300026089 Ga0207648_10377994 Ga0207648_103779942 191
285 3300046519 Ga0495632_0057182 Ga0495632_0057182_751_1488 191
286 3300005843 Ga0068860_100196291 Ga0068860_1001962912 193
287 3300007788 Ga0099795_10154354 Ga0099795_101543541 193
288 3300031901 Ga0307406_10616402 Ga0307406_106164021 193
289 3300035170 Ga0373943_0237717 Ga0373943_0237717_158_895 193
290 3300036401 Ga0373937_0974171 Ga0373937_0974171_35_757 193
291 3300048918 Ga0496115_0261308 Ga0496115_0261308_524_1258 193
292 3300005445 Ga0070708_100221465 Ga0070708_1002214652 194
293 3300005471 Ga0070698_100145423 Ga0070698_1001454232 194
294 3300005843 Ga0068860_100001542 Ga0068860_10000154222 194
295 3300005937 Ga0081455_10000156 Ga0081455_1000015629 194
296 3300005937 Ga0081455_10014081 Ga0081455_100140813 194
297 3300005983 Ga0081540_1010442 Ga0081540_10104423 194
298 3300006038 Ga0075365_10179135 Ga0075365_101791352 194
299 3300006038 Ga0075365_10261830 Ga0075365_102618301 194
300 3300006178 Ga0075367_10343471 Ga0075367_103434711 194
301 3300006186 Ga0075369_10096155 Ga0075369_100961551 194
302 3300007788 Ga0099795_10038100 Ga0099795_100381002 194
303 3300025261 Ga0209233_1004497 Ga0209233_10044973 194
304 3300025910 Ga0207684_10281335 Ga0207684_102813352 194
305 3300025922 Ga0207646_10091778 Ga0207646_100917783 194
306 3300025942 Ga0207689_10061064 Ga0207689_100610642 194
307 3300026121 Ga0207683_10045001 Ga0207683_100450013 194
308 3300026142 Ga0207698_10136945 Ga0207698_101369451 194
309 3300045976 Ga0466967_0631746 Ga0466967_0631746_31_756 194
310 3300046459 Ga0495629_0112536 Ga0495629_0112536_101_838 194
311 3300046663 Ga0495635_0245052 Ga0495635_0245052_207_944 194
312 3300047472 Ga0495686_0120156 Ga0495686_0120156_599_1369 194
313 3300050492 nmdc:mga0yw44_140863_c1 nmdc:mga0yw44_140863_c1_664_1395 194
314 3300050492 nmdc:mga0yw44_216580_c1 nmdc:mga0yw44_216580_c1_309_1040 194
315 3300050493 nmdc:mga0k408_55170_c1 nmdc:mga0k408_55170_c1_683_1414 194
316 3300050494 nmdc:mga06z11_68282_c1 nmdc:mga06z11_68282_c1_420_1151 194
317 3300050516 nmdc:mga0sz30_86766_c1 nmdc:mga0sz30_86766_c1_407_1138 194
318 3300053153 Ga0500616_0001188 Ga0500616_0001188_25591_26322 194
319 iso_pu_bacteria 8006964411 8006965126 194
320 3300005614 Ga0068856_100000050 Ga0068856_10000005079 195
321 3300005937 Ga0081455_10019461 Ga0081455_100194614 195
322 3300006175 Ga0070712_100415473 Ga0070712_1004154732 195
323 3300006177 Ga0075362_10126289 Ga0075362_101262891 195
324 3300009177 Ga0105248_10042929 Ga0105248_100429295 195
325 3300009545 Ga0105237_10630826 Ga0105237_106308262 195
326 3300010375 Ga0105239_10061849 Ga0105239_100618495 195
327 3300013306 Ga0163162_10574513 Ga0163162_105745132 195
328 3300021361 Ga0213872_10029234 Ga0213872_100292342 195
329 3300025910 Ga0207684_10010041 Ga0207684_100100412 195
330 3300025915 Ga0207693_10362025 Ga0207693_103620251 195
331 3300025922 Ga0207646_10224389 Ga0207646_102243892 195
332 3300025934 Ga0207686_10274860 Ga0207686_102748601 195
333 3300025941 Ga0207711_10164945 Ga0207711_101649452 195
334 3300026078 Ga0207702_10000197 Ga0207702_100001975 195
335 3300031251 Ga0265327_10000493 Ga0265327_1000049310 195
336 3300035085 Ga0373929_0027011 Ga0373929_0027011_18_752 195
337 3300035691 Ga0373931_0022655 Ga0373931_0022655_1514_2248 195
338 3300035695 Ga0373927_0205395 Ga0373927_0205395_539_1273 195
339 3300036647 Ga0316582_0202904 Ga0316582_0202904_341_1069 195
340 3300045049 Ga0466959_0047268 Ga0466959_0047268_1074_1808 195
341 3300048903 Ga0496100_0421853 Ga0496100_0421853_257_991 195
342 3300048904 Ga0496101_0006299 Ga0496101_0006299_6339_7073 195
343 3300048905 Ga0496102_0087694 Ga0496102_0087694_285_1052 195
344 3300048907 Ga0496104_0266192 Ga0496104_0266192_191_958 195
345 3300048908 Ga0496105_0138712 Ga0496105_0138712_223_957 195
346 3300048910 Ga0496107_0016292 Ga0496107_0016292_3514_4248 195
347 3300048913 Ga0496110_0391035 Ga0496110_0391035_322_1056 195
348 3300048914 Ga0496111_0029884 Ga0496111_0029884_1127_1894 195
349 3300048917 Ga0496114_0070783 Ga0496114_0070783_669_1403 195
350 3300050489 nmdc:mga03683_150150_c1 nmdc:mga03683_150150_c1_203_934 195
351 3300005445 Ga0070708_100176298 Ga0070708_1001762983 196
352 3300005467 Ga0070706_100027664 Ga0070706_1000276642 196
353 3300005468 Ga0070707_100005034 Ga0070707_1000050348 196
354 3300005468 Ga0070707_100239127 Ga0070707_1002391273 196
355 3300005536 Ga0070697_100087829 Ga0070697_1000878293 196
356 3300005536 Ga0070697_100414836 Ga0070697_1004148362 196
357 3300005614 Ga0068856_100305322 Ga0068856_1003053222 196
358 3300005985 Ga0081539_10000220 Ga0081539_1000022020 196
359 3300006173 Ga0070716_100007511 Ga0070716_1000075112 196
360 3300006846 Ga0075430_100183303 Ga0075430_1001833032 196
361 3300006847 Ga0075431_100087695 Ga0075431_1000876951 196
362 3300006847 Ga0075431_100098758 Ga0075431_1000987582 196
363 3300006880 Ga0075429_100026318 Ga0075429_1000263184 196
364 3300006942 Ga0099824_1011059 Ga0099824_10110593 196
365 3300009094 Ga0111539_10065332 Ga0111539_100653323 196
366 3300009147 Ga0114129_10113280 Ga0114129_101132803 196
367 3300009147 Ga0114129_10350211 Ga0114129_103502112 196
368 3300009545 Ga0105237_10219025 Ga0105237_102190252 196
369 3300009551 Ga0105238_10008261 Ga0105238_100082612 196
370 3300021358 Ga0213873_10074665 Ga0213873_100746651 196
371 3300021384 Ga0213876_10009013 Ga0213876_100090138 196
372 3300025910 Ga0207684_10053380 Ga0207684_100533806 196
373 3300025914 Ga0207671_10136388 Ga0207671_101363882 196
374 3300025922 Ga0207646_10002435 Ga0207646_1000243511 196
375 3300025922 Ga0207646_10201272 Ga0207646_102012723 196
376 3300025922 Ga0207646_10337707 Ga0207646_103377071 196
377 3300025938 Ga0207704_10486344 Ga0207704_104863441 196
378 3300025939 Ga0207665_10069236 Ga0207665_100692362 196
379 3300025939 Ga0207665_10162031 Ga0207665_101620312 196
380 3300025939 Ga0207665_10280905 Ga0207665_102809052 196
381 3300025960 Ga0207651_10723985 Ga0207651_107239851 196
382 3300025972 Ga0207668_10219227 Ga0207668_102192272 196
383 3300026116 Ga0207674_10147103 Ga0207674_101471033 196
384 3300027357 Ga0209589_1000006 Ga0209589_100000634 196
385 3300027361 Ga0209489_100007 Ga0209489_10000734 196
386 3300027363 Ga0209700_100008 Ga0209700_10000834 196
387 3300027907 Ga0207428_10006011 Ga0207428_100060113 196
388 3300027907 Ga0207428_10201582 Ga0207428_102015821 196
389 3300028379 Ga0268266_10239671 Ga0268266_102396712 196
390 3300031852 Ga0307410_10509933 Ga0307410_105099332 196
391 3300035692 Ga0373935_0304710 Ga0373935_0304710_324_1055 196
392 3300037068 Ga0373925_0091969 Ga0373925_0091969_1177_1908 196
393 3300039437 Ga0436365_1420650 Ga0436365_1420650_12173_12916 196
394 3300039453 Ga0436362_0910589 Ga0436362_0910589_666_1409 196
395 3300046455 Ga0495603_0057292 Ga0495603_0057292_1001_1732 196
396 3300046459 Ga0495629_0045702 Ga0495629_0045702_302_1033 196
397 3300046473 Ga0495582_0025264 Ga0495582_0025264_2206_2937 196
398 3300046475 Ga0495639_0018676 Ga0495639_0018676_850_1581 196
399 3300046477 Ga0495664_0129836 Ga0495664_0129836_208_939 196
400 3300046499 Ga0495594_0084734 Ga0495594_0084734_935_1666 196
401 3300046517 Ga0495630_0108049 Ga0495630_0108049_329_1060 196
402 3300046526 Ga0495666_0090833 Ga0495666_0090833_580_1311 196
403 3300046531 Ga0495665_0127794 Ga0495665_0127794_151_882 196
404 3300046533 Ga0495640_0080365 Ga0495640_0080365_876_1607 196
405 3300046535 Ga0495586_0035768 Ga0495586_0035768_1114_1845 196
406 3300046681 Ga0495647_0016646 Ga0495647_0016646_406_1137 196
407 3300046683 Ga0495658_0073406 Ga0495658_0073406_358_1089 196
408 3300046683 Ga0495658_0359373 Ga0495658_0359373_35_772 196
409 3300046689 Ga0495613_0049001 Ga0495613_0049001_674_1405 196
410 3300046690 Ga0495624_0243800 Ga0495624_0243800_256_987 196
411 3300047315 Ga0495581_0079912 Ga0495581_0079912_1002_1733 196
412 3300047319 Ga0495674_0076014 Ga0495674_0076014_1609_2340 196
413 3300047321 Ga0495676_0089104 Ga0495676_0089104_1456_2187 196
414 3300047471 Ga0495684_0080936 Ga0495684_0080936_551_1282 196
415 3300048089 Ga0495614_0006299 Ga0495614_0006299_170_901 196
416 3300048903 Ga0496100_0045950 Ga0496100_0045950_1668_2399 196
417 3300048904 Ga0496101_0276325 Ga0496101_0276325_20_751 196
418 3300048908 Ga0496105_0565669 Ga0496105_0565669_73_804 196
419 3300048917 Ga0496114_0158625 Ga0496114_0158625_589_1320 196
420 3300049586 Ga0501070_0042133 Ga0501070_0042133_753_1484 196
421 3300049589 Ga0501073_0345807 Ga0501073_0345807_160_897 196
422 3300049742 Ga0501080_0059875 Ga0501080_0059875_577_1308 196
423 3300050507 nmdc:mga05p37_313149_c1 nmdc:mga05p37_313149_c1_949_1686 196
424 3300050507 nmdc:mga05p37_50988_c1 nmdc:mga05p37_50988_c1_2019_2819 196
425 3300050508 nmdc:mga09592_3218_c1 nmdc:mga09592_3218_c1_2621_3358 196
426 3300050511 nmdc:mga08y16_768_c1 nmdc:mga08y16_768_c1_23549_24286 196
427 3300053090 Ga0500646_0039680 Ga0500646_0039680_376_1113 196
428 3300053119 Ga0500595_000602 Ga0500595_000602_11997_12734 196
429 3300005434 Ga0070709_10308735 Ga0070709_103087351 197
430 3300005435 Ga0070714_100139653 Ga0070714_1001396531 197
431 3300005518 Ga0070699_100581979 Ga0070699_1005819791 197
432 3300006028 Ga0070717_10409383 Ga0070717_104093832 197
433 3300013296 Ga0157374_10010696 Ga0157374_100106964 197
434 3300013308 Ga0157375_10820172 Ga0157375_108201721 197
435 3300014325 Ga0163163_10006895 Ga0163163_100068957 197
436 3300021361 Ga0213872_10037684 Ga0213872_100376843 197
437 3300025929 Ga0207664_10120601 Ga0207664_101206012 197
438 3300025929 Ga0207664_10707892 Ga0207664_107078922 197
439 3300026023 Ga0207677_10543270 Ga0207677_105432701 197
440 3300035172 Ga0373955_0399800 Ga0373955_0399800_57_797 197
441 3300039437 Ga0436365_1600738 Ga0436365_1600738_428_1168 197
442 3300046472 Ga0495580_0127670 Ga0495580_0127670_997_1737 197
443 3300046511 Ga0495608_0005147 Ga0495608_0005147_5741_6472 197
444 3300047317 Ga0495604_0340351 Ga0495604_0340351_60_791 197
445 3300048911 Ga0496108_0309099 Ga0496108_0309099_232_972 197
446 3300026089 Ga0207648_10622707 Ga0207648_106227071 200
447 3300044842 Ga0466957_0107601 Ga0466957_0107601_663_1448 201
448 3300045836 Ga0466958_0020701 Ga0466958_0020701_722_1507 201
449 3300025944 Ga0207661_10315798 Ga0207661_103157982 202
450 3300044706 Ga0466964_0110619 Ga0466964_0110619_234_992 202
451 3300044719 Ga0466971_0037692 Ga0466971_0037692_266_1009 202
452 3300009093 Ga0105240_10243085 Ga0105240_102430853 203
453 3300037418 Ga0395900_0092391 Ga0395900_0092391_186_929 203
454 3300044658 Ga0466972_0088655 Ga0466972_0088655_10_768 203
455 3300044684 Ga0466966_0171335 Ga0466966_0171335_167_925 203
456 3300044693 Ga0466961_0081668 Ga0466961_0081668_1262_2020 203
457 3300044765 Ga0466970_0052452 Ga0466970_0052452_1327_2085 203
458 3300044842 Ga0466957_0148365 Ga0466957_0148365_531_1289 203
459 3300045049 Ga0466959_0175690 Ga0466959_0175690_186_944 203
460 3300046615 Ga0495656_0015039 Ga0495656_0015039_1339_2097 203
461 3300046810 Ga0495660_0076901 Ga0495660_0076901_832_1590 203
462 3300048927 Ga0496124_0004606 Ga0496124_0004606_13399_14142 203
463 3300049823 Ga0501044_0234513 Ga0501044_0234513_283_1041 203
464 3300005339 Ga0070660_100122216 Ga0070660_1001222162 204
465 3300005366 Ga0070659_100103993 Ga0070659_1001039932 204
466 3300005459 Ga0068867_100215356 Ga0068867_1002153562 204
467 3300025919 Ga0207657_10441184 Ga0207657_104411842 204
468 3300025935 Ga0207709_10026119 Ga0207709_100261195 204
469 3300025938 Ga0207704_10259696 Ga0207704_102596962 204
470 3300025945 Ga0207679_10029891 Ga0207679_100298912 204
471 3300026116 Ga0207674_10320848 Ga0207674_103208482 204
472 3300037312 Ga0395899_0049891 Ga0395899_0049891_660_1406 204
473 3300037312 Ga0395899_0110937 Ga0395899_0110937_473_1219 204
474 3300037418 Ga0395900_0000324 Ga0395900_0000324_34361_35119 204
475 3300037418 Ga0395900_0016248 Ga0395900_0016248_1452_2198 204
476 3300038443 Ga0395901_0000089 Ga0395901_0000089_89660_90418 204
477 3300038443 Ga0395901_0237764 Ga0395901_0237764_760_1506 204
478 3300044656 Ga0466969_0168002 Ga0466969_0168002_80_838 204
479 3300044694 Ga0466963_0124760 Ga0466963_0124760_1019_1762 204
480 3300045976 Ga0466967_0026810 Ga0466967_0026810_1940_2683 204
481 3300048913 Ga0496110_0460812 Ga0496110_0460812_146_892 204
482 3300048914 Ga0496111_0623152 Ga0496111_0623152_10_753 204
483 3300048917 Ga0496114_0210769 Ga0496114_0210769_207_953 204
484 iso_pu_bacteria 2643221556 2643799297 204
485 iso_pu_bacteria 2643221684 2644473370 204
486 3300005327 Ga0070658_10050929 Ga0070658_100509293 205
487 3300005563 Ga0068855_100013239 Ga0068855_1000132392 205
488 3300005564 Ga0070664_100008099 Ga0070664_1000080998 205
489 3300005616 Ga0068852_100038503 Ga0068852_1000385034 205
490 3300009148 Ga0105243_10021057 Ga0105243_100210573 205
491 3300013297 Ga0157378_10379265 Ga0157378_103792652 205
492 3300025909 Ga0207705_10017941 Ga0207705_100179412 205
493 3300025920 Ga0207649_10220795 Ga0207649_102207952 205
494 3300025933 Ga0207706_10024502 Ga0207706_100245025 205
495 3300025945 Ga0207679_10065299 Ga0207679_100652992 205
496 3300037312 Ga0395899_0030051 Ga0395899_0030051_2709_3452 205
497 3300037312 Ga0395899_0121071 Ga0395899_0121071_867_1613 205
498 3300037418 Ga0395900_0026991 Ga0395900_0026991_818_1561 205
499 3300037418 Ga0395900_0214356 Ga0395900_0214356_701_1447 205
500 3300037466 Ga0395898_0158119 Ga0395898_0158119_92_838 205
501 3300037471 Ga0395905_0024811 Ga0395905_0024811_682_1428 205
502 3300037471 Ga0395905_0138645 Ga0395905_0138645_451_1197 205
503 3300037471 Ga0395905_0265970 Ga0395905_0265970_490_1233 205
504 3300038443 Ga0395901_0005708 Ga0395901_0005708_4467_5210 205
505 3300038443 Ga0395901_0240222 Ga0395901_0240222_12_758 205
506 3300038443 Ga0395901_0917669 Ga0395901_0917669_19_765 205
507 3300044683 Ga0466965_0024013 Ga0466965_0024013_321_1064 205
508 3300044684 Ga0466966_0032666 Ga0466966_0032666_1532_2275 205
509 3300044842 Ga0466957_0003950 Ga0466957_0003950_2780_3523 205
510 3300044842 Ga0466957_0114060 Ga0466957_0114060_328_1071 205
511 3300048904 Ga0496101_0393548 Ga0496101_0393548_102_890 205
512 3300048907 Ga0496104_0110188 Ga0496104_0110188_707_1495 205
513 3300048908 Ga0496105_0132893 Ga0496105_0132893_41_829 205
514 3300048909 Ga0496106_0283797 Ga0496106_0283797_451_1239 205
515 3300048914 Ga0496111_0233289 Ga0496111_0233289_100_858 205
516 3300048916 Ga0496113_0343649 Ga0496113_0343649_224_982 205
517 3300048925 Ga0496122_0028323 Ga0496122_0028323_1121_1879 205
518 3300048926 Ga0496123_0001793 Ga0496123_0001793_20757_21515 205
519 3300048926 Ga0496123_0219192 Ga0496123_0219192_12_770 205
520 3300048927 Ga0496124_0133677 Ga0496124_0133677_1024_1782 205
521 3300003322 rootL2_10008419 rootL2_100084193 206
522 3300003759 Ga0055525_1000025 Ga0055525_100002564 206
523 3300005327 Ga0070658_10286647 Ga0070658_102866471 206
524 3300005366 Ga0070659_100059218 Ga0070659_1000592182 206
525 3300025230 Ga0209563_100003 Ga0209563_100003840 206
526 3300025254 Ga0209148_1000590 Ga0209148_100059021 206
527 3300025917 Ga0207660_10082639 Ga0207660_100826391 206
528 3300025919 Ga0207657_10019370 Ga0207657_100193706 206
529 3300025949 Ga0207667_10024575 Ga0207667_100245753 206
530 3300037312 Ga0395899_0004477 Ga0395899_0004477_4464_5210 206
531 3300037312 Ga0395899_0015816 Ga0395899_0015816_2832_3620 206
532 3300037418 Ga0395900_0002902 Ga0395900_0002902_5093_5839 206
533 3300037418 Ga0395900_0251278 Ga0395900_0251278_833_1621 206
534 3300037466 Ga0395898_0044475 Ga0395898_0044475_2492_3280 206
535 3300037471 Ga0395905_0172813 Ga0395905_0172813_1093_1881 206
536 3300037471 Ga0395905_0502888 Ga0395905_0502888_55_801 206
537 3300038443 Ga0395901_0267278 Ga0395901_0267278_568_1326 206
538 3300042005 Ga0439448_0000868 Ga0439448_0000868_5614_6402 206
539 3300044693 Ga0466961_0128439 Ga0466961_0128439_482_1267 206
540 3300044765 Ga0466970_0270032 Ga0466970_0270032_65_823 206
541 3300045049 Ga0466959_0007083 Ga0466959_0007083_6128_6886 206
542 3300046474 Ga0495605_0000117 Ga0495605_0000117_26495_27241 206
543 3300046474 Ga0495605_0003312 Ga0495605_0003312_8008_8766 206
544 3300046501 Ga0495607_0001221 Ga0495607_0001221_1073_1831 206
545 3300046501 Ga0495607_0002442 Ga0495607_0002442_12947_13693 206
546 3300046519 Ga0495632_0187665 Ga0495632_0187665_16_762 206
547 3300046522 Ga0495643_0000263 Ga0495643_0000263_59174_59920 206
548 3300046528 Ga0495642_0000907 Ga0495642_0000907_1858_2604 206
549 3300046538 Ga0495609_0000001 Ga0495609_0000001_248882_249640 206
550 3300046615 Ga0495656_0001980 Ga0495656_0001980_4266_5024 206
551 3300046665 Ga0495661_0000663 Ga0495661_0000663_27762_28520 206
552 3300046665 Ga0495661_0002221 Ga0495661_0002221_12961_13707 206
553 3300046794 Ga0495589_0000027 Ga0495589_0000027_6153_6911 206
554 3300046794 Ga0495589_0000974 Ga0495589_0000974_300_1046 206
555 3300046810 Ga0495660_0000054 Ga0495660_0000054_16329_17075 206
556 3300047320 Ga0495672_0001329 Ga0495672_0001329_13653_14399 206
557 3300047443 Ga0495687_000019 Ga0495687_000019_248882_249640 206
558 3300047443 Ga0495687_000287 Ga0495687_000287_12519_13265 206
559 3300047445 Ga0495677_0000020 Ga0495677_0000020_78082_78840 206
560 3300047445 Ga0495677_0000779 Ga0495677_0000779_245_991 206
561 3300047472 Ga0495686_0000054 Ga0495686_0000054_214954_215748 206
562 3300048091 Ga0495626_0000800 Ga0495626_0000800_5537_6283 206
563 3300048091 Ga0495626_0001889 Ga0495626_0001889_10527_11285 206
564 3300048903 Ga0496100_0199378 Ga0496100_0199378_382_1128 206
565 3300048907 Ga0496104_0618028 Ga0496104_0618028_94_840 206
566 3300048912 Ga0496109_0085811 Ga0496109_0085811_1801_2547 206
567 3300048925 Ga0496122_0002445 Ga0496122_0002445_24015_24761 206
568 3300048926 Ga0496123_0094998 Ga0496123_0094998_605_1351 206
569 3300048927 Ga0496124_0012480 Ga0496124_0012480_2718_3476 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

264

0.95

PF00106

adh_short

short chain dehydrogenase

31

225

0.94

PF08659

KR

KR domain

32

209

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zgw-assembly1.cif.gz_A short-chain dehydrogenase/reductase from serratia marcescens bcrc 10948 0.9671 3 206
5wul-assembly1.cif.gz_A serratia marcescens short-chain dehydrogenase/reductase f98a/f202l 0.9671 3 206
5wuw-assembly1.cif.gz_A-2 serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant 0.9647 3 206
5wva-assembly1.cif.gz_A-2 serratia marcescens short-chain dehydrogenase/reductase f98y/f202y mutant 0.9642 3 206
6j7h-assembly1.cif.gz_C crystal structure of blue fluorescent protein from metagenomic library 0.9622 3 206
ID Description Score Start End Superfamily
5z2lB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9513 3 204 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 2 203 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9318 2 203 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9297 2 203 3.40.50.720
5z2lB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9287 3 204 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5C6YUC4-F1-model_v4 SDR family oxidoreductase 0.9942 49 206 GO:0016616
AF-A0A0P9PQ17-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9935 44 206 GO:0016616
AF-A0A4Y9RIH2-F1-model_v4 SDR family oxidoreductase 0.9923 82 206 GO:0016616
AF-A0A532B9A9-F1-model_v4 SDR family oxidoreductase 0.9916 42 203 GO:0016616
AF-C4WHM3-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9914 73 203 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.41 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map