F464721
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 345 | 566 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10113280|Ga0114129_101132803 |
| Length | 266 |
| Sequence | LADAIVSWQSPCVLYRKEICMAERMNDLAGRVALVTGASRGIGKAVALXXXEXGADVAVNYRERGEEARVVAEVIAAFGRRSAAVRGDVADSEAVRKMVATVEHDIGPVDILVNNAGIAIRRGLDDLTEADFDRTVAVNLKSAFLCTQAVLPHMRAQRWGRVINISSGAARGFGIVGLHYNASKAGLEGLTRGYATRVVKEGITVNAVAPTLIETDMVTASPELAARVPLGRMGRSEEVAQAVLMVIGNAYMTGQTIQVNGGTHFI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 2 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 66 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 197 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 198 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 199 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 200 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 201 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 202 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 323 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 334 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 337 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 339 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 342 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.75 |
| Nodule | 1.05 |
| Rhizoplane | 7.73 |
| Rhizosphere | 83.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10008419 | 3300003322 | Bacteria | 9888 |
| 2 | Ga0055525_1000025 | 3300003759 | Bacteria | 347582 |
| 3 | Ga0065715_10227956 | 3300005293 | Bacteria | 1234 |
| 4 | Ga0070658_10050929 | 3300005327 | Bacteria | 3356 |
| 5 | Ga0070658_10286647 | 3300005327 | Bacteria | 1403 |
| 6 | Ga0070683_100015345 | 3300005329 | Bacteria | 6725 |
| 7 | Ga0070683_100142631 | 3300005329 | Bacteria | 2269 |
| 8 | Ga0070683_100279086 | 3300005329 | Bacteria | 1589 |
| 9 | Ga0070683_100659229 | 3300005329 | Bacteria | 1002 |
| 10 | Ga0070666_10208809 | 3300005335 | Bacteria | 1375 |
| 11 | Ga0070680_100054166 | 3300005336 | Bacteria | 3274 |
| 12 | Ga0070682_100064479 | 3300005337 | Bacteria | 2325 |
| 13 | Ga0070660_100122216 | 3300005339 | Bacteria | 2078 |
| 14 | Ga0070660_100241275 | 3300005339 | Bacteria | 1472 |
| 15 | Ga0070689_100532399 | 3300005340 | Bacteria | 1010 |
| 16 | Ga0070661_100180662 | 3300005344 | Bacteria | 1605 |
| 17 | Ga0070675_100603499 | 3300005354 | Bacteria | 995 |
| 18 | Ga0070671_100014371 | 3300005355 | Bacteria | 6395 |
| 19 | Ga0070674_100036608 | 3300005356 | Bacteria | 3295 |
| 20 | Ga0070659_100059218 | 3300005366 | Bacteria | 3024 |
| 21 | Ga0070659_100103993 | 3300005366 | Bacteria | 2287 |
| 22 | Ga0070709_10308735 | 3300005434 | Bacteria | 1157 |
| 23 | Ga0070714_100139653 | 3300005435 | Bacteria | 2173 |
| 24 | Ga0070713_100491640 | 3300005436 | Bacteria | 1157 |
| 25 | Ga0070711_100002557 | 3300005439 | Bacteria | 10418 |
| 26 | Ga0070705_100212756 | 3300005440 | Bacteria | 1334 |
| 27 | Ga0070708_100176298 | 3300005445 | Bacteria | 1997 |
| 28 | Ga0070708_100221465 | 3300005445 | Bacteria | 1774 |
| 29 | Ga0070663_100012086 | 3300005455 | Bacteria | 5448 |
| 30 | Ga0070663_100063240 | 3300005455 | Bacteria | 2671 |
| 31 | Ga0070678_100011840 | 3300005456 | Bacteria | 5397 |
| 32 | Ga0070678_100041478 | 3300005456 | Bacteria | 3263 |
| 33 | Ga0070681_10145748 | 3300005458 | Bacteria | 2297 |
| 34 | Ga0070681_10198307 | 3300005458 | Bacteria | 1926 |
| 35 | Ga0068867_100009412 | 3300005459 | Bacteria | 6892 |
| 36 | Ga0068867_100215356 | 3300005459 | Bacteria | 1545 |
| 37 | Ga0070706_100027664 | 3300005467 | Bacteria | 5216 |
| 38 | Ga0070707_100005034 | 3300005468 | Bacteria | 12391 |
| 39 | Ga0070707_100239127 | 3300005468 | Bacteria | 1767 |
| 40 | Ga0070698_100145423 | 3300005471 | Bacteria | 2320 |
| 41 | Ga0070699_100581979 | 3300005518 | Bacteria | 1020 |
| 42 | Ga0070679_100023383 | 3300005530 | Bacteria | 6049 |
| 43 | Ga0070679_100083175 | 3300005530 | Bacteria | 3190 |
| 44 | Ga0070684_100024248 | 3300005535 | Bacteria | 5086 |
| 45 | Ga0070684_100153804 | 3300005535 | Bacteria | 2085 |
| 46 | Ga0070684_100179971 | 3300005535 | Bacteria | 1922 |
| 47 | Ga0070697_100087829 | 3300005536 | Bacteria | 2567 |
| 48 | Ga0070697_100414836 | 3300005536 | Unclassified | 1170 |
| 49 | Ga0070672_100331743 | 3300005543 | Bacteria | 1294 |
| 50 | Ga0068855_100013239 | 3300005563 | Bacteria | 9948 |
| 51 | Ga0068855_100055309 | 3300005563 | Bacteria | 4662 |
| 52 | Ga0070664_100008099 | 3300005564 | Bacteria | 8494 |
| 53 | Ga0068856_100000050 | 3300005614 | Bacteria | 108220 |
| 54 | Ga0068856_100126034 | 3300005614 | Bacteria | 2564 |
| 55 | Ga0068856_100175834 | 3300005614 | Bacteria | 2153 |
| 56 | Ga0068856_100226003 | 3300005614 | Bacteria | 1887 |
| 57 | Ga0068856_100305322 | 3300005614 | Bacteria | 1609 |
| 58 | Ga0070702_100220132 | 3300005615 | Bacteria | 1269 |
| 59 | Ga0068852_100038503 | 3300005616 | Bacteria | 4019 |
| 60 | Ga0068864_100708691 | 3300005618 | Bacteria | 984 |
| 61 | Ga0068861_100098000 | 3300005719 | Bacteria | 2326 |
| 62 | Ga0068858_100350079 | 3300005842 | Bacteria | 1415 |
| 63 | Ga0068860_100001542 | 3300005843 | Bacteria | 24802 |
| 64 | Ga0068860_100196291 | 3300005843 | Bacteria | 1955 |
| 65 | Ga0068862_100555275 | 3300005844 | Bacteria | 1097 |
| 66 | Ga0081455_10000156 | 3300005937 | Bacteria | 82406 |
| 67 | Ga0081455_10014081 | 3300005937 | Bacteria | 7861 |
| 68 | Ga0081455_10019461 | 3300005937 | Bacteria | 6422 |
| 69 | Ga0081455_10035073 | 3300005937 | Bacteria | 4488 |
| 70 | Ga0081540_1010442 | 3300005983 | Bacteria | 6289 |
| 71 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 72 | Ga0070717_10170081 | 3300006028 | Bacteria | 1895 |
| 73 | Ga0070717_10286119 | 3300006028 | Bacteria | 1463 |
| 74 | Ga0070717_10409383 | 3300006028 | Bacteria | 1219 |
| 75 | Ga0075365_10179135 | 3300006038 | Bacteria | 1481 |
| 76 | Ga0075365_10261830 | 3300006038 | Bacteria | 1216 |
| 77 | Ga0075432_10047710 | 3300006058 | Bacteria | 1506 |
| 78 | Ga0070715_10145995 | 3300006163 | Bacteria | 1154 |
| 79 | Ga0070716_100007511 | 3300006173 | Bacteria | 5372 |
| 80 | Ga0070712_100260100 | 3300006175 | Bacteria | 1390 |
| 81 | Ga0070712_100415473 | 3300006175 | Unclassified | 1114 |
| 82 | Ga0075362_10010175 | 3300006177 | Bacteria | 3664 |
| 83 | Ga0075362_10126289 | 3300006177 | Bacteria | 1214 |
| 84 | Ga0075367_10343471 | 3300006178 | Bacteria | 942 |
| 85 | Ga0075369_10096155 | 3300006186 | Bacteria | 1325 |
| 86 | Ga0075428_100003218 | 3300006844 | Bacteria | 17867 |
| 87 | Ga0075430_100183303 | 3300006846 | Bacteria | 1741 |
| 88 | Ga0075431_100015919 | 3300006847 | Bacteria | 7629 |
| 89 | Ga0075431_100087695 | 3300006847 | Bacteria | 3211 |
| 90 | Ga0075431_100098758 | 3300006847 | Bacteria | 3014 |
| 91 | Ga0075433_10016728 | 3300006852 | Bacteria | 6055 |
| 92 | Ga0075434_100016586 | 3300006871 | Bacteria | 7083 |
| 93 | Ga0075429_100001278 | 3300006880 | Bacteria | 20473 |
| 94 | Ga0075429_100008235 | 3300006880 | Bacteria | 9064 |
| 95 | Ga0075429_100026318 | 3300006880 | Bacteria | 5050 |
| 96 | Ga0068865_100017220 | 3300006881 | Bacteria | 4644 |
| 97 | Ga0099824_1011059 | 3300006942 | Bacteria | 10373 |
| 98 | Ga0099822_1012158 | 3300006943 | Bacteria | 10347 |
| 99 | Ga0075435_100252580 | 3300007076 | Bacteria | 1501 |
| 100 | Ga0099795_10038100 | 3300007788 | Bacteria | 1695 |
| 101 | Ga0099795_10154354 | 3300007788 | Bacteria | 942 |
| 102 | Ga0105240_10018029 | 3300009093 | Bacteria | 9495 |
| 103 | Ga0105240_10023440 | 3300009093 | Bacteria | 8160 |
| 104 | Ga0105240_10243085 | 3300009093 | Bacteria | 2086 |
| 105 | Ga0111539_10000530 | 3300009094 | Bacteria | 48418 |
| 106 | Ga0111539_10065332 | 3300009094 | Bacteria | 4299 |
| 107 | Ga0111539_10284131 | 3300009094 | Bacteria | 1926 |
| 108 | Ga0105245_10013572 | 3300009098 | Bacteria | 7096 |
| 109 | Ga0114129_10020594 | 3300009147 | Bacteria | 9379 |
| 110 | Ga0114129_10113280 | 3300009147 | Bacteria | 3740 |
| 111 | Ga0114129_10120587 | 3300009147 | Bacteria | 3611 |
| 112 | Ga0114129_10124504 | 3300009147 | Bacteria | 3545 |
| 113 | Ga0114129_10350211 | 3300009147 | Bacteria | 1957 |
| 114 | Ga0105243_10021057 | 3300009148 | Bacteria | 4948 |
| 115 | Ga0105242_10095956 | 3300009176 | Bacteria | 2504 |
| 116 | Ga0105248_10042929 | 3300009177 | Bacteria | 5070 |
| 117 | Ga0105248_10554102 | 3300009177 | Bacteria | 1297 |
| 118 | Ga0105237_10219025 | 3300009545 | Bacteria | 1904 |
| 119 | Ga0105237_10630826 | 3300009545 | Bacteria | 1079 |
| 120 | Ga0105238_10008261 | 3300009551 | Bacteria | 10412 |
| 121 | Ga0105238_10809571 | 3300009551 | Bacteria | 953 |
| 122 | Ga0105249_10296036 | 3300009553 | Bacteria | 1621 |
| 123 | Ga0105239_10061849 | 3300010375 | Bacteria | 4110 |
| 124 | Ga0105239_10194302 | 3300010375 | Bacteria | 2272 |
| 125 | Ga0157371_10132671 | 3300013102 | Bacteria | 1772 |
| 126 | Ga0157370_10069454 | 3300013104 | Bacteria | 3327 |
| 127 | Ga0157370_10147564 | 3300013104 | Bacteria | 2190 |
| 128 | Ga0157369_10004231 | 3300013105 | Bacteria | 17000 |
| 129 | Ga0157369_10663744 | 3300013105 | Bacteria | 1075 |
| 130 | Ga0157374_10010696 | 3300013296 | Bacteria | 7905 |
| 131 | Ga0157374_10031921 | 3300013296 | Bacteria | 4791 |
| 132 | Ga0157378_10379265 | 3300013297 | Bacteria | 1388 |
| 133 | Ga0163162_10015679 | 3300013306 | Bacteria | 7405 |
| 134 | Ga0163162_10574513 | 3300013306 | Bacteria | 1254 |
| 135 | Ga0157372_10231336 | 3300013307 | Bacteria | 2143 |
| 136 | Ga0157375_10012064 | 3300013308 | Bacteria | 7654 |
| 137 | Ga0157375_10264048 | 3300013308 | Bacteria | 1883 |
| 138 | Ga0157375_10820172 | 3300013308 | Bacteria | 1078 |
| 139 | Ga0163163_10006895 | 3300014325 | Bacteria | 9971 |
| 140 | Ga0163163_10020344 | 3300014325 | Bacteria | 6248 |
| 141 | Ga0163163_10866652 | 3300014325 | Bacteria | 966 |
| 142 | Ga0157376_10008083 | 3300014969 | Bacteria | 7560 |
| 143 | Ga0163161_10056138 | 3300017792 | Bacteria | 2860 |
| 144 | Ga0206356_11686928 | 3300020070 | Bacteria | 828 |
| 145 | Ga0213873_10074665 | 3300021358 | Bacteria | 940 |
| 146 | Ga0213872_10029234 | 3300021361 | Bacteria | 2527 |
| 147 | Ga0213872_10037684 | 3300021361 | Unclassified | 2208 |
| 148 | Ga0213876_10009013 | 3300021384 | Bacteria | 5375 |
| 149 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 150 | Ga0209148_1000590 | 3300025254 | Bacteria | 33089 |
| 151 | Ga0209233_1004497 | 3300025261 | Bacteria | 4731 |
| 152 | Ga0207642_10278613 | 3300025899 | Bacteria | 961 |
| 153 | Ga0207688_10032968 | 3300025901 | Bacteria | 2863 |
| 154 | Ga0207688_10149582 | 3300025901 | Bacteria | 1378 |
| 155 | Ga0207680_10180597 | 3300025903 | Bacteria | 1427 |
| 156 | Ga0207699_10462260 | 3300025906 | Bacteria | 912 |
| 157 | Ga0207705_10017941 | 3300025909 | Bacteria | 5062 |
| 158 | Ga0207684_10010041 | 3300025910 | Bacteria | 8341 |
| 159 | Ga0207684_10053380 | 3300025910 | Bacteria | 3431 |
| 160 | Ga0207684_10281335 | 3300025910 | Bacteria | 1434 |
| 161 | Ga0207707_10083857 | 3300025912 | Bacteria | 2783 |
| 162 | Ga0207707_10090526 | 3300025912 | Bacteria | 2674 |
| 163 | Ga0207695_10194253 | 3300025913 | Bacteria | 1946 |
| 164 | Ga0207695_10274461 | 3300025913 | Bacteria | 1581 |
| 165 | Ga0207671_10136388 | 3300025914 | Bacteria | 1887 |
| 166 | Ga0207693_10362025 | 3300025915 | Unclassified | 1135 |
| 167 | Ga0207660_10082639 | 3300025917 | Bacteria | 2363 |
| 168 | Ga0207657_10019370 | 3300025919 | Bacteria | 6464 |
| 169 | Ga0207657_10441184 | 3300025919 | Bacteria | 1022 |
| 170 | Ga0207657_10543259 | 3300025919 | Bacteria | 909 |
| 171 | Ga0207649_10220795 | 3300025920 | Bacteria | 1350 |
| 172 | Ga0207649_10323198 | 3300025920 | Bacteria | 1134 |
| 173 | Ga0207652_10014990 | 3300025921 | Bacteria | 6288 |
| 174 | Ga0207652_10085603 | 3300025921 | Bacteria | 2762 |
| 175 | Ga0207646_10002435 | 3300025922 | Bacteria | 21941 |
| 176 | Ga0207646_10091778 | 3300025922 | Bacteria | 2718 |
| 177 | Ga0207646_10201272 | 3300025922 | Bacteria | 1799 |
| 178 | Ga0207646_10224389 | 3300025922 | Unclassified | 1697 |
| 179 | Ga0207646_10337707 | 3300025922 | Bacteria | 1361 |
| 180 | Ga0207650_10868217 | 3300025925 | Bacteria | 766 |
| 181 | Ga0207659_10373069 | 3300025926 | Bacteria | 1188 |
| 182 | Ga0207687_10039946 | 3300025927 | Bacteria | 3214 |
| 183 | Ga0207700_10424045 | 3300025928 | Bacteria | 1169 |
| 184 | Ga0207700_10547359 | 3300025928 | Bacteria | 1027 |
| 185 | Ga0207664_10055565 | 3300025929 | Bacteria | 3142 |
| 186 | Ga0207664_10120601 | 3300025929 | Bacteria | 2194 |
| 187 | Ga0207664_10707892 | 3300025929 | Bacteria | 906 |
| 188 | Ga0207644_10049690 | 3300025931 | Bacteria | 3004 |
| 189 | Ga0207706_10024502 | 3300025933 | Bacteria | 5409 |
| 190 | Ga0207686_10274860 | 3300025934 | Bacteria | 1241 |
| 191 | Ga0207709_10011139 | 3300025935 | Bacteria | 4958 |
| 192 | Ga0207709_10026119 | 3300025935 | Bacteria | 3351 |
| 193 | Ga0207670_10332880 | 3300025936 | Bacteria | 1198 |
| 194 | Ga0207669_10015538 | 3300025937 | Bacteria | 3841 |
| 195 | Ga0207704_10004400 | 3300025938 | Bacteria | 6445 |
| 196 | Ga0207704_10259696 | 3300025938 | Bacteria | 1309 |
| 197 | Ga0207704_10486344 | 3300025938 | Bacteria | 992 |
| 198 | Ga0207665_10063591 | 3300025939 | Bacteria | 2507 |
| 199 | Ga0207665_10069236 | 3300025939 | Bacteria | 2406 |
| 200 | Ga0207665_10162031 | 3300025939 | Bacteria | 1609 |
| 201 | Ga0207665_10280905 | 3300025939 | Bacteria | 1239 |
| 202 | Ga0207691_10297276 | 3300025940 | Bacteria | 1387 |
| 203 | Ga0207691_10438690 | 3300025940 | Bacteria | 1112 |
| 204 | Ga0207711_10164945 | 3300025941 | Bacteria | 2007 |
| 205 | Ga0207689_10061064 | 3300025942 | Bacteria | 3099 |
| 206 | Ga0207661_10000190 | 3300025944 | Bacteria | 39991 |
| 207 | Ga0207661_10233963 | 3300025944 | Bacteria | 1628 |
| 208 | Ga0207661_10315798 | 3300025944 | Bacteria | 1404 |
| 209 | Ga0207679_10029891 | 3300025945 | Bacteria | 3798 |
| 210 | Ga0207679_10065299 | 3300025945 | Bacteria | 2723 |
| 211 | Ga0207667_10014052 | 3300025949 | Bacteria | 9139 |
| 212 | Ga0207667_10024575 | 3300025949 | Bacteria | 6611 |
| 213 | Ga0207651_10723985 | 3300025960 | Bacteria | 878 |
| 214 | Ga0207651_10815254 | 3300025960 | Bacteria | 828 |
| 215 | Ga0207668_10219227 | 3300025972 | Bacteria | 1527 |
| 216 | Ga0207640_10091096 | 3300025981 | Bacteria | 2112 |
| 217 | Ga0207677_10051431 | 3300026023 | Bacteria | 2794 |
| 218 | Ga0207677_10543270 | 3300026023 | Bacteria | 1012 |
| 219 | Ga0207678_10012679 | 3300026067 | Bacteria | 7407 |
| 220 | Ga0207708_10567274 | 3300026075 | Bacteria | 959 |
| 221 | Ga0207702_10000197 | 3300026078 | Bacteria | 71667 |
| 222 | Ga0207702_10145220 | 3300026078 | Bacteria | 2152 |
| 223 | Ga0207702_10235214 | 3300026078 | Bacteria | 1714 |
| 224 | Ga0207702_10235293 | 3300026078 | Bacteria | 1714 |
| 225 | Ga0207648_10038090 | 3300026089 | Bacteria | 4232 |
| 226 | Ga0207648_10377994 | 3300026089 | Bacteria | 1281 |
| 227 | Ga0207648_10622707 | 3300026089 | Bacteria | 996 |
| 228 | Ga0207674_10147103 | 3300026116 | Bacteria | 2314 |
| 229 | Ga0207674_10320848 | 3300026116 | Bacteria | 1498 |
| 230 | Ga0207674_10333033 | 3300026116 | Bacteria | 1468 |
| 231 | Ga0207675_100193789 | 3300026118 | Bacteria | 1950 |
| 232 | Ga0207683_10045001 | 3300026121 | Bacteria | 3859 |
| 233 | Ga0207683_10370128 | 3300026121 | Bacteria | 1316 |
| 234 | Ga0207698_10010543 | 3300026142 | Bacteria | 5948 |
| 235 | Ga0207698_10136945 | 3300026142 | Bacteria | 2102 |
| 236 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 237 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 238 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 239 | Ga0209588_1063288 | 3300027671 | Bacteria | 1196 |
| 240 | Ga0209971_1032374 | 3300027682 | Bacteria | 1255 |
| 241 | Ga0207428_10004136 | 3300027907 | Bacteria | 13912 |
| 242 | Ga0207428_10006011 | 3300027907 | Bacteria | 11239 |
| 243 | Ga0207428_10201582 | 3300027907 | Bacteria | 1497 |
| 244 | Ga0268266_10239671 | 3300028379 | Bacteria | 1673 |
| 245 | Ga0265319_1071362 | 3300028563 | Bacteria | 1113 |
| 246 | Ga0265318_10018048 | 3300028577 | Bacteria | 2886 |
| 247 | Ga0265322_10007102 | 3300028654 | Bacteria | 3282 |
| 248 | Ga0265338_10013244 | 3300028800 | Bacteria | 9332 |
| 249 | Ga0265320_10023737 | 3300031240 | Bacteria | 3257 |
| 250 | Ga0265320_10095617 | 3300031240 | Bacteria | 1372 |
| 251 | Ga0265340_10023806 | 3300031247 | Bacteria | 3118 |
| 252 | Ga0265339_10021860 | 3300031249 | Bacteria | 3713 |
| 253 | Ga0265327_10000493 | 3300031251 | Bacteria | 69042 |
| 254 | Ga0265316_10025605 | 3300031344 | Bacteria | 4921 |
| 255 | Ga0307509_10084453 | 3300031507 | Bacteria | 3270 |
| 256 | Ga0307408_100006290 | 3300031548 | Bacteria | 7882 |
| 257 | Ga0265313_10015356 | 3300031595 | Bacteria | 4465 |
| 258 | Ga0307508_10067571 | 3300031616 | Bacteria | 3144 |
| 259 | Ga0265314_10005339 | 3300031711 | Bacteria | 11618 |
| 260 | Ga0265314_10223287 | 3300031711 | Bacteria | 1098 |
| 261 | Ga0265342_10073470 | 3300031712 | Bacteria | 1989 |
| 262 | Ga0307405_10026086 | 3300031731 | Bacteria | 3366 |
| 263 | Ga0307410_10509933 | 3300031852 | Bacteria | 991 |
| 264 | Ga0307406_10028243 | 3300031901 | Bacteria | 3388 |
| 265 | Ga0307406_10616402 | 3300031901 | Bacteria | 897 |
| 266 | Ga0307412_10023279 | 3300031911 | Bacteria | 3809 |
| 267 | Ga0307412_10298363 | 3300031911 | Bacteria | 1272 |
| 268 | Ga0307416_100114688 | 3300032002 | Bacteria | 2384 |
| 269 | Ga0307411_10569420 | 3300032005 | Bacteria | 969 |
| 270 | Ga0307415_100226691 | 3300032126 | Bacteria | 1502 |
| 271 | Ga0373929_0027011 | 3300035085 | Bacteria | 1203 |
| 272 | Ga0373923_0092553 | 3300035111 | Bacteria | 1324 |
| 273 | Ga0373932_0047869 | 3300035112 | Bacteria | 1258 |
| 274 | Ga0373936_0000007 | 3300035113 | Bacteria | 290641 |
| 275 | Ga0373954_0000659 | 3300035118 | Bacteria | 13205 |
| 276 | Ga0373954_0164926 | 3300035118 | Bacteria | 1084 |
| 277 | Ga0373956_0004523 | 3300035119 | Bacteria | 5554 |
| 278 | Ga0373957_0011611 | 3300035120 | Bacteria | 2946 |
| 279 | Ga0373943_0237717 | 3300035170 | Bacteria | 1020 |
| 280 | Ga0373955_0000335 | 3300035172 | Bacteria | 19651 |
| 281 | Ga0373955_0399800 | 3300035172 | Bacteria | 835 |
| 282 | Ga0373924_0012720 | 3300035410 | Bacteria | 3148 |
| 283 | Ga0373931_0022655 | 3300035691 | Bacteria | 3163 |
| 284 | Ga0373935_0304710 | 3300035692 | Archaea | 1127 |
| 285 | Ga0373927_0191853 | 3300035695 | Bacteria | 1340 |
| 286 | Ga0373927_0205395 | 3300035695 | Bacteria | 1293 |
| 287 | Ga0373933_0030121 | 3300035724 | Bacteria | 3141 |
| 288 | Ga0373937_0026361 | 3300036401 | Bacteria | 5252 |
| 289 | Ga0373937_0974171 | 3300036401 | Bacteria | 797 |
| 290 | Ga0316582_0202904 | 3300036647 | Bacteria | 1353 |
| 291 | Ga0373925_0091969 | 3300037068 | Unclassified | 2320 |
| 292 | Ga0395899_0004477 | 3300037312 | Bacteria | 10891 |
| 293 | Ga0395899_0015816 | 3300037312 | Bacteria | 5752 |
| 294 | Ga0395899_0030051 | 3300037312 | Bacteria | 4088 |
| 295 | Ga0395899_0049891 | 3300037312 | Bacteria | 3109 |
| 296 | Ga0395899_0110937 | 3300037312 | Bacteria | 1972 |
| 297 | Ga0395899_0121071 | 3300037312 | Bacteria | 1874 |
| 298 | Ga0395900_0000324 | 3300037418 | Bacteria | 70682 |
| 299 | Ga0395900_0002902 | 3300037418 | Bacteria | 18675 |
| 300 | Ga0395900_0016248 | 3300037418 | Bacteria | 7584 |
| 301 | Ga0395900_0026991 | 3300037418 | Bacteria | 5878 |
| 302 | Ga0395900_0031469 | 3300037418 | Bacteria | 5452 |
| 303 | Ga0395900_0092391 | 3300037418 | Bacteria | 3109 |
| 304 | Ga0395900_0214356 | 3300037418 | Bacteria | 1943 |
| 305 | Ga0395900_0251278 | 3300037418 | Bacteria | 1769 |
| 306 | Ga0395898_0044475 | 3300037466 | Bacteria | 4370 |
| 307 | Ga0395898_0117142 | 3300037466 | Bacteria | 2552 |
| 308 | Ga0395898_0158119 | 3300037466 | Bacteria | 2167 |
| 309 | Ga0395898_0776067 | 3300037466 | Bacteria | 899 |
| 310 | Ga0395905_0024811 | 3300037471 | Bacteria | 5658 |
| 311 | Ga0395905_0138645 | 3300037471 | Bacteria | 2288 |
| 312 | Ga0395905_0172813 | 3300037471 | Bacteria | 2029 |
| 313 | Ga0395905_0265970 | 3300037471 | Bacteria | 1600 |
| 314 | Ga0395905_0502888 | 3300037471 | Bacteria | 1112 |
| 315 | Ga0395901_0000089 | 3300038443 | Bacteria | 124305 |
| 316 | Ga0395901_0005708 | 3300038443 | Bacteria | 12596 |
| 317 | Ga0395901_0237764 | 3300038443 | Bacteria | 1900 |
| 318 | Ga0395901_0240222 | 3300038443 | Bacteria | 1889 |
| 319 | Ga0395901_0267278 | 3300038443 | Bacteria | 1779 |
| 320 | Ga0395901_0917669 | 3300038443 | Bacteria | 856 |
| 321 | Ga0436365_1420650 | 3300039437 | Bacteria | 46154 |
| 322 | Ga0436365_1600738 | 3300039437 | Bacteria | 1404 |
| 323 | Ga0436361_0002710 | 3300039447 | Bacteria | 4140 |
| 324 | Ga0436361_0457489 | 3300039447 | Bacteria | 1256 |
| 325 | Ga0436362_0886852 | 3300039453 | Bacteria | 909 |
| 326 | Ga0436362_0910589 | 3300039453 | Bacteria | 1507 |
| 327 | Ga0439448_0000868 | 3300042005 | Bacteria | 7386 |
| 328 | Ga0439435_0055683 | 3300042436 | Bacteria | 1141 |
| 329 | Ga0439464_0022775 | 3300042439 | Bacteria | 1727 |
| 330 | Ga0466969_0168002 | 3300044656 | Bacteria | 1006 |
| 331 | Ga0466972_0088655 | 3300044658 | Bacteria | 1468 |
| 332 | Ga0466965_0024013 | 3300044683 | Bacteria | 2947 |
| 333 | Ga0466966_0032666 | 3300044684 | Bacteria | 3371 |
| 334 | Ga0466966_0127733 | 3300044684 | Bacteria | 1558 |
| 335 | Ga0466966_0171335 | 3300044684 | Bacteria | 1319 |
| 336 | Ga0466961_0081668 | 3300044693 | Bacteria | 2045 |
| 337 | Ga0466961_0128439 | 3300044693 | Bacteria | 1589 |
| 338 | Ga0466963_0124760 | 3300044694 | Bacteria | 1774 |
| 339 | Ga0466963_0183189 | 3300044694 | Bacteria | 1462 |
| 340 | Ga0466964_0110619 | 3300044706 | Bacteria | 1224 |
| 341 | Ga0453684_0615778 | 3300044712 | Bacteria | 1188 |
| 342 | Ga0466971_0037692 | 3300044719 | Bacteria | 2168 |
| 343 | Ga0466970_0052452 | 3300044765 | Bacteria | 2177 |
| 344 | Ga0466970_0270032 | 3300044765 | Bacteria | 955 |
| 345 | Ga0466957_0003950 | 3300044842 | Bacteria | 8195 |
| 346 | Ga0466957_0107601 | 3300044842 | Bacteria | 1765 |
| 347 | Ga0466957_0114060 | 3300044842 | Bacteria | 1716 |
| 348 | Ga0466957_0148365 | 3300044842 | Bacteria | 1515 |
| 349 | Ga0466960_0191651 | 3300044901 | Bacteria | 1113 |
| 350 | Ga0466959_0007083 | 3300045049 | Bacteria | 7842 |
| 351 | Ga0466959_0047268 | 3300045049 | Bacteria | 3165 |
| 352 | Ga0466959_0175690 | 3300045049 | Bacteria | 1500 |
| 353 | Ga0451576_1276630 | 3300045051 | Bacteria | 766 |
| 354 | Ga0466958_0020701 | 3300045836 | Bacteria | 3838 |
| 355 | Ga0466967_0026810 | 3300045976 | Bacteria | 4781 |
| 356 | Ga0466967_0416412 | 3300045976 | Bacteria | 1309 |
| 357 | Ga0466967_0631746 | 3300045976 | Bacteria | 1058 |
| 358 | Ga0495592_0006367 | 3300046454 | Bacteria | 8792 |
| 359 | Ga0495603_0057292 | 3300046455 | Archaea | 2306 |
| 360 | Ga0495603_0092775 | 3300046455 | Bacteria | 1765 |
| 361 | Ga0495603_0168875 | 3300046455 | Bacteria | 1267 |
| 362 | Ga0495629_0002353 | 3300046459 | Bacteria | 14564 |
| 363 | Ga0495629_0045702 | 3300046459 | Bacteria | 3072 |
| 364 | Ga0495629_0112536 | 3300046459 | Bacteria | 1897 |
| 365 | Ga0495653_0041016 | 3300046463 | Bacteria | 3615 |
| 366 | Ga0495580_0127670 | 3300046472 | Bacteria | 1765 |
| 367 | Ga0495582_0025264 | 3300046473 | Bacteria | 3254 |
| 368 | Ga0495605_0000117 | 3300046474 | Bacteria | 103262 |
| 369 | Ga0495605_0003312 | 3300046474 | Bacteria | 9648 |
| 370 | Ga0495639_0018676 | 3300046475 | Bacteria | 3020 |
| 371 | Ga0495639_0028217 | 3300046475 | Bacteria | 2486 |
| 372 | Ga0495664_0129836 | 3300046477 | Archaea | 1525 |
| 373 | Ga0495594_0084734 | 3300046499 | Archaea | 1772 |
| 374 | Ga0495607_0001221 | 3300046501 | Bacteria | 23080 |
| 375 | Ga0495607_0002442 | 3300046501 | Bacteria | 15135 |
| 376 | Ga0495606_0216465 | 3300046507 | Bacteria | 1082 |
| 377 | Ga0495608_0005147 | 3300046511 | Bacteria | 9345 |
| 378 | Ga0495608_0095340 | 3300046511 | Bacteria | 1922 |
| 379 | Ga0495608_0286525 | 3300046511 | Bacteria | 1021 |
| 380 | Ga0495628_0163656 | 3300046516 | Bacteria | 1689 |
| 381 | Ga0495630_0108049 | 3300046517 | Archaea | 2107 |
| 382 | Ga0495632_0057182 | 3300046519 | Bacteria | 1905 |
| 383 | Ga0495632_0187665 | 3300046519 | Bacteria | 945 |
| 384 | Ga0495643_0000263 | 3300046522 | Bacteria | 76248 |
| 385 | Ga0495666_0090833 | 3300046526 | Archaea | 1441 |
| 386 | Ga0495642_0000907 | 3300046528 | Bacteria | 13909 |
| 387 | Ga0495652_0148607 | 3300046529 | Bacteria | 1833 |
| 388 | Ga0495665_0127794 | 3300046531 | Archaea | 1331 |
| 389 | Ga0495640_0004127 | 3300046533 | Bacteria | 11621 |
| 390 | Ga0495640_0080365 | 3300046533 | Archaea | 2168 |
| 391 | Ga0495586_0035768 | 3300046535 | Archaea | 2668 |
| 392 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 393 | Ga0495656_0001980 | 3300046615 | Bacteria | 6746 |
| 394 | Ga0495656_0002791 | 3300046615 | Bacteria | 5839 |
| 395 | Ga0495656_0015039 | 3300046615 | Bacteria | 2913 |
| 396 | Ga0495668_0273560 | 3300046616 | Bacteria | 925 |
| 397 | Ga0495635_0050435 | 3300046663 | Bacteria | 2868 |
| 398 | Ga0495635_0065696 | 3300046663 | Bacteria | 2489 |
| 399 | Ga0495635_0245052 | 3300046663 | Bacteria | 1209 |
| 400 | Ga0495661_0000663 | 3300046665 | Bacteria | 34526 |
| 401 | Ga0495661_0002221 | 3300046665 | Bacteria | 15090 |
| 402 | Ga0495657_0066317 | 3300046675 | Bacteria | 2371 |
| 403 | Ga0495599_0006109 | 3300046678 | Bacteria | 7253 |
| 404 | Ga0495599_0058003 | 3300046678 | Bacteria | 2422 |
| 405 | Ga0495623_0027760 | 3300046679 | Bacteria | 3644 |
| 406 | Ga0495647_0016646 | 3300046681 | Bacteria | 2591 |
| 407 | Ga0495658_0073406 | 3300046683 | Archaea | 1991 |
| 408 | Ga0495658_0359373 | 3300046683 | Bacteria | 926 |
| 409 | Ga0495669_0006435 | 3300046684 | Bacteria | 4904 |
| 410 | Ga0495613_0040882 | 3300046689 | Bacteria | 3434 |
| 411 | Ga0495613_0049001 | 3300046689 | Bacteria | 3118 |
| 412 | Ga0495624_0243800 | 3300046690 | Archaea | 1087 |
| 413 | Ga0495589_0000027 | 3300046794 | Bacteria | 181084 |
| 414 | Ga0495589_0000974 | 3300046794 | Bacteria | 17471 |
| 415 | Ga0495600_0088311 | 3300046809 | Bacteria | 2022 |
| 416 | Ga0495660_0000054 | 3300046810 | Bacteria | 135325 |
| 417 | Ga0495660_0076901 | 3300046810 | Bacteria | 1757 |
| 418 | Ga0495581_0039677 | 3300047315 | Bacteria | 2726 |
| 419 | Ga0495581_0079912 | 3300047315 | Archaea | 1892 |
| 420 | Ga0495604_0150309 | 3300047317 | Bacteria | 1655 |
| 421 | Ga0495604_0340351 | 3300047317 | Bacteria | 999 |
| 422 | Ga0495674_0076014 | 3300047319 | Unclassified | 2889 |
| 423 | Ga0495674_0410375 | 3300047319 | Bacteria | 1092 |
| 424 | Ga0495672_0001329 | 3300047320 | Bacteria | 24574 |
| 425 | Ga0495676_0089104 | 3300047321 | Bacteria | 2312 |
| 426 | Ga0495680_0034539 | 3300047322 | Bacteria | 4081 |
| 427 | Ga0495687_000019 | 3300047443 | Bacteria | 341756 |
| 428 | Ga0495687_000287 | 3300047443 | Bacteria | 66402 |
| 429 | Ga0495675_0003409 | 3300047444 | Bacteria | 9576 |
| 430 | Ga0495677_0000020 | 3300047445 | Bacteria | 107093 |
| 431 | Ga0495677_0000779 | 3300047445 | Bacteria | 12855 |
| 432 | Ga0495673_0046634 | 3300047469 | Bacteria | 1919 |
| 433 | Ga0495681_0099164 | 3300047470 | Bacteria | 1276 |
| 434 | Ga0495684_0013598 | 3300047471 | Bacteria | 6267 |
| 435 | Ga0495684_0080936 | 3300047471 | Unclassified | 2465 |
| 436 | Ga0495686_0000054 | 3300047472 | Bacteria | 259400 |
| 437 | Ga0495686_0120156 | 3300047472 | Bacteria | 1567 |
| 438 | Ga0495593_0001736 | 3300047673 | Bacteria | 12917 |
| 439 | Ga0495602_0099423 | 3300048088 | Bacteria | 2391 |
| 440 | Ga0495614_0006299 | 3300048089 | Bacteria | 5333 |
| 441 | Ga0495626_0000800 | 3300048091 | Bacteria | 28478 |
| 442 | Ga0495626_0001889 | 3300048091 | Bacteria | 15658 |
| 443 | Ga0496100_0045950 | 3300048903 | Bacteria | 2805 |
| 444 | Ga0496100_0199378 | 3300048903 | Bacteria | 1458 |
| 445 | Ga0496100_0421853 | 3300048903 | Bacteria | 1019 |
| 446 | Ga0496100_0640046 | 3300048903 | Bacteria | 827 |
| 447 | Ga0496101_0006299 | 3300048904 | Bacteria | 7640 |
| 448 | Ga0496101_0007388 | 3300048904 | Bacteria | 7117 |
| 449 | Ga0496101_0072062 | 3300048904 | Bacteria | 2535 |
| 450 | Ga0496101_0276325 | 3300048904 | Archaea | 1312 |
| 451 | Ga0496101_0393548 | 3300048904 | Bacteria | 1091 |
| 452 | Ga0496102_0001495 | 3300048905 | Bacteria | 20650 |
| 453 | Ga0496102_0087694 | 3300048905 | Bacteria | 2875 |
| 454 | Ga0496103_0051764 | 3300048906 | Bacteria | 2542 |
| 455 | Ga0496104_0110188 | 3300048907 | Bacteria | 2639 |
| 456 | Ga0496104_0266192 | 3300048907 | Bacteria | 1626 |
| 457 | Ga0496104_0618028 | 3300048907 | Bacteria | 993 |
| 458 | Ga0496105_0013499 | 3300048908 | Bacteria | 6486 |
| 459 | Ga0496105_0132893 | 3300048908 | Bacteria | 2050 |
| 460 | Ga0496105_0138712 | 3300048908 | Bacteria | 2002 |
| 461 | Ga0496105_0170645 | 3300048908 | Bacteria | 1783 |
| 462 | Ga0496105_0565669 | 3300048908 | Bacteria | 886 |
| 463 | Ga0496105_0706237 | 3300048908 | Bacteria | 774 |
| 464 | Ga0496106_0024986 | 3300048909 | Bacteria | 4444 |
| 465 | Ga0496106_0283797 | 3300048909 | Bacteria | 1327 |
| 466 | Ga0496107_0016292 | 3300048910 | Bacteria | 5216 |
| 467 | Ga0496108_0309099 | 3300048911 | Bacteria | 1377 |
| 468 | Ga0496109_0085811 | 3300048912 | Bacteria | 2907 |
| 469 | Ga0496109_0141375 | 3300048912 | Bacteria | 2250 |
| 470 | Ga0496110_0222294 | 3300048913 | Bacteria | 1717 |
| 471 | Ga0496110_0391035 | 3300048913 | Bacteria | 1268 |
| 472 | Ga0496110_0460812 | 3300048913 | Bacteria | 1158 |
| 473 | Ga0496111_0029884 | 3300048914 | Bacteria | 3872 |
| 474 | Ga0496111_0060590 | 3300048914 | Bacteria | 2743 |
| 475 | Ga0496111_0233289 | 3300048914 | Bacteria | 1367 |
| 476 | Ga0496111_0623152 | 3300048914 | Bacteria | 789 |
| 477 | Ga0496112_0004295 | 3300048915 | Bacteria | 12036 |
| 478 | Ga0496112_0650197 | 3300048915 | Bacteria | 984 |
| 479 | Ga0496113_0018959 | 3300048916 | Bacteria | 4803 |
| 480 | Ga0496113_0343649 | 3300048916 | Bacteria | 1197 |
| 481 | Ga0496114_0019092 | 3300048917 | Bacteria | 5555 |
| 482 | Ga0496114_0070783 | 3300048917 | Bacteria | 2930 |
| 483 | Ga0496114_0158625 | 3300048917 | Bacteria | 1966 |
| 484 | Ga0496114_0210769 | 3300048917 | Bacteria | 1704 |
| 485 | Ga0496115_0001988 | 3300048918 | Bacteria | 14603 |
| 486 | Ga0496115_0261308 | 3300048918 | Bacteria | 1424 |
| 487 | Ga0496119_0118951 | 3300048922 | Bacteria | 1455 |
| 488 | Ga0496122_0002445 | 3300048925 | Bacteria | 26295 |
| 489 | Ga0496122_0028323 | 3300048925 | Bacteria | 4758 |
| 490 | Ga0496123_0001793 | 3300048926 | Bacteria | 28269 |
| 491 | Ga0496123_0094998 | 3300048926 | Bacteria | 1755 |
| 492 | Ga0496123_0219192 | 3300048926 | Bacteria | 961 |
| 493 | Ga0496124_0004606 | 3300048927 | Bacteria | 15973 |
| 494 | Ga0496124_0012480 | 3300048927 | Bacteria | 8385 |
| 495 | Ga0496124_0133677 | 3300048927 | Bacteria | 1967 |
| 496 | Ga0496126_0048866 | 3300048929 | Bacteria | 3863 |
| 497 | Ga0496126_0211855 | 3300048929 | Bacteria | 1631 |
| 498 | Ga0501031_0006301 | 3300049568 | Bacteria | 7734 |
| 499 | Ga0501032_0000320 | 3300049569 | Bacteria | 40199 |
| 500 | Ga0501033_0000968 | 3300049570 | Bacteria | 26054 |
| 501 | Ga0501034_0000058 | 3300049571 | Bacteria | 198554 |
| 502 | Ga0501036_0001143 | 3300049572 | Bacteria | 20195 |
| 503 | Ga0501037_0000700 | 3300049573 | Bacteria | 25505 |
| 504 | Ga0501038_0000059 | 3300049574 | Bacteria | 92319 |
| 505 | Ga0501039_0001176 | 3300049575 | Bacteria | 19201 |
| 506 | Ga0501040_0481625 | 3300049576 | Bacteria | 894 |
| 507 | Ga0501041_0332608 | 3300049577 | Bacteria | 959 |
| 508 | Ga0501043_0007372 | 3300049579 | Bacteria | 8728 |
| 509 | Ga0501046_0002041 | 3300049580 | Bacteria | 19193 |
| 510 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 511 | Ga0501048_0001669 | 3300049582 | Bacteria | 16903 |
| 512 | Ga0501067_0003092 | 3300049583 | Bacteria | 9187 |
| 513 | Ga0501068_0015136 | 3300049584 | Bacteria | 4425 |
| 514 | Ga0501070_0001070 | 3300049586 | Bacteria | 24549 |
| 515 | Ga0501070_0042133 | 3300049586 | Bacteria | 3802 |
| 516 | Ga0501073_0000604 | 3300049589 | Bacteria | 25323 |
| 517 | Ga0501073_0345807 | 3300049589 | Bacteria | 1027 |
| 518 | Ga0501074_0000028 | 3300049590 | Bacteria | 67595 |
| 519 | Ga0501076_0160357 | 3300049592 | Bacteria | 1832 |
| 520 | Ga0501076_0416660 | 3300049592 | Bacteria | 1105 |
| 521 | Ga0501079_0001041 | 3300049741 | Bacteria | 19211 |
| 522 | Ga0501080_0001713 | 3300049742 | Bacteria | 18728 |
| 523 | Ga0501080_0059875 | 3300049742 | Bacteria | 3544 |
| 524 | Ga0501080_0179275 | 3300049742 | Bacteria | 1950 |
| 525 | Ga0501083_0001278 | 3300049744 | Bacteria | 17040 |
| 526 | Ga0501035_0000240 | 3300049822 | Bacteria | 65635 |
| 527 | Ga0501044_0025135 | 3300049823 | Bacteria | 6315 |
| 528 | Ga0501044_0234513 | 3300049823 | Bacteria | 1781 |
| 529 | Ga0501045_0007836 | 3300049824 | Bacteria | 7430 |
| 530 | nmdc:mga03683_150150_c1 | 3300050489 | Bacteria | 1051 |
| 531 | nmdc:mga03683_2041_c1 | 3300050489 | Bacteria | 6185 |
| 532 | nmdc:mga0yw44_140863_c1 | 3300050492 | Bacteria | 1567 |
| 533 | nmdc:mga0yw44_216580_c1 | 3300050492 | Bacteria | 1268 |
| 534 | nmdc:mga0k408_55170_c1 | 3300050493 | Bacteria | 2303 |
| 535 | nmdc:mga06z11_68282_c1 | 3300050494 | Bacteria | 1873 |
| 536 | nmdc:mga07m45_17594_c3 | 3300050496 | Bacteria | 1011 |
| 537 | nmdc:mga07m45_213717_c1 | 3300050496 | Bacteria | 1122 |
| 538 | nmdc:mga05p37_313149_c1 | 3300050507 | Bacteria | 1860 |
| 539 | nmdc:mga05p37_382_c1 | 3300050507 | Bacteria | 47795 |
| 540 | nmdc:mga05p37_42707_c1 | 3300050507 | Bacteria | 5573 |
| 541 | nmdc:mga05p37_50988_c1 | 3300050507 | Bacteria | 5089 |
| 542 | nmdc:mga09592_12628_c1 | 3300050508 | Bacteria | 6886 |
| 543 | nmdc:mga09592_3218_c1 | 3300050508 | Bacteria | 13223 |
| 544 | nmdc:mga09592_6583_c1 | 3300050508 | Bacteria | 9462 |
| 545 | nmdc:mga0qj67_168329_c1 | 3300050509 | Bacteria | 1779 |
| 546 | nmdc:mga06r32_1110_c1 | 3300050510 | Bacteria | 24142 |
| 547 | nmdc:mga08y16_5292_c1 | 3300050511 | Bacteria | 13496 |
| 548 | nmdc:mga08y16_768_c1 | 3300050511 | Bacteria | 30549 |
| 549 | nmdc:mga08y16_796031_c1 | 3300050511 | Bacteria | 938 |
| 550 | nmdc:mga0n895_14188_c1 | 3300050512 | Bacteria | 7226 |
| 551 | nmdc:mga0rr50_25988_c1 | 3300050513 | Bacteria | 1501 |
| 552 | nmdc:mga0a205_18236_c1 | 3300050515 | Bacteria | 6594 |
| 553 | nmdc:mga0a205_945903_c1 | 3300050515 | Bacteria | 708 |
| 554 | nmdc:mga0sz30_86766_c1 | 3300050516 | Bacteria | 1359 |
| 555 | Ga0495601_0118081 | 3300053077 | Bacteria | 1721 |
| 556 | Ga0495595_0003363 | 3300053084 | Bacteria | 6349 |
| 557 | Ga0500646_0039680 | 3300053090 | Bacteria | 1322 |
| 558 | Ga0500555_036849 | 3300053103 | Bacteria | 1371 |
| 559 | Ga0500562_021658 | 3300053108 | Bacteria | 1674 |
| 560 | Ga0500595_000602 | 3300053119 | Bacteria | 21451 |
| 561 | Ga0500595_002200 | 3300053119 | Bacteria | 9908 |
| 562 | Ga0500616_0001188 | 3300053153 | Bacteria | 26456 |
| 563 | Ga0500622_0039492 | 3300053156 | Bacteria | 2460 |
| 564 | Ga0500552_001098 | 3300053733 | Bacteria | 2557 |
| 565 | Ga0501084_0021521 | 3300054114 | Bacteria | 5375 |
| 566 | Ga0501082_0000428 | 3300060353 | Bacteria | 37284 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035111 | Ga0373923_0092553 | Ga0373923_0092553_664_1251 | 158 |
| 2 | 3300046454 | Ga0495592_0006367 | Ga0495592_0006367_5303_5890 | 158 |
| 3 | 3300048916 | Ga0496113_0018959 | Ga0496113_0018959_4241_4789 | 158 |
| 4 | 3300050496 | nmdc:mga07m45_213717_c1 | nmdc:mga07m45_213717_c1_542_1099 | 158 |
| 5 | 3300039453 | Ga0436362_0886852 | Ga0436362_0886852_13_573 | 159 |
| 6 | 3300046511 | Ga0495608_0286525 | Ga0495608_0286525_54_605 | 159 |
| 7 | 3300009553 | Ga0105249_10296036 | Ga0105249_102960362 | 165 |
| 8 | 3300031240 | Ga0265320_10023737 | Ga0265320_100237374 | 168 |
| 9 | 3300042436 | Ga0439435_0055683 | Ga0439435_0055683_90_791 | 168 |
| 10 | 3300025935 | Ga0207709_10011139 | Ga0207709_100111394 | 169 |
| 11 | 3300025981 | Ga0207640_10091096 | Ga0207640_100910962 | 169 |
| 12 | 3300005455 | Ga0070663_100063240 | Ga0070663_1000632402 | 170 |
| 13 | 3300009147 | Ga0114129_10124504 | Ga0114129_101245042 | 170 |
| 14 | 3300050507 | nmdc:mga05p37_42707_c1 | nmdc:mga05p37_42707_c1_2643_3344 | 170 |
| 15 | 3300050515 | nmdc:mga0a205_18236_c1 | nmdc:mga0a205_18236_c1_3794_4495 | 170 |
| 16 | 3300050515 | nmdc:mga0a205_945903_c1 | nmdc:mga0a205_945903_c1_34_663 | 170 |
| 17 | 3300048908 | Ga0496105_0706237 | Ga0496105_0706237_89_742 | 171 |
| 18 | 3300006028 | Ga0070717_10286119 | Ga0070717_102861192 | 173 |
| 19 | 3300026142 | Ga0207698_10010543 | Ga0207698_100105433 | 173 |
| 20 | 3300025929 | Ga0207664_10055565 | Ga0207664_100555654 | 174 |
| 21 | 3300044901 | Ga0466960_0191651 | Ga0466960_0191651_145_879 | 175 |
| 22 | 3300050496 | nmdc:mga07m45_17594_c3 | nmdc:mga07m45_17594_c3_14_682 | 175 |
| 23 | 3300005329 | Ga0070683_100015345 | Ga0070683_1000153456 | 176 |
| 24 | 3300005456 | Ga0070678_100041478 | Ga0070678_1000414783 | 176 |
| 25 | 3300005458 | Ga0070681_10145748 | Ga0070681_101457482 | 176 |
| 26 | 3300005458 | Ga0070681_10198307 | Ga0070681_101983073 | 176 |
| 27 | 3300005535 | Ga0070684_100024248 | Ga0070684_1000242484 | 176 |
| 28 | 3300025901 | Ga0207688_10032968 | Ga0207688_100329682 | 176 |
| 29 | 3300025912 | Ga0207707_10083857 | Ga0207707_100838572 | 176 |
| 30 | 3300025912 | Ga0207707_10090526 | Ga0207707_100905264 | 176 |
| 31 | 3300025939 | Ga0207665_10063591 | Ga0207665_100635912 | 176 |
| 32 | 3300025944 | Ga0207661_10000190 | Ga0207661_100001909 | 176 |
| 33 | 3300031247 | Ga0265340_10023806 | Ga0265340_100238062 | 176 |
| 34 | 3300031616 | Ga0307508_10067571 | Ga0307508_100675712 | 176 |
| 35 | 3300031711 | Ga0265314_10223287 | Ga0265314_102232872 | 176 |
| 36 | 3300037466 | Ga0395898_0776067 | Ga0395898_0776067_22_786 | 176 |
| 37 | 3300048929 | Ga0496126_0211855 | Ga0496126_0211855_393_1130 | 176 |
| 38 | 3300005329 | Ga0070683_100142631 | Ga0070683_1001426311 | 177 |
| 39 | 3300005336 | Ga0070680_100054166 | Ga0070680_1000541664 | 177 |
| 40 | 3300005344 | Ga0070661_100180662 | Ga0070661_1001806622 | 177 |
| 41 | 3300005530 | Ga0070679_100023383 | Ga0070679_1000233835 | 177 |
| 42 | 3300005563 | Ga0068855_100055309 | Ga0068855_1000553091 | 177 |
| 43 | 3300005614 | Ga0068856_100126034 | Ga0068856_1001260345 | 177 |
| 44 | 3300005618 | Ga0068864_100708691 | Ga0068864_1007086911 | 177 |
| 45 | 3300006058 | Ga0075432_10047710 | Ga0075432_100477102 | 177 |
| 46 | 3300006175 | Ga0070712_100260100 | Ga0070712_1002601001 | 177 |
| 47 | 3300009093 | Ga0105240_10018029 | Ga0105240_100180298 | 177 |
| 48 | 3300009098 | Ga0105245_10013572 | Ga0105245_100135726 | 177 |
| 49 | 3300009176 | Ga0105242_10095956 | Ga0105242_100959562 | 177 |
| 50 | 3300009177 | Ga0105248_10554102 | Ga0105248_105541022 | 177 |
| 51 | 3300010375 | Ga0105239_10194302 | Ga0105239_101943022 | 177 |
| 52 | 3300013102 | Ga0157371_10132671 | Ga0157371_101326712 | 177 |
| 53 | 3300013104 | Ga0157370_10069454 | Ga0157370_100694544 | 177 |
| 54 | 3300013105 | Ga0157369_10663744 | Ga0157369_106637442 | 177 |
| 55 | 3300013296 | Ga0157374_10031921 | Ga0157374_100319212 | 177 |
| 56 | 3300013306 | Ga0163162_10015679 | Ga0163162_100156798 | 177 |
| 57 | 3300014325 | Ga0163163_10020344 | Ga0163163_100203444 | 177 |
| 58 | 3300014969 | Ga0157376_10008083 | Ga0157376_100080835 | 177 |
| 59 | 3300025901 | Ga0207688_10149582 | Ga0207688_101495821 | 177 |
| 60 | 3300025913 | Ga0207695_10274461 | Ga0207695_102744612 | 177 |
| 61 | 3300025920 | Ga0207649_10323198 | Ga0207649_103231982 | 177 |
| 62 | 3300025921 | Ga0207652_10085603 | Ga0207652_100856032 | 177 |
| 63 | 3300025927 | Ga0207687_10039946 | Ga0207687_100399463 | 177 |
| 64 | 3300025928 | Ga0207700_10547359 | Ga0207700_105473591 | 177 |
| 65 | 3300025949 | Ga0207667_10014052 | Ga0207667_100140526 | 177 |
| 66 | 3300025960 | Ga0207651_10815254 | Ga0207651_108152541 | 177 |
| 67 | 3300026023 | Ga0207677_10051431 | Ga0207677_100514313 | 177 |
| 68 | 3300026067 | Ga0207678_10012679 | Ga0207678_100126798 | 177 |
| 69 | 3300026078 | Ga0207702_10235293 | Ga0207702_102352932 | 177 |
| 70 | 3300031711 | Ga0265314_10005339 | Ga0265314_100053396 | 177 |
| 71 | 3300035118 | Ga0373954_0000659 | Ga0373954_0000659_11430_12167 | 177 |
| 72 | 3300035119 | Ga0373956_0004523 | Ga0373956_0004523_4288_5025 | 177 |
| 73 | 3300035120 | Ga0373957_0011611 | Ga0373957_0011611_1359_2096 | 177 |
| 74 | 3300035172 | Ga0373955_0000335 | Ga0373955_0000335_11366_12103 | 177 |
| 75 | 3300035410 | Ga0373924_0012720 | Ga0373924_0012720_1036_1773 | 177 |
| 76 | 3300035695 | Ga0373927_0191853 | Ga0373927_0191853_223_960 | 177 |
| 77 | 3300035724 | Ga0373933_0030121 | Ga0373933_0030121_735_1472 | 177 |
| 78 | 3300036401 | Ga0373937_0026361 | Ga0373937_0026361_3506_4243 | 177 |
| 79 | 3300046459 | Ga0495629_0002353 | Ga0495629_0002353_5878_6615 | 177 |
| 80 | 3300046463 | Ga0495653_0041016 | Ga0495653_0041016_1655_2392 | 177 |
| 81 | 3300046511 | Ga0495608_0095340 | Ga0495608_0095340_1138_1875 | 177 |
| 82 | 3300046516 | Ga0495628_0163656 | Ga0495628_0163656_326_1063 | 177 |
| 83 | 3300046529 | Ga0495652_0148607 | Ga0495652_0148607_320_1057 | 177 |
| 84 | 3300046533 | Ga0495640_0004127 | Ga0495640_0004127_10256_10993 | 177 |
| 85 | 3300046663 | Ga0495635_0050435 | Ga0495635_0050435_1235_1972 | 177 |
| 86 | 3300046675 | Ga0495657_0066317 | Ga0495657_0066317_897_1634 | 177 |
| 87 | 3300046678 | Ga0495599_0058003 | Ga0495599_0058003_834_1571 | 177 |
| 88 | 3300046679 | Ga0495623_0027760 | Ga0495623_0027760_2643_3380 | 177 |
| 89 | 3300046689 | Ga0495613_0040882 | Ga0495613_0040882_851_1588 | 177 |
| 90 | 3300046809 | Ga0495600_0088311 | Ga0495600_0088311_752_1489 | 177 |
| 91 | 3300047317 | Ga0495604_0150309 | Ga0495604_0150309_842_1579 | 177 |
| 92 | 3300047319 | Ga0495674_0410375 | Ga0495674_0410375_104_841 | 177 |
| 93 | 3300047322 | Ga0495680_0034539 | Ga0495680_0034539_852_1589 | 177 |
| 94 | 3300047444 | Ga0495675_0003409 | Ga0495675_0003409_6497_7234 | 177 |
| 95 | 3300047469 | Ga0495673_0046634 | Ga0495673_0046634_1135_1872 | 177 |
| 96 | 3300047471 | Ga0495684_0013598 | Ga0495684_0013598_1138_1875 | 177 |
| 97 | 3300047673 | Ga0495593_0001736 | Ga0495593_0001736_11357_12094 | 177 |
| 98 | 3300048088 | Ga0495602_0099423 | Ga0495602_0099423_127_864 | 177 |
| 99 | 3300048904 | Ga0496101_0007388 | Ga0496101_0007388_2677_3414 | 177 |
| 100 | 3300048905 | Ga0496102_0001495 | Ga0496102_0001495_15669_16406 | 177 |
| 101 | 3300048906 | Ga0496103_0051764 | Ga0496103_0051764_1428_2165 | 177 |
| 102 | 3300048909 | Ga0496106_0024986 | Ga0496106_0024986_3473_4210 | 177 |
| 103 | 3300048913 | Ga0496110_0222294 | Ga0496110_0222294_870_1607 | 177 |
| 104 | 3300048914 | Ga0496111_0060590 | Ga0496111_0060590_1225_1962 | 177 |
| 105 | 3300048915 | Ga0496112_0004295 | Ga0496112_0004295_3664_4401 | 177 |
| 106 | 3300048917 | Ga0496114_0019092 | Ga0496114_0019092_3090_3827 | 177 |
| 107 | 3300048918 | Ga0496115_0001988 | Ga0496115_0001988_9515_10252 | 177 |
| 108 | 3300049568 | Ga0501031_0006301 | Ga0501031_0006301_1212_1946 | 177 |
| 109 | 3300049569 | Ga0501032_0000320 | Ga0501032_0000320_8379_9113 | 177 |
| 110 | 3300049570 | Ga0501033_0000968 | Ga0501033_0000968_8400_9134 | 177 |
| 111 | 3300049571 | Ga0501034_0000058 | Ga0501034_0000058_189421_190155 | 177 |
| 112 | 3300049572 | Ga0501036_0001143 | Ga0501036_0001143_8725_9459 | 177 |
| 113 | 3300049573 | Ga0501037_0000700 | Ga0501037_0000700_8400_9134 | 177 |
| 114 | 3300049574 | Ga0501038_0000059 | Ga0501038_0000059_75144_75878 | 177 |
| 115 | 3300049575 | Ga0501039_0001176 | Ga0501039_0001176_10068_10802 | 177 |
| 116 | 3300049579 | Ga0501043_0007372 | Ga0501043_0007372_2681_3415 | 177 |
| 117 | 3300049580 | Ga0501046_0002041 | Ga0501046_0002041_10308_11042 | 177 |
| 118 | 3300049581 | Ga0501047_0000022 | Ga0501047_0000022_96828_97562 | 177 |
| 119 | 3300049582 | Ga0501048_0001669 | Ga0501048_0001669_8769_9503 | 177 |
| 120 | 3300049583 | Ga0501067_0003092 | Ga0501067_0003092_5444_6178 | 177 |
| 121 | 3300049584 | Ga0501068_0015136 | Ga0501068_0015136_1047_1781 | 177 |
| 122 | 3300049586 | Ga0501070_0001070 | Ga0501070_0001070_7095_7829 | 177 |
| 123 | 3300049589 | Ga0501073_0000604 | Ga0501073_0000604_16936_17670 | 177 |
| 124 | 3300049590 | Ga0501074_0000028 | Ga0501074_0000028_58462_59196 | 177 |
| 125 | 3300049592 | Ga0501076_0160357 | Ga0501076_0160357_1014_1748 | 177 |
| 126 | 3300049741 | Ga0501079_0001041 | Ga0501079_0001041_10088_10822 | 177 |
| 127 | 3300049742 | Ga0501080_0001713 | Ga0501080_0001713_3702_4436 | 177 |
| 128 | 3300049744 | Ga0501083_0001278 | Ga0501083_0001278_7708_8442 | 177 |
| 129 | 3300049822 | Ga0501035_0000240 | Ga0501035_0000240_48776_49510 | 177 |
| 130 | 3300049823 | Ga0501044_0025135 | Ga0501044_0025135_2901_3635 | 177 |
| 131 | 3300049824 | Ga0501045_0007836 | Ga0501045_0007836_5809_6543 | 177 |
| 132 | 3300053084 | Ga0495595_0003363 | Ga0495595_0003363_3561_4298 | 177 |
| 133 | 3300054114 | Ga0501084_0021521 | Ga0501084_0021521_702_1436 | 177 |
| 134 | 3300005293 | Ga0065715_10227956 | Ga0065715_102279561 | 178 |
| 135 | 3300005337 | Ga0070682_100064479 | Ga0070682_1000644792 | 178 |
| 136 | 3300005355 | Ga0070671_100014371 | Ga0070671_1000143713 | 178 |
| 137 | 3300005439 | Ga0070711_100002557 | Ga0070711_1000025579 | 178 |
| 138 | 3300005455 | Ga0070663_100012086 | Ga0070663_1000120863 | 178 |
| 139 | 3300006028 | Ga0070717_10170081 | Ga0070717_101700812 | 178 |
| 140 | 3300006163 | Ga0070715_10145995 | Ga0070715_101459951 | 178 |
| 141 | 3300006844 | Ga0075428_100003218 | Ga0075428_1000032185 | 178 |
| 142 | 3300006847 | Ga0075431_100015919 | Ga0075431_1000159196 | 178 |
| 143 | 3300006871 | Ga0075434_100016586 | Ga0075434_1000165864 | 178 |
| 144 | 3300006880 | Ga0075429_100001278 | Ga0075429_10000127810 | 178 |
| 145 | 3300006880 | Ga0075429_100008235 | Ga0075429_1000082352 | 178 |
| 146 | 3300007076 | Ga0075435_100252580 | Ga0075435_1002525801 | 178 |
| 147 | 3300009094 | Ga0111539_10000530 | Ga0111539_1000053038 | 178 |
| 148 | 3300009147 | Ga0114129_10020594 | Ga0114129_100205943 | 178 |
| 149 | 3300009147 | Ga0114129_10120587 | Ga0114129_101205873 | 178 |
| 150 | 3300013307 | Ga0157372_10231336 | Ga0157372_102313362 | 178 |
| 151 | 3300013308 | Ga0157375_10012064 | Ga0157375_100120646 | 178 |
| 152 | 3300025906 | Ga0207699_10462260 | Ga0207699_104622601 | 178 |
| 153 | 3300025931 | Ga0207644_10049690 | Ga0207644_100496902 | 178 |
| 154 | 3300025940 | Ga0207691_10438690 | Ga0207691_104386901 | 178 |
| 155 | 3300026121 | Ga0207683_10370128 | Ga0207683_103701282 | 178 |
| 156 | 3300027671 | Ga0209588_1063288 | Ga0209588_10632882 | 178 |
| 157 | 3300027907 | Ga0207428_10004136 | Ga0207428_100041362 | 178 |
| 158 | 3300028563 | Ga0265319_1071362 | Ga0265319_10713621 | 178 |
| 159 | 3300028577 | Ga0265318_10018048 | Ga0265318_100180485 | 178 |
| 160 | 3300028654 | Ga0265322_10007102 | Ga0265322_100071022 | 178 |
| 161 | 3300028800 | Ga0265338_10013244 | Ga0265338_100132446 | 178 |
| 162 | 3300031240 | Ga0265320_10095617 | Ga0265320_100956172 | 178 |
| 163 | 3300031344 | Ga0265316_10025605 | Ga0265316_100256054 | 178 |
| 164 | 3300031548 | Ga0307408_100006290 | Ga0307408_1000062908 | 178 |
| 165 | 3300031712 | Ga0265342_10073470 | Ga0265342_100734702 | 178 |
| 166 | 3300031731 | Ga0307405_10026086 | Ga0307405_100260865 | 178 |
| 167 | 3300031901 | Ga0307406_10028243 | Ga0307406_100282433 | 178 |
| 168 | 3300031911 | Ga0307412_10023279 | Ga0307412_100232793 | 178 |
| 169 | 3300032005 | Ga0307411_10569420 | Ga0307411_105694201 | 178 |
| 170 | 3300039447 | Ga0436361_0002710 | Ga0436361_0002710_1406_2143 | 178 |
| 171 | 3300039447 | Ga0436361_0457489 | Ga0436361_0457489_237_974 | 178 |
| 172 | 3300042439 | Ga0439464_0022775 | Ga0439464_0022775_741_1496 | 178 |
| 173 | 3300046507 | Ga0495606_0216465 | Ga0495606_0216465_189_926 | 178 |
| 174 | 3300048908 | Ga0496105_0013499 | Ga0496105_0013499_3291_4028 | 178 |
| 175 | 3300050507 | nmdc:mga05p37_382_c1 | nmdc:mga05p37_382_c1_31711_32466 | 178 |
| 176 | 3300050508 | nmdc:mga09592_12628_c1 | nmdc:mga09592_12628_c1_3360_4115 | 178 |
| 177 | 3300050508 | nmdc:mga09592_6583_c1 | nmdc:mga09592_6583_c1_3577_4332 | 178 |
| 178 | 3300050510 | nmdc:mga06r32_1110_c1 | nmdc:mga06r32_1110_c1_22735_23490 | 178 |
| 179 | 3300050511 | nmdc:mga08y16_5292_c1 | nmdc:mga08y16_5292_c1_7914_8669 | 178 |
| 180 | 3300050511 | nmdc:mga08y16_796031_c1 | nmdc:mga08y16_796031_c1_147_890 | 178 |
| 181 | 3300050512 | nmdc:mga0n895_14188_c1 | nmdc:mga0n895_14188_c1_1331_2068 | 178 |
| 182 | 3300050513 | nmdc:mga0rr50_25988_c1 | nmdc:mga0rr50_25988_c1_284_1021 | 178 |
| 183 | 3300053119 | Ga0500595_002200 | Ga0500595_002200_5119_5856 | 178 |
| 184 | 3300060353 | Ga0501082_0000428 | Ga0501082_0000428_26984_27766 | 178 |
| 185 | 3300005339 | Ga0070660_100241275 | Ga0070660_1002412751 | 179 |
| 186 | 3300005340 | Ga0070689_100532399 | Ga0070689_1005323991 | 179 |
| 187 | 3300005543 | Ga0070672_100331743 | Ga0070672_1003317432 | 179 |
| 188 | 3300005614 | Ga0068856_100226003 | Ga0068856_1002260032 | 179 |
| 189 | 3300005844 | Ga0068862_100555275 | Ga0068862_1005552752 | 179 |
| 190 | 3300025919 | Ga0207657_10543259 | Ga0207657_105432591 | 179 |
| 191 | 3300025936 | Ga0207670_10332880 | Ga0207670_103328801 | 179 |
| 192 | 3300026078 | Ga0207702_10235214 | Ga0207702_102352142 | 179 |
| 193 | 3300026116 | Ga0207674_10333033 | Ga0207674_103330331 | 179 |
| 194 | 3300027682 | Ga0209971_1032374 | Ga0209971_10323742 | 179 |
| 195 | 3300031249 | Ga0265339_10021860 | Ga0265339_100218602 | 179 |
| 196 | 3300031595 | Ga0265313_10015356 | Ga0265313_100153562 | 179 |
| 197 | 3300031911 | Ga0307412_10298363 | Ga0307412_102983632 | 179 |
| 198 | 3300032002 | Ga0307416_100114688 | Ga0307416_1001146882 | 179 |
| 199 | 3300032126 | Ga0307415_100226691 | Ga0307415_1002266912 | 179 |
| 200 | 3300048915 | Ga0496112_0650197 | Ga0496112_0650197_155_895 | 179 |
| 201 | 3300053733 | Ga0500552_001098 | Ga0500552_001098_1106_1837 | 179 |
| 202 | 3300005530 | Ga0070679_100083175 | Ga0070679_1000831753 | 180 |
| 203 | 3300006852 | Ga0075433_10016728 | Ga0075433_100167282 | 180 |
| 204 | 3300025921 | Ga0207652_10014990 | Ga0207652_100149904 | 180 |
| 205 | 3300044694 | Ga0466963_0183189 | Ga0466963_0183189_396_1127 | 180 |
| 206 | 3300046663 | Ga0495635_0065696 | Ga0495635_0065696_1226_2014 | 180 |
| 207 | 3300046678 | Ga0495599_0006109 | Ga0495599_0006109_3408_4148 | 180 |
| 208 | 3300048922 | Ga0496119_0118951 | Ga0496119_0118951_87_827 | 180 |
| 209 | 3300005436 | Ga0070713_100491640 | Ga0070713_1004916402 | 181 |
| 210 | 3300005615 | Ga0070702_100220132 | Ga0070702_1002201322 | 181 |
| 211 | 3300006177 | Ga0075362_10010175 | Ga0075362_100101752 | 181 |
| 212 | 3300025903 | Ga0207680_10180597 | Ga0207680_101805972 | 181 |
| 213 | 3300025928 | Ga0207700_10424045 | Ga0207700_104240452 | 181 |
| 214 | 3300049592 | Ga0501076_0416660 | Ga0501076_0416660_176_907 | 181 |
| 215 | 3300050489 | nmdc:mga03683_2041_c1 | nmdc:mga03683_2041_c1_3178_3912 | 181 |
| 216 | 3300005440 | Ga0070705_100212756 | Ga0070705_1002127562 | 182 |
| 217 | 3300005535 | Ga0070684_100153804 | Ga0070684_1001538042 | 182 |
| 218 | 3300005614 | Ga0068856_100175834 | Ga0068856_1001758342 | 182 |
| 219 | 3300009093 | Ga0105240_10023440 | Ga0105240_100234403 | 182 |
| 220 | 3300014325 | Ga0163163_10866652 | Ga0163163_108666522 | 182 |
| 221 | 3300025913 | Ga0207695_10194253 | Ga0207695_101942532 | 182 |
| 222 | 3300026078 | Ga0207702_10145220 | Ga0207702_101452202 | 182 |
| 223 | 3300037418 | Ga0395900_0031469 | Ga0395900_0031469_801_1538 | 182 |
| 224 | 3300037466 | Ga0395898_0117142 | Ga0395898_0117142_1397_2134 | 182 |
| 225 | 3300048908 | Ga0496105_0170645 | Ga0496105_0170645_751_1458 | 182 |
| 226 | 3300048912 | Ga0496109_0141375 | Ga0496109_0141375_1374_2081 | 182 |
| 227 | 3300044684 | Ga0466966_0127733 | Ga0466966_0127733_127_903 | 183 |
| 228 | 3300044712 | Ga0453684_0615778 | Ga0453684_0615778_212_952 | 183 |
| 229 | 3300006943 | Ga0099822_1012158 | Ga0099822_101215812 | 184 |
| 230 | 3300035112 | Ga0373932_0047869 | Ga0373932_0047869_445_1179 | 184 |
| 231 | 3300026075 | Ga0207708_10567274 | Ga0207708_105672741 | 185 |
| 232 | 3300031507 | Ga0307509_10084453 | Ga0307509_100844533 | 185 |
| 233 | 3300046455 | Ga0495603_0168875 | Ga0495603_0168875_101_838 | 185 |
| 234 | 3300047470 | Ga0495681_0099164 | Ga0495681_0099164_262_999 | 185 |
| 235 | 3300049742 | Ga0501080_0179275 | Ga0501080_0179275_195_932 | 185 |
| 236 | 3300053156 | Ga0500622_0039492 | Ga0500622_0039492_110_832 | 185 |
| 237 | 3300005329 | Ga0070683_100279086 | Ga0070683_1002790862 | 186 |
| 238 | 3300005842 | Ga0068858_100350079 | Ga0068858_1003500791 | 186 |
| 239 | 3300025925 | Ga0207650_10868217 | Ga0207650_108682171 | 186 |
| 240 | 3300025944 | Ga0207661_10233963 | Ga0207661_102339632 | 186 |
| 241 | 3300035113 | Ga0373936_0000007 | Ga0373936_0000007_268548_269297 | 186 |
| 242 | 3300045051 | Ga0451576_1276630 | Ga0451576_1276630_12_749 | 186 |
| 243 | 3300048929 | Ga0496126_0048866 | Ga0496126_0048866_1413_2147 | 186 |
| 244 | 3300009094 | Ga0111539_10284131 | Ga0111539_102841312 | 187 |
| 245 | 3300047315 | Ga0495581_0039677 | Ga0495581_0039677_1802_2539 | 187 |
| 246 | 3300050509 | nmdc:mga0qj67_168329_c1 | nmdc:mga0qj67_168329_c1_859_1659 | 187 |
| 247 | 3300053103 | Ga0500555_036849 | Ga0500555_036849_52_789 | 187 |
| 248 | 3300053108 | Ga0500562_021658 | Ga0500562_021658_136_873 | 187 |
| 249 | 3300005937 | Ga0081455_10035073 | Ga0081455_100350732 | 188 |
| 250 | 3300009551 | Ga0105238_10809571 | Ga0105238_108095712 | 188 |
| 251 | 3300013308 | Ga0157375_10264048 | Ga0157375_102640482 | 188 |
| 252 | 3300049576 | Ga0501040_0481625 | Ga0501040_0481625_60_803 | 188 |
| 253 | 3300049577 | Ga0501041_0332608 | Ga0501041_0332608_98_841 | 188 |
| 254 | 3300005329 | Ga0070683_100659229 | Ga0070683_1006592292 | 189 |
| 255 | 3300005335 | Ga0070666_10208809 | Ga0070666_102088092 | 189 |
| 256 | 3300005354 | Ga0070675_100603499 | Ga0070675_1006034991 | 189 |
| 257 | 3300005356 | Ga0070674_100036608 | Ga0070674_1000366082 | 189 |
| 258 | 3300005456 | Ga0070678_100011840 | Ga0070678_1000118405 | 189 |
| 259 | 3300005459 | Ga0068867_100009412 | Ga0068867_1000094123 | 189 |
| 260 | 3300005535 | Ga0070684_100179971 | Ga0070684_1001799712 | 189 |
| 261 | 3300005719 | Ga0068861_100098000 | Ga0068861_1000980003 | 189 |
| 262 | 3300006881 | Ga0068865_100017220 | Ga0068865_1000172204 | 189 |
| 263 | 3300013104 | Ga0157370_10147564 | Ga0157370_101475642 | 189 |
| 264 | 3300013105 | Ga0157369_10004231 | Ga0157369_1000423116 | 189 |
| 265 | 3300017792 | Ga0163161_10056138 | Ga0163161_100561381 | 189 |
| 266 | 3300020070 | Ga0206356_11686928 | Ga0206356_116869281 | 189 |
| 267 | 3300025899 | Ga0207642_10278613 | Ga0207642_102786131 | 189 |
| 268 | 3300025926 | Ga0207659_10373069 | Ga0207659_103730692 | 189 |
| 269 | 3300025937 | Ga0207669_10015538 | Ga0207669_100155382 | 189 |
| 270 | 3300025938 | Ga0207704_10004400 | Ga0207704_100044004 | 189 |
| 271 | 3300025940 | Ga0207691_10297276 | Ga0207691_102972762 | 189 |
| 272 | 3300026089 | Ga0207648_10038090 | Ga0207648_100380904 | 189 |
| 273 | 3300026118 | Ga0207675_100193789 | Ga0207675_1001937892 | 189 |
| 274 | 3300046615 | Ga0495656_0002791 | Ga0495656_0002791_485_1222 | 189 |
| 275 | 3300046616 | Ga0495668_0273560 | Ga0495668_0273560_10_747 | 189 |
| 276 | 3300046684 | Ga0495669_0006435 | Ga0495669_0006435_3762_4499 | 189 |
| 277 | 3300048903 | Ga0496100_0640046 | Ga0496100_0640046_39_776 | 189 |
| 278 | 3300048904 | Ga0496101_0072062 | Ga0496101_0072062_1501_2238 | 189 |
| 279 | 3300035118 | Ga0373954_0164926 | Ga0373954_0164926_105_842 | 190 |
| 280 | 3300045976 | Ga0466967_0416412 | Ga0466967_0416412_177_914 | 190 |
| 281 | 3300046455 | Ga0495603_0092775 | Ga0495603_0092775_669_1406 | 190 |
| 282 | 3300046475 | Ga0495639_0028217 | Ga0495639_0028217_384_1121 | 190 |
| 283 | 3300053077 | Ga0495601_0118081 | Ga0495601_0118081_695_1432 | 190 |
| 284 | 3300026089 | Ga0207648_10377994 | Ga0207648_103779942 | 191 |
| 285 | 3300046519 | Ga0495632_0057182 | Ga0495632_0057182_751_1488 | 191 |
| 286 | 3300005843 | Ga0068860_100196291 | Ga0068860_1001962912 | 193 |
| 287 | 3300007788 | Ga0099795_10154354 | Ga0099795_101543541 | 193 |
| 288 | 3300031901 | Ga0307406_10616402 | Ga0307406_106164021 | 193 |
| 289 | 3300035170 | Ga0373943_0237717 | Ga0373943_0237717_158_895 | 193 |
| 290 | 3300036401 | Ga0373937_0974171 | Ga0373937_0974171_35_757 | 193 |
| 291 | 3300048918 | Ga0496115_0261308 | Ga0496115_0261308_524_1258 | 193 |
| 292 | 3300005445 | Ga0070708_100221465 | Ga0070708_1002214652 | 194 |
| 293 | 3300005471 | Ga0070698_100145423 | Ga0070698_1001454232 | 194 |
| 294 | 3300005843 | Ga0068860_100001542 | Ga0068860_10000154222 | 194 |
| 295 | 3300005937 | Ga0081455_10000156 | Ga0081455_1000015629 | 194 |
| 296 | 3300005937 | Ga0081455_10014081 | Ga0081455_100140813 | 194 |
| 297 | 3300005983 | Ga0081540_1010442 | Ga0081540_10104423 | 194 |
| 298 | 3300006038 | Ga0075365_10179135 | Ga0075365_101791352 | 194 |
| 299 | 3300006038 | Ga0075365_10261830 | Ga0075365_102618301 | 194 |
| 300 | 3300006178 | Ga0075367_10343471 | Ga0075367_103434711 | 194 |
| 301 | 3300006186 | Ga0075369_10096155 | Ga0075369_100961551 | 194 |
| 302 | 3300007788 | Ga0099795_10038100 | Ga0099795_100381002 | 194 |
| 303 | 3300025261 | Ga0209233_1004497 | Ga0209233_10044973 | 194 |
| 304 | 3300025910 | Ga0207684_10281335 | Ga0207684_102813352 | 194 |
| 305 | 3300025922 | Ga0207646_10091778 | Ga0207646_100917783 | 194 |
| 306 | 3300025942 | Ga0207689_10061064 | Ga0207689_100610642 | 194 |
| 307 | 3300026121 | Ga0207683_10045001 | Ga0207683_100450013 | 194 |
| 308 | 3300026142 | Ga0207698_10136945 | Ga0207698_101369451 | 194 |
| 309 | 3300045976 | Ga0466967_0631746 | Ga0466967_0631746_31_756 | 194 |
| 310 | 3300046459 | Ga0495629_0112536 | Ga0495629_0112536_101_838 | 194 |
| 311 | 3300046663 | Ga0495635_0245052 | Ga0495635_0245052_207_944 | 194 |
| 312 | 3300047472 | Ga0495686_0120156 | Ga0495686_0120156_599_1369 | 194 |
| 313 | 3300050492 | nmdc:mga0yw44_140863_c1 | nmdc:mga0yw44_140863_c1_664_1395 | 194 |
| 314 | 3300050492 | nmdc:mga0yw44_216580_c1 | nmdc:mga0yw44_216580_c1_309_1040 | 194 |
| 315 | 3300050493 | nmdc:mga0k408_55170_c1 | nmdc:mga0k408_55170_c1_683_1414 | 194 |
| 316 | 3300050494 | nmdc:mga06z11_68282_c1 | nmdc:mga06z11_68282_c1_420_1151 | 194 |
| 317 | 3300050516 | nmdc:mga0sz30_86766_c1 | nmdc:mga0sz30_86766_c1_407_1138 | 194 |
| 318 | 3300053153 | Ga0500616_0001188 | Ga0500616_0001188_25591_26322 | 194 |
| 319 | iso_pu_bacteria | 8006964411 | 8006965126 | 194 |
| 320 | 3300005614 | Ga0068856_100000050 | Ga0068856_10000005079 | 195 |
| 321 | 3300005937 | Ga0081455_10019461 | Ga0081455_100194614 | 195 |
| 322 | 3300006175 | Ga0070712_100415473 | Ga0070712_1004154732 | 195 |
| 323 | 3300006177 | Ga0075362_10126289 | Ga0075362_101262891 | 195 |
| 324 | 3300009177 | Ga0105248_10042929 | Ga0105248_100429295 | 195 |
| 325 | 3300009545 | Ga0105237_10630826 | Ga0105237_106308262 | 195 |
| 326 | 3300010375 | Ga0105239_10061849 | Ga0105239_100618495 | 195 |
| 327 | 3300013306 | Ga0163162_10574513 | Ga0163162_105745132 | 195 |
| 328 | 3300021361 | Ga0213872_10029234 | Ga0213872_100292342 | 195 |
| 329 | 3300025910 | Ga0207684_10010041 | Ga0207684_100100412 | 195 |
| 330 | 3300025915 | Ga0207693_10362025 | Ga0207693_103620251 | 195 |
| 331 | 3300025922 | Ga0207646_10224389 | Ga0207646_102243892 | 195 |
| 332 | 3300025934 | Ga0207686_10274860 | Ga0207686_102748601 | 195 |
| 333 | 3300025941 | Ga0207711_10164945 | Ga0207711_101649452 | 195 |
| 334 | 3300026078 | Ga0207702_10000197 | Ga0207702_100001975 | 195 |
| 335 | 3300031251 | Ga0265327_10000493 | Ga0265327_1000049310 | 195 |
| 336 | 3300035085 | Ga0373929_0027011 | Ga0373929_0027011_18_752 | 195 |
| 337 | 3300035691 | Ga0373931_0022655 | Ga0373931_0022655_1514_2248 | 195 |
| 338 | 3300035695 | Ga0373927_0205395 | Ga0373927_0205395_539_1273 | 195 |
| 339 | 3300036647 | Ga0316582_0202904 | Ga0316582_0202904_341_1069 | 195 |
| 340 | 3300045049 | Ga0466959_0047268 | Ga0466959_0047268_1074_1808 | 195 |
| 341 | 3300048903 | Ga0496100_0421853 | Ga0496100_0421853_257_991 | 195 |
| 342 | 3300048904 | Ga0496101_0006299 | Ga0496101_0006299_6339_7073 | 195 |
| 343 | 3300048905 | Ga0496102_0087694 | Ga0496102_0087694_285_1052 | 195 |
| 344 | 3300048907 | Ga0496104_0266192 | Ga0496104_0266192_191_958 | 195 |
| 345 | 3300048908 | Ga0496105_0138712 | Ga0496105_0138712_223_957 | 195 |
| 346 | 3300048910 | Ga0496107_0016292 | Ga0496107_0016292_3514_4248 | 195 |
| 347 | 3300048913 | Ga0496110_0391035 | Ga0496110_0391035_322_1056 | 195 |
| 348 | 3300048914 | Ga0496111_0029884 | Ga0496111_0029884_1127_1894 | 195 |
| 349 | 3300048917 | Ga0496114_0070783 | Ga0496114_0070783_669_1403 | 195 |
| 350 | 3300050489 | nmdc:mga03683_150150_c1 | nmdc:mga03683_150150_c1_203_934 | 195 |
| 351 | 3300005445 | Ga0070708_100176298 | Ga0070708_1001762983 | 196 |
| 352 | 3300005467 | Ga0070706_100027664 | Ga0070706_1000276642 | 196 |
| 353 | 3300005468 | Ga0070707_100005034 | Ga0070707_1000050348 | 196 |
| 354 | 3300005468 | Ga0070707_100239127 | Ga0070707_1002391273 | 196 |
| 355 | 3300005536 | Ga0070697_100087829 | Ga0070697_1000878293 | 196 |
| 356 | 3300005536 | Ga0070697_100414836 | Ga0070697_1004148362 | 196 |
| 357 | 3300005614 | Ga0068856_100305322 | Ga0068856_1003053222 | 196 |
| 358 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022020 | 196 |
| 359 | 3300006173 | Ga0070716_100007511 | Ga0070716_1000075112 | 196 |
| 360 | 3300006846 | Ga0075430_100183303 | Ga0075430_1001833032 | 196 |
| 361 | 3300006847 | Ga0075431_100087695 | Ga0075431_1000876951 | 196 |
| 362 | 3300006847 | Ga0075431_100098758 | Ga0075431_1000987582 | 196 |
| 363 | 3300006880 | Ga0075429_100026318 | Ga0075429_1000263184 | 196 |
| 364 | 3300006942 | Ga0099824_1011059 | Ga0099824_10110593 | 196 |
| 365 | 3300009094 | Ga0111539_10065332 | Ga0111539_100653323 | 196 |
| 366 | 3300009147 | Ga0114129_10113280 | Ga0114129_101132803 | 196 |
| 367 | 3300009147 | Ga0114129_10350211 | Ga0114129_103502112 | 196 |
| 368 | 3300009545 | Ga0105237_10219025 | Ga0105237_102190252 | 196 |
| 369 | 3300009551 | Ga0105238_10008261 | Ga0105238_100082612 | 196 |
| 370 | 3300021358 | Ga0213873_10074665 | Ga0213873_100746651 | 196 |
| 371 | 3300021384 | Ga0213876_10009013 | Ga0213876_100090138 | 196 |
| 372 | 3300025910 | Ga0207684_10053380 | Ga0207684_100533806 | 196 |
| 373 | 3300025914 | Ga0207671_10136388 | Ga0207671_101363882 | 196 |
| 374 | 3300025922 | Ga0207646_10002435 | Ga0207646_1000243511 | 196 |
| 375 | 3300025922 | Ga0207646_10201272 | Ga0207646_102012723 | 196 |
| 376 | 3300025922 | Ga0207646_10337707 | Ga0207646_103377071 | 196 |
| 377 | 3300025938 | Ga0207704_10486344 | Ga0207704_104863441 | 196 |
| 378 | 3300025939 | Ga0207665_10069236 | Ga0207665_100692362 | 196 |
| 379 | 3300025939 | Ga0207665_10162031 | Ga0207665_101620312 | 196 |
| 380 | 3300025939 | Ga0207665_10280905 | Ga0207665_102809052 | 196 |
| 381 | 3300025960 | Ga0207651_10723985 | Ga0207651_107239851 | 196 |
| 382 | 3300025972 | Ga0207668_10219227 | Ga0207668_102192272 | 196 |
| 383 | 3300026116 | Ga0207674_10147103 | Ga0207674_101471033 | 196 |
| 384 | 3300027357 | Ga0209589_1000006 | Ga0209589_100000634 | 196 |
| 385 | 3300027361 | Ga0209489_100007 | Ga0209489_10000734 | 196 |
| 386 | 3300027363 | Ga0209700_100008 | Ga0209700_10000834 | 196 |
| 387 | 3300027907 | Ga0207428_10006011 | Ga0207428_100060113 | 196 |
| 388 | 3300027907 | Ga0207428_10201582 | Ga0207428_102015821 | 196 |
| 389 | 3300028379 | Ga0268266_10239671 | Ga0268266_102396712 | 196 |
| 390 | 3300031852 | Ga0307410_10509933 | Ga0307410_105099332 | 196 |
| 391 | 3300035692 | Ga0373935_0304710 | Ga0373935_0304710_324_1055 | 196 |
| 392 | 3300037068 | Ga0373925_0091969 | Ga0373925_0091969_1177_1908 | 196 |
| 393 | 3300039437 | Ga0436365_1420650 | Ga0436365_1420650_12173_12916 | 196 |
| 394 | 3300039453 | Ga0436362_0910589 | Ga0436362_0910589_666_1409 | 196 |
| 395 | 3300046455 | Ga0495603_0057292 | Ga0495603_0057292_1001_1732 | 196 |
| 396 | 3300046459 | Ga0495629_0045702 | Ga0495629_0045702_302_1033 | 196 |
| 397 | 3300046473 | Ga0495582_0025264 | Ga0495582_0025264_2206_2937 | 196 |
| 398 | 3300046475 | Ga0495639_0018676 | Ga0495639_0018676_850_1581 | 196 |
| 399 | 3300046477 | Ga0495664_0129836 | Ga0495664_0129836_208_939 | 196 |
| 400 | 3300046499 | Ga0495594_0084734 | Ga0495594_0084734_935_1666 | 196 |
| 401 | 3300046517 | Ga0495630_0108049 | Ga0495630_0108049_329_1060 | 196 |
| 402 | 3300046526 | Ga0495666_0090833 | Ga0495666_0090833_580_1311 | 196 |
| 403 | 3300046531 | Ga0495665_0127794 | Ga0495665_0127794_151_882 | 196 |
| 404 | 3300046533 | Ga0495640_0080365 | Ga0495640_0080365_876_1607 | 196 |
| 405 | 3300046535 | Ga0495586_0035768 | Ga0495586_0035768_1114_1845 | 196 |
| 406 | 3300046681 | Ga0495647_0016646 | Ga0495647_0016646_406_1137 | 196 |
| 407 | 3300046683 | Ga0495658_0073406 | Ga0495658_0073406_358_1089 | 196 |
| 408 | 3300046683 | Ga0495658_0359373 | Ga0495658_0359373_35_772 | 196 |
| 409 | 3300046689 | Ga0495613_0049001 | Ga0495613_0049001_674_1405 | 196 |
| 410 | 3300046690 | Ga0495624_0243800 | Ga0495624_0243800_256_987 | 196 |
| 411 | 3300047315 | Ga0495581_0079912 | Ga0495581_0079912_1002_1733 | 196 |
| 412 | 3300047319 | Ga0495674_0076014 | Ga0495674_0076014_1609_2340 | 196 |
| 413 | 3300047321 | Ga0495676_0089104 | Ga0495676_0089104_1456_2187 | 196 |
| 414 | 3300047471 | Ga0495684_0080936 | Ga0495684_0080936_551_1282 | 196 |
| 415 | 3300048089 | Ga0495614_0006299 | Ga0495614_0006299_170_901 | 196 |
| 416 | 3300048903 | Ga0496100_0045950 | Ga0496100_0045950_1668_2399 | 196 |
| 417 | 3300048904 | Ga0496101_0276325 | Ga0496101_0276325_20_751 | 196 |
| 418 | 3300048908 | Ga0496105_0565669 | Ga0496105_0565669_73_804 | 196 |
| 419 | 3300048917 | Ga0496114_0158625 | Ga0496114_0158625_589_1320 | 196 |
| 420 | 3300049586 | Ga0501070_0042133 | Ga0501070_0042133_753_1484 | 196 |
| 421 | 3300049589 | Ga0501073_0345807 | Ga0501073_0345807_160_897 | 196 |
| 422 | 3300049742 | Ga0501080_0059875 | Ga0501080_0059875_577_1308 | 196 |
| 423 | 3300050507 | nmdc:mga05p37_313149_c1 | nmdc:mga05p37_313149_c1_949_1686 | 196 |
| 424 | 3300050507 | nmdc:mga05p37_50988_c1 | nmdc:mga05p37_50988_c1_2019_2819 | 196 |
| 425 | 3300050508 | nmdc:mga09592_3218_c1 | nmdc:mga09592_3218_c1_2621_3358 | 196 |
| 426 | 3300050511 | nmdc:mga08y16_768_c1 | nmdc:mga08y16_768_c1_23549_24286 | 196 |
| 427 | 3300053090 | Ga0500646_0039680 | Ga0500646_0039680_376_1113 | 196 |
| 428 | 3300053119 | Ga0500595_000602 | Ga0500595_000602_11997_12734 | 196 |
| 429 | 3300005434 | Ga0070709_10308735 | Ga0070709_103087351 | 197 |
| 430 | 3300005435 | Ga0070714_100139653 | Ga0070714_1001396531 | 197 |
| 431 | 3300005518 | Ga0070699_100581979 | Ga0070699_1005819791 | 197 |
| 432 | 3300006028 | Ga0070717_10409383 | Ga0070717_104093832 | 197 |
| 433 | 3300013296 | Ga0157374_10010696 | Ga0157374_100106964 | 197 |
| 434 | 3300013308 | Ga0157375_10820172 | Ga0157375_108201721 | 197 |
| 435 | 3300014325 | Ga0163163_10006895 | Ga0163163_100068957 | 197 |
| 436 | 3300021361 | Ga0213872_10037684 | Ga0213872_100376843 | 197 |
| 437 | 3300025929 | Ga0207664_10120601 | Ga0207664_101206012 | 197 |
| 438 | 3300025929 | Ga0207664_10707892 | Ga0207664_107078922 | 197 |
| 439 | 3300026023 | Ga0207677_10543270 | Ga0207677_105432701 | 197 |
| 440 | 3300035172 | Ga0373955_0399800 | Ga0373955_0399800_57_797 | 197 |
| 441 | 3300039437 | Ga0436365_1600738 | Ga0436365_1600738_428_1168 | 197 |
| 442 | 3300046472 | Ga0495580_0127670 | Ga0495580_0127670_997_1737 | 197 |
| 443 | 3300046511 | Ga0495608_0005147 | Ga0495608_0005147_5741_6472 | 197 |
| 444 | 3300047317 | Ga0495604_0340351 | Ga0495604_0340351_60_791 | 197 |
| 445 | 3300048911 | Ga0496108_0309099 | Ga0496108_0309099_232_972 | 197 |
| 446 | 3300026089 | Ga0207648_10622707 | Ga0207648_106227071 | 200 |
| 447 | 3300044842 | Ga0466957_0107601 | Ga0466957_0107601_663_1448 | 201 |
| 448 | 3300045836 | Ga0466958_0020701 | Ga0466958_0020701_722_1507 | 201 |
| 449 | 3300025944 | Ga0207661_10315798 | Ga0207661_103157982 | 202 |
| 450 | 3300044706 | Ga0466964_0110619 | Ga0466964_0110619_234_992 | 202 |
| 451 | 3300044719 | Ga0466971_0037692 | Ga0466971_0037692_266_1009 | 202 |
| 452 | 3300009093 | Ga0105240_10243085 | Ga0105240_102430853 | 203 |
| 453 | 3300037418 | Ga0395900_0092391 | Ga0395900_0092391_186_929 | 203 |
| 454 | 3300044658 | Ga0466972_0088655 | Ga0466972_0088655_10_768 | 203 |
| 455 | 3300044684 | Ga0466966_0171335 | Ga0466966_0171335_167_925 | 203 |
| 456 | 3300044693 | Ga0466961_0081668 | Ga0466961_0081668_1262_2020 | 203 |
| 457 | 3300044765 | Ga0466970_0052452 | Ga0466970_0052452_1327_2085 | 203 |
| 458 | 3300044842 | Ga0466957_0148365 | Ga0466957_0148365_531_1289 | 203 |
| 459 | 3300045049 | Ga0466959_0175690 | Ga0466959_0175690_186_944 | 203 |
| 460 | 3300046615 | Ga0495656_0015039 | Ga0495656_0015039_1339_2097 | 203 |
| 461 | 3300046810 | Ga0495660_0076901 | Ga0495660_0076901_832_1590 | 203 |
| 462 | 3300048927 | Ga0496124_0004606 | Ga0496124_0004606_13399_14142 | 203 |
| 463 | 3300049823 | Ga0501044_0234513 | Ga0501044_0234513_283_1041 | 203 |
| 464 | 3300005339 | Ga0070660_100122216 | Ga0070660_1001222162 | 204 |
| 465 | 3300005366 | Ga0070659_100103993 | Ga0070659_1001039932 | 204 |
| 466 | 3300005459 | Ga0068867_100215356 | Ga0068867_1002153562 | 204 |
| 467 | 3300025919 | Ga0207657_10441184 | Ga0207657_104411842 | 204 |
| 468 | 3300025935 | Ga0207709_10026119 | Ga0207709_100261195 | 204 |
| 469 | 3300025938 | Ga0207704_10259696 | Ga0207704_102596962 | 204 |
| 470 | 3300025945 | Ga0207679_10029891 | Ga0207679_100298912 | 204 |
| 471 | 3300026116 | Ga0207674_10320848 | Ga0207674_103208482 | 204 |
| 472 | 3300037312 | Ga0395899_0049891 | Ga0395899_0049891_660_1406 | 204 |
| 473 | 3300037312 | Ga0395899_0110937 | Ga0395899_0110937_473_1219 | 204 |
| 474 | 3300037418 | Ga0395900_0000324 | Ga0395900_0000324_34361_35119 | 204 |
| 475 | 3300037418 | Ga0395900_0016248 | Ga0395900_0016248_1452_2198 | 204 |
| 476 | 3300038443 | Ga0395901_0000089 | Ga0395901_0000089_89660_90418 | 204 |
| 477 | 3300038443 | Ga0395901_0237764 | Ga0395901_0237764_760_1506 | 204 |
| 478 | 3300044656 | Ga0466969_0168002 | Ga0466969_0168002_80_838 | 204 |
| 479 | 3300044694 | Ga0466963_0124760 | Ga0466963_0124760_1019_1762 | 204 |
| 480 | 3300045976 | Ga0466967_0026810 | Ga0466967_0026810_1940_2683 | 204 |
| 481 | 3300048913 | Ga0496110_0460812 | Ga0496110_0460812_146_892 | 204 |
| 482 | 3300048914 | Ga0496111_0623152 | Ga0496111_0623152_10_753 | 204 |
| 483 | 3300048917 | Ga0496114_0210769 | Ga0496114_0210769_207_953 | 204 |
| 484 | iso_pu_bacteria | 2643221556 | 2643799297 | 204 |
| 485 | iso_pu_bacteria | 2643221684 | 2644473370 | 204 |
| 486 | 3300005327 | Ga0070658_10050929 | Ga0070658_100509293 | 205 |
| 487 | 3300005563 | Ga0068855_100013239 | Ga0068855_1000132392 | 205 |
| 488 | 3300005564 | Ga0070664_100008099 | Ga0070664_1000080998 | 205 |
| 489 | 3300005616 | Ga0068852_100038503 | Ga0068852_1000385034 | 205 |
| 490 | 3300009148 | Ga0105243_10021057 | Ga0105243_100210573 | 205 |
| 491 | 3300013297 | Ga0157378_10379265 | Ga0157378_103792652 | 205 |
| 492 | 3300025909 | Ga0207705_10017941 | Ga0207705_100179412 | 205 |
| 493 | 3300025920 | Ga0207649_10220795 | Ga0207649_102207952 | 205 |
| 494 | 3300025933 | Ga0207706_10024502 | Ga0207706_100245025 | 205 |
| 495 | 3300025945 | Ga0207679_10065299 | Ga0207679_100652992 | 205 |
| 496 | 3300037312 | Ga0395899_0030051 | Ga0395899_0030051_2709_3452 | 205 |
| 497 | 3300037312 | Ga0395899_0121071 | Ga0395899_0121071_867_1613 | 205 |
| 498 | 3300037418 | Ga0395900_0026991 | Ga0395900_0026991_818_1561 | 205 |
| 499 | 3300037418 | Ga0395900_0214356 | Ga0395900_0214356_701_1447 | 205 |
| 500 | 3300037466 | Ga0395898_0158119 | Ga0395898_0158119_92_838 | 205 |
| 501 | 3300037471 | Ga0395905_0024811 | Ga0395905_0024811_682_1428 | 205 |
| 502 | 3300037471 | Ga0395905_0138645 | Ga0395905_0138645_451_1197 | 205 |
| 503 | 3300037471 | Ga0395905_0265970 | Ga0395905_0265970_490_1233 | 205 |
| 504 | 3300038443 | Ga0395901_0005708 | Ga0395901_0005708_4467_5210 | 205 |
| 505 | 3300038443 | Ga0395901_0240222 | Ga0395901_0240222_12_758 | 205 |
| 506 | 3300038443 | Ga0395901_0917669 | Ga0395901_0917669_19_765 | 205 |
| 507 | 3300044683 | Ga0466965_0024013 | Ga0466965_0024013_321_1064 | 205 |
| 508 | 3300044684 | Ga0466966_0032666 | Ga0466966_0032666_1532_2275 | 205 |
| 509 | 3300044842 | Ga0466957_0003950 | Ga0466957_0003950_2780_3523 | 205 |
| 510 | 3300044842 | Ga0466957_0114060 | Ga0466957_0114060_328_1071 | 205 |
| 511 | 3300048904 | Ga0496101_0393548 | Ga0496101_0393548_102_890 | 205 |
| 512 | 3300048907 | Ga0496104_0110188 | Ga0496104_0110188_707_1495 | 205 |
| 513 | 3300048908 | Ga0496105_0132893 | Ga0496105_0132893_41_829 | 205 |
| 514 | 3300048909 | Ga0496106_0283797 | Ga0496106_0283797_451_1239 | 205 |
| 515 | 3300048914 | Ga0496111_0233289 | Ga0496111_0233289_100_858 | 205 |
| 516 | 3300048916 | Ga0496113_0343649 | Ga0496113_0343649_224_982 | 205 |
| 517 | 3300048925 | Ga0496122_0028323 | Ga0496122_0028323_1121_1879 | 205 |
| 518 | 3300048926 | Ga0496123_0001793 | Ga0496123_0001793_20757_21515 | 205 |
| 519 | 3300048926 | Ga0496123_0219192 | Ga0496123_0219192_12_770 | 205 |
| 520 | 3300048927 | Ga0496124_0133677 | Ga0496124_0133677_1024_1782 | 205 |
| 521 | 3300003322 | rootL2_10008419 | rootL2_100084193 | 206 |
| 522 | 3300003759 | Ga0055525_1000025 | Ga0055525_100002564 | 206 |
| 523 | 3300005327 | Ga0070658_10286647 | Ga0070658_102866471 | 206 |
| 524 | 3300005366 | Ga0070659_100059218 | Ga0070659_1000592182 | 206 |
| 525 | 3300025230 | Ga0209563_100003 | Ga0209563_100003840 | 206 |
| 526 | 3300025254 | Ga0209148_1000590 | Ga0209148_100059021 | 206 |
| 527 | 3300025917 | Ga0207660_10082639 | Ga0207660_100826391 | 206 |
| 528 | 3300025919 | Ga0207657_10019370 | Ga0207657_100193706 | 206 |
| 529 | 3300025949 | Ga0207667_10024575 | Ga0207667_100245753 | 206 |
| 530 | 3300037312 | Ga0395899_0004477 | Ga0395899_0004477_4464_5210 | 206 |
| 531 | 3300037312 | Ga0395899_0015816 | Ga0395899_0015816_2832_3620 | 206 |
| 532 | 3300037418 | Ga0395900_0002902 | Ga0395900_0002902_5093_5839 | 206 |
| 533 | 3300037418 | Ga0395900_0251278 | Ga0395900_0251278_833_1621 | 206 |
| 534 | 3300037466 | Ga0395898_0044475 | Ga0395898_0044475_2492_3280 | 206 |
| 535 | 3300037471 | Ga0395905_0172813 | Ga0395905_0172813_1093_1881 | 206 |
| 536 | 3300037471 | Ga0395905_0502888 | Ga0395905_0502888_55_801 | 206 |
| 537 | 3300038443 | Ga0395901_0267278 | Ga0395901_0267278_568_1326 | 206 |
| 538 | 3300042005 | Ga0439448_0000868 | Ga0439448_0000868_5614_6402 | 206 |
| 539 | 3300044693 | Ga0466961_0128439 | Ga0466961_0128439_482_1267 | 206 |
| 540 | 3300044765 | Ga0466970_0270032 | Ga0466970_0270032_65_823 | 206 |
| 541 | 3300045049 | Ga0466959_0007083 | Ga0466959_0007083_6128_6886 | 206 |
| 542 | 3300046474 | Ga0495605_0000117 | Ga0495605_0000117_26495_27241 | 206 |
| 543 | 3300046474 | Ga0495605_0003312 | Ga0495605_0003312_8008_8766 | 206 |
| 544 | 3300046501 | Ga0495607_0001221 | Ga0495607_0001221_1073_1831 | 206 |
| 545 | 3300046501 | Ga0495607_0002442 | Ga0495607_0002442_12947_13693 | 206 |
| 546 | 3300046519 | Ga0495632_0187665 | Ga0495632_0187665_16_762 | 206 |
| 547 | 3300046522 | Ga0495643_0000263 | Ga0495643_0000263_59174_59920 | 206 |
| 548 | 3300046528 | Ga0495642_0000907 | Ga0495642_0000907_1858_2604 | 206 |
| 549 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_248882_249640 | 206 |
| 550 | 3300046615 | Ga0495656_0001980 | Ga0495656_0001980_4266_5024 | 206 |
| 551 | 3300046665 | Ga0495661_0000663 | Ga0495661_0000663_27762_28520 | 206 |
| 552 | 3300046665 | Ga0495661_0002221 | Ga0495661_0002221_12961_13707 | 206 |
| 553 | 3300046794 | Ga0495589_0000027 | Ga0495589_0000027_6153_6911 | 206 |
| 554 | 3300046794 | Ga0495589_0000974 | Ga0495589_0000974_300_1046 | 206 |
| 555 | 3300046810 | Ga0495660_0000054 | Ga0495660_0000054_16329_17075 | 206 |
| 556 | 3300047320 | Ga0495672_0001329 | Ga0495672_0001329_13653_14399 | 206 |
| 557 | 3300047443 | Ga0495687_000019 | Ga0495687_000019_248882_249640 | 206 |
| 558 | 3300047443 | Ga0495687_000287 | Ga0495687_000287_12519_13265 | 206 |
| 559 | 3300047445 | Ga0495677_0000020 | Ga0495677_0000020_78082_78840 | 206 |
| 560 | 3300047445 | Ga0495677_0000779 | Ga0495677_0000779_245_991 | 206 |
| 561 | 3300047472 | Ga0495686_0000054 | Ga0495686_0000054_214954_215748 | 206 |
| 562 | 3300048091 | Ga0495626_0000800 | Ga0495626_0000800_5537_6283 | 206 |
| 563 | 3300048091 | Ga0495626_0001889 | Ga0495626_0001889_10527_11285 | 206 |
| 564 | 3300048903 | Ga0496100_0199378 | Ga0496100_0199378_382_1128 | 206 |
| 565 | 3300048907 | Ga0496104_0618028 | Ga0496104_0618028_94_840 | 206 |
| 566 | 3300048912 | Ga0496109_0085811 | Ga0496109_0085811_1801_2547 | 206 |
| 567 | 3300048925 | Ga0496122_0002445 | Ga0496122_0002445_24015_24761 | 206 |
| 568 | 3300048926 | Ga0496123_0094998 | Ga0496123_0094998_605_1351 | 206 |
| 569 | 3300048927 | Ga0496124_0012480 | Ga0496124_0012480_2718_3476 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zgw-assembly1.cif.gz_A | short-chain dehydrogenase/reductase from serratia marcescens bcrc 10948 | 0.9671 | 3 | 206 |
| 5wul-assembly1.cif.gz_A | serratia marcescens short-chain dehydrogenase/reductase f98a/f202l | 0.9671 | 3 | 206 |
| 5wuw-assembly1.cif.gz_A-2 | serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant | 0.9647 | 3 | 206 |
| 5wva-assembly1.cif.gz_A-2 | serratia marcescens short-chain dehydrogenase/reductase f98y/f202y mutant | 0.9642 | 3 | 206 |
| 6j7h-assembly1.cif.gz_C | crystal structure of blue fluorescent protein from metagenomic library | 0.9622 | 3 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5z2lB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9513 | 3 | 204 | 3.40.50.720 |
| 3v2gA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.951 | 2 | 203 | 3.40.50.720 |
| af_I1LJY0_35_302_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9318 | 2 | 203 | 3.40.50.720 |
| 4npcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9297 | 2 | 203 | 3.40.50.720 |
| 5z2lB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9287 | 3 | 204 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C6YUC4-F1-model_v4 | SDR family oxidoreductase | 0.9942 | 49 | 206 |
GO:0016616
|
| AF-A0A0P9PQ17-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9935 | 44 | 206 |
GO:0016616
|
| AF-A0A4Y9RIH2-F1-model_v4 | SDR family oxidoreductase | 0.9923 | 82 | 206 |
GO:0016616
|
| AF-A0A532B9A9-F1-model_v4 | SDR family oxidoreductase | 0.9916 | 42 | 203 |
GO:0016616
|
| AF-C4WHM3-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9914 | 73 | 203 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar