F464634

General Info

Members Datasets Scaffolds Average Seq Length
568 313 557 79

Family's Representative Sequence

Representative Sequence 3300025291|Ga0209675_1000985|Ga0209675_100098514
Length 84
Sequence MKARVHVSLKNGVLDPQGKAIGHALHGLGFKDVADVRQGKLIELELTGALASKPKAEIEAAVKEMAQKLLANTVIENFSVELVG

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
4 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
5 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
6 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
7 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
8 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
9 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
10 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
11 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
237 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 1.76
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.85
Nodule 0
Rhizoplane 1.41
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01BQGDU 2088090003 Bacteria 503
2 JGI25406J46586_10044658 3300003203 Bacteria 1532
3 Ga0058863_11645915 3300004799 Bacteria 512
4 Ga0065704_10391639 3300005289 Bacteria 762
5 Ga0070658_10008327 3300005327 Bacteria 8339
6 Ga0070658_10034663 3300005327 Bacteria 4061
7 Ga0070676_10616048 3300005328 Bacteria 784
8 Ga0070676_11475455 3300005328 Unclassified 523
9 Ga0070683_100085043 3300005329 Bacteria 2964
10 Ga0070683_100730207 3300005329 Bacteria 949
11 Ga0070690_100673912 3300005330 Bacteria 792
12 Ga0070680_100015841 3300005336 Bacteria 5918
13 Ga0070680_100466763 3300005336 Bacteria 1079
14 Ga0070682_101432808 3300005337 Bacteria 592
15 Ga0068868_100099235 3300005338 Bacteria 2355
16 Ga0068868_102209838 3300005338 Bacteria 524
17 Ga0070660_100014637 3300005339 Bacteria 5659
18 Ga0070660_100291403 3300005339 Bacteria 1337
19 Ga0070691_10015649 3300005341 Bacteria 3484
20 Ga0070661_100060490 3300005344 Bacteria 2779
21 Ga0070668_101734544 3300005347 Bacteria 574
22 Ga0070669_101202777 3300005353 Bacteria 655
23 Ga0070675_101670677 3300005354 Bacteria 588
24 Ga0070674_100202871 3300005356 Bacteria 1532
25 Ga0070674_101516461 3300005356 Bacteria 603
26 Ga0070673_101892796 3300005364 Bacteria 566
27 Ga0070673_102229601 3300005364 Bacteria 520
28 Ga0070659_100028695 3300005366 Bacteria 4299
29 Ga0070709_10028618 3300005434 Bacteria 3325
30 Ga0070714_100004146 3300005435 Bacteria 10891
31 Ga0070713_100000939 3300005436 Bacteria 18616
32 Ga0070713_100086246 3300005436 Bacteria 2692
33 Ga0070713_100352912 3300005436 Bacteria 1365
34 Ga0070713_101082232 3300005436 Bacteria 775
35 Ga0070710_10053020 3300005437 Bacteria 2283
36 Ga0070701_10687886 3300005438 Bacteria 687
37 Ga0070711_100008941 3300005439 Bacteria 6150
38 Ga0070705_101254033 3300005440 Bacteria 613
39 Ga0070700_101821374 3300005441 Bacteria 525
40 Ga0070700_101892594 3300005441 Bacteria 515
41 Ga0070694_101537726 3300005444 Bacteria 564
42 Ga0070663_100048820 3300005455 Bacteria 3003
43 Ga0070663_100182298 3300005455 Bacteria 1630
44 Ga0070678_100044838 3300005456 Bacteria 3160
45 Ga0070662_100521666 3300005457 Bacteria 993
46 Ga0070662_100815435 3300005457 Bacteria 794
47 Ga0070681_10029061 3300005458 Bacteria 5550
48 Ga0070681_10667553 3300005458 Bacteria 955
49 Ga0070681_10813433 3300005458 Bacteria 852
50 Ga0070681_11101739 3300005458 Bacteria 715
51 Ga0070706_100347490 3300005467 Bacteria 1382
52 Ga0070706_101484978 3300005467 Bacteria 620
53 Ga0070699_100057798 3300005518 Bacteria 3359
54 Ga0070679_100002889 3300005530 Bacteria 15609
55 Ga0070679_101188516 3300005530 Bacteria 708
56 Ga0070684_100102560 3300005535 Bacteria 2558
57 Ga0070684_100585366 3300005535 Bacteria 1037
58 Ga0070684_100915793 3300005535 Bacteria 822
59 Ga0070697_100072310 3300005536 Bacteria 2830
60 Ga0068853_100002194 3300005539 Bacteria 14566
61 Ga0068853_100032562 3300005539 Bacteria 4416
62 Ga0068853_100989297 3300005539 Bacteria 809
63 Ga0070695_100122969 3300005545 Bacteria 1778
64 Ga0070696_101371951 3300005546 Bacteria 602
65 Ga0070693_101619699 3300005547 Bacteria 509
66 Ga0070665_100039027 3300005548 Bacteria 4775
67 Ga0070665_100044210 3300005548 Bacteria 4473
68 Ga0070665_100493404 3300005548 Bacteria 1236
69 Ga0070665_101267069 3300005548 Bacteria 747
70 Ga0068855_100094201 3300005563 Bacteria 3453
71 Ga0068855_100097061 3300005563 Bacteria 3394
72 Ga0068855_100129089 3300005563 Bacteria 2888
73 Ga0068855_100208652 3300005563 Bacteria 2196
74 Ga0068855_100214721 3300005563 Bacteria 2160
75 Ga0068855_100511763 3300005563 Bacteria 1303
76 Ga0070664_100022461 3300005564 Bacteria 5201
77 Ga0070664_100333366 3300005564 Bacteria 1377
78 Ga0068857_100041147 3300005577 Bacteria 4098
79 Ga0068857_100404447 3300005577 Bacteria 1271
80 Ga0068857_100831884 3300005577 Bacteria 883
81 Ga0068857_100946225 3300005577 Bacteria 827
82 Ga0068854_100003320 3300005578 Bacteria 10024
83 Ga0068854_100024710 3300005578 Bacteria 4117
84 Ga0068854_102288845 3300005578 Bacteria 501
85 Ga0068856_100025379 3300005614 Bacteria 5779
86 Ga0068856_100072854 3300005614 Bacteria 3401
87 Ga0068856_100199632 3300005614 Bacteria 2015
88 Ga0068856_100219317 3300005614 Bacteria 1917
89 Ga0068856_100234683 3300005614 Bacteria 1850
90 Ga0068856_100515395 3300005614 Bacteria 1217
91 Ga0068856_101100017 3300005614 Bacteria 812
92 Ga0068852_100003488 3300005616 Bacteria 10996
93 Ga0068852_100007647 3300005616 Bacteria 7903
94 Ga0068852_100013493 3300005616 Bacteria 6254
95 Ga0068859_100181338 3300005617 Bacteria 2188
96 Ga0068864_100258895 3300005618 Bacteria 1618
97 Ga0068864_100511379 3300005618 Bacteria 1157
98 Ga0068851_10001935 3300005834 Bacteria 9099
99 Ga0068870_10678248 3300005840 Bacteria 709
100 Ga0068863_100292262 3300005841 Bacteria 1580
101 Ga0068863_101064418 3300005841 Bacteria 813
102 Ga0068858_102327032 3300005842 Bacteria 530
103 Ga0068860_101507793 3300005843 Bacteria 694
104 Ga0081455_10000434 3300005937 Bacteria 54939
105 Ga0081455_10002143 3300005937 Bacteria 23543
106 Ga0081538_10031628 3300005981 Bacteria 3564
107 Ga0081539_10009772 3300005985 Bacteria 7934
108 Ga0081539_10011462 3300005985 Bacteria 7001
109 Ga0081539_10019052 3300005985 Bacteria 4721
110 Ga0075365_10029237 3300006038 Bacteria 3520
111 Ga0075365_10326099 3300006038 Bacteria 1081
112 Ga0075365_10346649 3300006038 Bacteria 1047
113 Ga0075365_10916917 3300006038 Bacteria 618
114 Ga0075365_11126589 3300006038 Bacteria 552
115 Ga0075368_10126789 3300006042 Bacteria 1059
116 Ga0075363_100033775 3300006048 Bacteria 2667
117 Ga0075363_100056901 3300006048 Bacteria 2097
118 Ga0075364_10024791 3300006051 Bacteria 3812
119 Ga0075364_10256115 3300006051 Bacteria 1189
120 Ga0075364_10296770 3300006051 Bacteria 1100
121 Ga0075364_10332005 3300006051 Bacteria 1036
122 Ga0075364_11077529 3300006051 Bacteria 546
123 Ga0075432_10374250 3300006058 Bacteria 609
124 Ga0070715_10579026 3300006163 Bacteria 655
125 Ga0070716_100063676 3300006173 Bacteria 2142
126 Ga0070712_100000779 3300006175 Bacteria 18831
127 Ga0070712_100812336 3300006175 Bacteria 803
128 Ga0075362_10007197 3300006177 Bacteria 4199
129 Ga0075362_10029282 3300006177 Bacteria 2372
130 Ga0075362_10052564 3300006177 Bacteria 1826
131 Ga0075362_10127471 3300006177 Bacteria 1208
132 Ga0075362_10190704 3300006177 Bacteria 995
133 Ga0075362_10297494 3300006177 Bacteria 800
134 Ga0075367_10019329 3300006178 Bacteria 3777
135 Ga0075367_10206897 3300006178 Bacteria 1227
136 Ga0075369_10000336 3300006186 Bacteria 14025
137 Ga0075369_10058572 3300006186 Bacteria 1677
138 Ga0075369_10236628 3300006186 Bacteria 847
139 Ga0075369_10446792 3300006186 Bacteria 612
140 Ga0075366_10013866 3300006195 Bacteria 4594
141 Ga0075366_10091553 3300006195 Bacteria 1821
142 Ga0075366_10188225 3300006195 Bacteria 1254
143 Ga0097621_100164766 3300006237 Bacteria 1908
144 Ga0075370_10934287 3300006353 Bacteria 531
145 Ga0097620_100181331 3300006931 Bacteria 2188
146 Ga0099794_10351138 3300007265 Bacteria 767
147 Ga0099795_10417585 3300007788 Bacteria 612
148 Ga0105240_10158518 3300009093 Bacteria 2690
149 Ga0105240_10346169 3300009093 Bacteria 1687
150 Ga0105240_10391683 3300009093 Bacteria 1567
151 Ga0111539_10544564 3300009094 Bacteria 1352
152 Ga0105245_10483539 3300009098 Bacteria 1252
153 Ga0105245_11381971 3300009098 Bacteria 754
154 Ga0105245_11657140 3300009098 Bacteria 692
155 Ga0105245_13111524 3300009098 Bacteria 514
156 Ga0105247_11036065 3300009101 Bacteria 643
157 Ga0114129_11331828 3300009147 Bacteria 889
158 Ga0114129_12334845 3300009147 Bacteria 641
159 Ga0114129_12531245 3300009147 Bacteria 613
160 Ga0105243_10549941 3300009148 Bacteria 1103
161 Ga0105243_11226887 3300009148 Bacteria 764
162 Ga0105243_11602529 3300009148 Bacteria 678
163 Ga0105241_10037479 3300009174 Bacteria 3653
164 Ga0105241_10071407 3300009174 Bacteria 2695
165 Ga0105242_10742254 3300009176 Bacteria 965
166 Ga0105242_12236310 3300009176 Bacteria 592
167 Ga0105248_12291157 3300009177 Bacteria 615
168 Ga0105237_10041468 3300009545 Bacteria 4642
169 Ga0105237_11585720 3300009545 Bacteria 661
170 Ga0105237_12602580 3300009545 Bacteria 517
171 Ga0105238_10035940 3300009551 Bacteria 5036
172 Ga0105238_10172179 3300009551 Bacteria 2141
173 Ga0105238_10676007 3300009551 Bacteria 1044
174 Ga0105238_11190233 3300009551 Bacteria 786
175 Ga0105035_128506 3300009988 Bacteria 542
176 Ga0099796_10184441 3300010159 Bacteria 839
177 Ga0099796_10248679 3300010159 Bacteria 738
178 Ga0105239_10025681 3300010375 Bacteria 6487
179 Ga0105239_10695661 3300010375 Bacteria 1162
180 Ga0105246_11833480 3300011119 Bacteria 580
181 Ga0157314_1042027 3300012500 Bacteria 556
182 Ga0157373_10137675 3300013100 Bacteria 1717
183 Ga0157371_10009845 3300013102 Bacteria 7489
184 Ga0157370_10009458 3300013104 Bacteria 10410
185 Ga0157370_10022575 3300013104 Bacteria 6262
186 Ga0157370_10076887 3300013104 Bacteria 3144
187 Ga0157370_10589434 3300013104 Bacteria 1018
188 Ga0157370_11831837 3300013104 Bacteria 544
189 Ga0157378_10231632 3300013297 Bacteria 1760
190 Ga0157378_11260453 3300013297 Bacteria 780
191 Ga0157378_11359364 3300013297 Bacteria 752
192 Ga0163162_10783964 3300013306 Bacteria 1071
193 Ga0163162_11594950 3300013306 Bacteria 744
194 Ga0157372_10842844 3300013307 Bacteria 1064
195 Ga0157372_11828603 3300013307 Bacteria 698
196 Ga0157372_11891280 3300013307 Bacteria 686
197 Ga0157375_11275147 3300013308 Bacteria 863
198 Ga0157375_13761565 3300013308 Bacteria 504
199 Ga0163163_10134983 3300014325 Bacteria 2508
200 Ga0163163_11812798 3300014325 Bacteria 670
201 Ga0163163_12278755 3300014325 Bacteria 600
202 Ga0157380_11269710 3300014326 Bacteria 783
203 Ga0157380_12726352 3300014326 Bacteria 561
204 Ga0182008_10019469 3300014497 Bacteria 3502
205 Ga0182008_10075655 3300014497 Bacteria 1656
206 Ga0157379_10960899 3300014968 Bacteria 813
207 Ga0157379_11175648 3300014968 Bacteria 737
208 Ga0157376_11228135 3300014969 Unclassified 778
209 Ga0157376_11417293 3300014969 Bacteria 727
210 Ga0206356_11886213 3300020070 Bacteria 559
211 Ga0206355_1135818 3300020076 Bacteria 567
212 Ga0213873_10004937 3300021358 Bacteria 2522
213 Ga0213872_10272679 3300021361 Bacteria 708
214 Ga0213872_10417208 3300021361 Bacteria 542
215 Ga0213875_10028110 3300021388 Bacteria 2674
216 Ga0213875_10152381 3300021388 Bacteria 1083
217 Ga0213871_10006183 3300021441 Bacteria 2520
218 Ga0213871_10018139 3300021441 Bacteria 1718
219 Ga0209675_1000985 3300025291 Bacteria 18017
220 Ga0209676_1087330 3300025292 Bacteria 694
221 Ga0207656_10000887 3300025321 Bacteria 9763
222 Ga0207647_10568001 3300025904 Bacteria 628
223 Ga0207685_10405396 3300025905 Bacteria 700
224 Ga0207685_10645224 3300025905 Bacteria 572
225 Ga0207699_10013245 3300025906 Bacteria 4216
226 Ga0207645_10771443 3300025907 Bacteria 654
227 Ga0207643_10429658 3300025908 Bacteria 838
228 Ga0207705_10041156 3300025909 Bacteria 3314
229 Ga0207705_10053858 3300025909 Bacteria 2899
230 Ga0207684_10333564 3300025910 Bacteria 1306
231 Ga0207684_10632928 3300025910 Bacteria 912
232 Ga0207654_10188307 3300025911 Bacteria 1351
233 Ga0207654_10221032 3300025911 Bacteria 1256
234 Ga0207654_10288492 3300025911 Bacteria 1112
235 Ga0207707_10013882 3300025912 Bacteria 7024
236 Ga0207707_10520344 3300025912 Bacteria 1013
237 Ga0207707_10661188 3300025912 Bacteria 880
238 Ga0207707_10866874 3300025912 Bacteria 748
239 Ga0207695_10067173 3300025913 Bacteria 3679
240 Ga0207695_10119337 3300025913 Bacteria 2607
241 Ga0207695_10249637 3300025913 Bacteria 1674
242 Ga0207671_11182681 3300025914 Bacteria 599
243 Ga0207693_10011626 3300025915 Bacteria 7122
244 Ga0207693_10375123 3300025915 Bacteria 1113
245 Ga0207663_11464526 3300025916 Bacteria 550
246 Ga0207660_10461161 3300025917 Bacteria 1028
247 Ga0207657_10026748 3300025919 Bacteria 5295
248 Ga0207657_10252473 3300025919 Bacteria 1405
249 Ga0207657_11406431 3300025919 Bacteria 524
250 Ga0207649_10025971 3300025920 Bacteria 3421
251 Ga0207649_10037683 3300025920 Bacteria 2922
252 Ga0207652_10027622 3300025921 Bacteria 4729
253 Ga0207681_10070672 3300025923 Bacteria 2432
254 Ga0207694_10019272 3300025924 Bacteria 5158
255 Ga0207694_10242155 3300025924 Bacteria 1474
256 Ga0207694_10346764 3300025924 Bacteria 1229
257 Ga0207694_11259872 3300025924 Bacteria 625
258 Ga0207687_11074604 3300025927 Bacteria 691
259 Ga0207687_11588566 3300025927 Bacteria 561
260 Ga0207700_10003857 3300025928 Bacteria 8757
261 Ga0207664_10008762 3300025929 Bacteria 7075
262 Ga0207664_10808971 3300025929 Bacteria 843
263 Ga0207690_10208686 3300025932 Bacteria 1488
264 Ga0207690_10299649 3300025932 Bacteria 1257
265 Ga0207706_10110350 3300025933 Bacteria 2420
266 Ga0207706_10434146 3300025933 Bacteria 1137
267 Ga0207709_10307807 3300025935 Bacteria 1181
268 Ga0207669_11150379 3300025937 Bacteria 656
269 Ga0207669_11407244 3300025937 Bacteria 594
270 Ga0207665_10073547 3300025939 Bacteria 2337
271 Ga0207665_10418843 3300025939 Bacteria 1023
272 Ga0207665_10509987 3300025939 Bacteria 930
273 Ga0207691_10161690 3300025940 Bacteria 1964
274 Ga0207711_11854714 3300025941 Bacteria 546
275 Ga0207689_10535312 3300025942 Bacteria 983
276 Ga0207661_10529855 3300025944 Bacteria 1078
277 Ga0207661_11188547 3300025944 Bacteria 702
278 Ga0207679_10229242 3300025945 Bacteria 1567
279 Ga0207679_11798340 3300025945 Bacteria 560
280 Ga0207667_10002364 3300025949 Bacteria 23627
281 Ga0207667_10057735 3300025949 Bacteria 4073
282 Ga0207667_10070173 3300025949 Bacteria 3647
283 Ga0207667_10274714 3300025949 Bacteria 1723
284 Ga0207667_11688995 3300025949 Bacteria 600
285 Ga0207712_11032831 3300025961 Bacteria 730
286 Ga0207640_10003952 3300025981 Bacteria 8000
287 Ga0207640_10118464 3300025981 Bacteria 1892
288 Ga0207640_10236048 3300025981 Bacteria 1410
289 Ga0207677_10129927 3300026023 Bacteria 1911
290 Ga0207703_11851107 3300026035 Bacteria 580
291 Ga0207639_10010460 3300026041 Bacteria 6428
292 Ga0207639_10125442 3300026041 Bacteria 2116
293 Ga0207639_10673112 3300026041 Bacteria 958
294 Ga0207639_10788323 3300026041 Bacteria 885
295 Ga0207639_11786630 3300026041 Bacteria 575
296 Ga0207678_10152286 3300026067 Bacteria 1975
297 Ga0207678_11448653 3300026067 Bacteria 607
298 Ga0207708_11118276 3300026075 Bacteria 687
299 Ga0207702_10017610 3300026078 Bacteria 5911
300 Ga0207702_10156439 3300026078 Bacteria 2078
301 Ga0207702_10166638 3300026078 Bacteria 2016
302 Ga0207702_10179401 3300026078 Bacteria 1949
303 Ga0207702_10264461 3300026078 Bacteria 1621
304 Ga0207702_10494373 3300026078 Bacteria 1192
305 Ga0207702_12454450 3300026078 Bacteria 508
306 Ga0207648_10569288 3300026089 Bacteria 1042
307 Ga0207648_11637745 3300026089 Bacteria 605
308 Ga0207676_12438304 3300026095 Bacteria 520
309 Ga0207674_10017245 3300026116 Bacteria 7877
310 Ga0207674_10032698 3300026116 Bacteria 5453
311 Ga0207674_10192431 3300026116 Bacteria 1990
312 Ga0207674_10330282 3300026116 Bacteria 1475
313 Ga0207675_100537358 3300026118 Bacteria 1167
314 Ga0207683_10069539 3300026121 Bacteria 3109
315 Ga0207683_10630963 3300026121 Bacteria 992
316 Ga0207698_10002528 3300026142 Bacteria 10858
317 Ga0207698_10574496 3300026142 Bacteria 1108
318 Ga0209813_10158147 3300027866 Bacteria 816
319 Ga0268266_10186323 3300028379 Bacteria 1892
320 Ga0268266_10346541 3300028379 Bacteria 1395
321 Ga0268266_10590099 3300028379 Bacteria 1067
322 Ga0268266_11693129 3300028379 Bacteria 608
323 Ga0268265_10887224 3300028380 Bacteria 875
324 Ga0265334_10041312 3300028573 Bacteria 1803
325 Ga0307517_10445086 3300028786 Bacteria 673
326 Ga0265338_10114946 3300028800 Bacteria 2158
327 Ga0265324_10053599 3300029957 Bacteria 1385
328 Ga0307511_10213818 3300030521 Bacteria 980
329 Ga0265330_10024058 3300031235 Bacteria 2763
330 Ga0265325_10056673 3300031241 Bacteria 2000
331 Ga0265329_10102590 3300031242 Bacteria 911
332 Ga0265329_10230058 3300031242 Bacteria 615
333 Ga0265340_10137109 3300031247 Bacteria 1120
334 Ga0265339_10000397 3300031249 Bacteria 34367
335 Ga0265316_10086402 3300031344 Bacteria 2398
336 Ga0265313_10000032 3300031595 Bacteria 128964
337 Ga0307405_10064977 3300031731 Bacteria 2321
338 Ga0307406_10193302 3300031901 Bacteria 1492
339 Ga0307406_10786535 3300031901 Bacteria 802
340 Ga0307412_10881190 3300031911 Bacteria 783
341 Ga0307409_100078824 3300031995 Bacteria 2652
342 Ga0307409_102370051 3300031995 Bacteria 560
343 Ga0307416_100635065 3300032002 Bacteria 1151
344 Ga0307414_10588054 3300032004 Bacteria 997
345 Ga0307414_10637001 3300032004 Bacteria 960
346 Ga0307411_11778026 3300032005 Bacteria 572
347 Ga0307415_100391663 3300032126 Bacteria 1183
348 Ga0373930_0020161 3300034816 Bacteria 1298
349 Ga0373928_0049987 3300035084 Bacteria 985
350 Ga0373928_0263474 3300035084 Bacteria 517
351 Ga0373929_0179325 3300035085 Bacteria 583
352 Ga0373934_0028064 3300035086 Bacteria 2191
353 Ga0373940_0065355 3300035088 Bacteria 1049
354 Ga0373923_0119568 3300035111 Bacteria 1176
355 Ga0373923_0254675 3300035111 Bacteria 822
356 Ga0373932_0229769 3300035112 Bacteria 670
357 Ga0373936_0131550 3300035113 Bacteria 1076
358 Ga0373939_0127742 3300035114 Bacteria 904
359 Ga0373941_0155144 3300035115 Bacteria 843
360 Ga0373941_0166525 3300035115 Bacteria 819
361 Ga0373945_0193558 3300035116 Bacteria 842
362 Ga0373953_0118550 3300035117 Bacteria 1123
363 Ga0373943_0124147 3300035170 Bacteria 1375
364 Ga0373943_0323040 3300035170 Bacteria 880
365 Ga0373943_0326197 3300035170 Bacteria 876
366 Ga0373946_0111286 3300035171 Bacteria 1240
367 Ga0373955_0009610 3300035172 Bacteria 4539
368 Ga0373955_0108703 3300035172 Bacteria 1601
369 Ga0373955_0164251 3300035172 Bacteria 1312
370 Ga0373955_0740259 3300035172 Bacteria 604
371 Ga0373924_0062969 3300035410 Bacteria 1554
372 Ga0373931_1088462 3300035691 Bacteria 544
373 Ga0373935_0059605 3300035692 Bacteria 2440
374 Ga0373935_0373484 3300035692 Bacteria 1020
375 Ga0373935_0508271 3300035692 Bacteria 875
376 Ga0373935_0656545 3300035692 Bacteria 769
377 Ga0373927_0098382 3300035695 Bacteria 1902
378 Ga0373927_0360830 3300035695 Bacteria 958
379 Ga0373927_0622732 3300035695 Bacteria 713
380 Ga0373927_0947623 3300035695 Bacteria 568
381 Ga0373933_0001236 3300035724 Bacteria 15103
382 Ga0373947_0024924 3300035725 Bacteria 3488
383 Ga0373947_0064341 3300035725 Bacteria 2236
384 Ga0373947_0335811 3300035725 Bacteria 1012
385 Ga0373947_0446030 3300035725 Bacteria 876
386 Ga0373937_0005149 3300036401 Bacteria 11147
387 Ga0373937_0010008 3300036401 Bacteria 8269
388 Ga0373937_0257543 3300036401 Bacteria 1645
389 Ga0373925_0023574 3300037068 Bacteria 4491
390 Ga0373925_0044845 3300037068 Bacteria 3283
391 Ga0373925_0236845 3300037068 Bacteria 1461
392 Ga0373925_0768771 3300037068 Bacteria 794
393 Ga0395899_0027167 3300037312 Bacteria 4317
394 Ga0395899_0178224 3300037312 Bacteria 1493
395 Ga0395899_0314503 3300037312 Bacteria 1056
396 Ga0395899_0691402 3300037312 Bacteria 640
397 Ga0395900_0035147 3300037418 Bacteria 5162
398 Ga0395900_0102804 3300037418 Bacteria 2935
399 Ga0395900_0468506 3300037418 Bacteria 1213
400 Ga0395898_0016415 3300037466 Bacteria 7578
401 Ga0395898_0717477 3300037466 Bacteria 941
402 Ga0395905_1070902 3300037471 Bacteria 709
403 Ga0436364_0191957 3300037853 Bacteria 809
404 Ga0436364_0821358 3300037853 Bacteria 4845
405 Ga0436364_1239827 3300037853 Bacteria 5018
406 Ga0395901_0001851 3300038443 Bacteria 21879
407 Ga0395901_0034540 3300038443 Bacteria 5222
408 Ga0395901_0055930 3300038443 Bacteria 4104
409 Ga0395901_0713111 3300038443 Bacteria 999
410 Ga0436365_0151417 3300039437 Bacteria 1671
411 Ga0436365_0414779 3300039437 Bacteria 621
412 Ga0436365_1686548 3300039437 Bacteria 510
413 Ga0436365_1694241 3300039437 Bacteria 625
414 Ga0436360_0405006 3300039438 Bacteria 1319
415 Ga0436360_0848685 3300039438 Bacteria 716
416 Ga0436360_1256092 3300039438 Bacteria 1751
417 Ga0436360_1286833 3300039438 Bacteria 2543
418 Ga0436361_0305263 3300039447 Bacteria 1764
419 Ga0436361_0767627 3300039447 Bacteria 2848
420 Ga0436361_1163612 3300039447 Bacteria 1508
421 Ga0436363_0563692 3300039450 Bacteria 1235
422 Ga0436363_0811460 3300039450 Bacteria 539
423 Ga0436363_0926035 3300039450 Bacteria 2661
424 Ga0436362_0338910 3300039453 Bacteria 561
425 Ga0436362_0509888 3300039453 Bacteria 4499
426 Ga0451787_280404 3300041441 Unclassified 844
427 Ga0451791_1235116 3300041451 Bacteria 563
428 Ga0451798_0946080 3300041458 Bacteria 522
429 Ga0451800_0272757 3300041459 Bacteria 592
430 Ga0451802_1078191 3300041460 Bacteria 621
431 Ga0451839_0008132 3300041496 Bacteria 521
432 Ga0451853_3561479 3300041512 Bacteria 563
433 Ga0439448_0093978 3300042005 Bacteria 1015
434 Ga0439459_0035812 3300042438 Bacteria 1033
435 Ga0439460_0091211 3300042461 Bacteria 969
436 Ga0451577_1421430 3300042876 Bacteria 615
437 Ga0453684_1471607 3300044712 Bacteria 704
438 Ga0451576_0718372 3300045051 Bacteria 1050
439 Ga0495592_0778519 3300046454 Bacteria 570
440 Ga0495629_0754616 3300046459 Bacteria 644
441 Ga0495651_0004432 3300046462 Bacteria 10760
442 Ga0495653_0084595 3300046463 Bacteria 2336
443 Ga0495639_0370691 3300046475 Bacteria 721
444 Ga0495662_0500569 3300046476 Bacteria 596
445 Ga0495583_0272368 3300046506 Bacteria 676
446 Ga0495608_0070537 3300046511 Bacteria 2280
447 Ga0495628_0539461 3300046516 Bacteria 839
448 Ga0495630_0321925 3300046517 Bacteria 1182
449 Ga0495640_0857988 3300046533 Bacteria 539
450 Ga0495587_0014044 3300046536 Bacteria 5029
451 Ga0495587_0297350 3300046536 Bacteria 903
452 Ga0495645_0155119 3300046543 Bacteria 1587
453 Ga0495645_0562672 3300046543 Bacteria 705
454 Ga0495667_0081426 3300046559 Bacteria 2104
455 Ga0495667_0247465 3300046559 Bacteria 1135
456 Ga0495667_0310071 3300046559 Bacteria 999
457 Ga0495668_0201172 3300046616 Bacteria 1091
458 Ga0495635_0109208 3300046663 Bacteria 1890
459 Ga0495635_0111009 3300046663 Bacteria 1873
460 Ga0495635_0632346 3300046663 Bacteria 697
461 Ga0495657_0134658 3300046675 Bacteria 1545
462 Ga0495657_0152607 3300046675 Bacteria 1433
463 Ga0495599_0164936 3300046678 Bacteria 1368
464 Ga0495599_0521311 3300046678 Bacteria 698
465 Ga0495623_0024082 3300046679 Bacteria 3927
466 Ga0495646_0283135 3300046680 Bacteria 880
467 Ga0495646_0444740 3300046680 Bacteria 670
468 Ga0495646_0672880 3300046680 Bacteria 522
469 Ga0495647_0586663 3300046681 Bacteria 523
470 Ga0495671_0467038 3300046692 Bacteria 603
471 Ga0495600_0022905 3300046809 Bacteria 4015
472 Ga0495600_0226191 3300046809 Bacteria 1196
473 Ga0495674_1176241 3300047319 Bacteria 581
474 Ga0495680_0040284 3300047322 Bacteria 3723
475 Ga0495675_0157551 3300047444 Bacteria 1399
476 Ga0495675_0228621 3300047444 Bacteria 1123
477 Ga0495684_0048400 3300047471 Bacteria 3251
478 Ga0495684_0214123 3300047471 Bacteria 1415
479 Ga0495602_0023216 3300048088 Bacteria 6050
480 Ga0496102_0958949 3300048905 Bacteria 776
481 Ga0496112_1461879 3300048915 Bacteria 598
482 Ga0496113_1086356 3300048916 Bacteria 628
483 Ga0496119_0003988 3300048922 Bacteria 14944
484 Ga0496120_0080651 3300048923 Bacteria 1763
485 Ga0496122_0067264 3300048925 Bacteria 2582
486 Ga0501318_003228 3300049534 Bacteria 1481
487 Ga0501032_0169566 3300049569 Bacteria 1432
488 Ga0501033_0541758 3300049570 Bacteria 802
489 Ga0501034_0017532 3300049571 Bacteria 7345
490 Ga0501034_0037546 3300049571 Bacteria 4905
491 Ga0501036_1708392 3300049572 Bacteria 507
492 Ga0501039_1544209 3300049575 Bacteria 510
493 Ga0501068_0140025 3300049584 Bacteria 1516
494 Ga0501070_0685556 3300049586 Bacteria 811
495 Ga0501070_0795355 3300049586 Bacteria 743
496 Ga0501074_1044795 3300049590 Bacteria 574
497 Ga0501074_1332310 3300049590 Bacteria 503
498 Ga0501077_0270191 3300049593 Bacteria 1082
499 Ga0501035_0744268 3300049822 Bacteria 787
500 Ga0501044_0117070 3300049823 Bacteria 2669
501 Ga0501044_1413941 3300049823 Bacteria 561
502 nmdc:mga03683_121593_c1 3300050489 Bacteria 1161
503 nmdc:mga03683_130026_c1 3300050489 Bacteria 1126
504 nmdc:mga03683_17888_c1 3300050489 Bacteria 2688
505 nmdc:mga03683_216721_c1 3300050489 Bacteria 882
506 nmdc:mga03683_27877_c1 3300050489 Bacteria 2241
507 nmdc:mga03683_47272_c1 3300050489 Bacteria 1785
508 nmdc:mga03n38_192938_c1 3300050490 Bacteria 1050
509 nmdc:mga03n38_42434_c1 3300050490 Bacteria 1988
510 nmdc:mga03n38_82602_c1 3300050490 Bacteria 1513
511 nmdc:mga03n38_964652_c1 3300050490 Bacteria 504
512 nmdc:mga00v17_464594_c1 3300050491 Bacteria 821
513 nmdc:mga00v17_961827_c1 3300050491 Bacteria 539
514 nmdc:mga00v17_98512_c1 3300050491 Bacteria 1843
515 nmdc:mga0yw44_11213_c1 3300050492 Bacteria 4614
516 nmdc:mga0yw44_65149_c1 3300050492 Bacteria 2245
517 nmdc:mga0yw44_744456_c1 3300050492 Bacteria 666
518 nmdc:mga0yw44_893222_c1 3300050492 Bacteria 603
519 nmdc:mga0yw44_914654_c1 3300050492 Bacteria 595
520 nmdc:mga0yw44_99739_c1 3300050492 Bacteria 1848
521 nmdc:mga0k408_27336_c1 3300050493 Bacteria 3240
522 nmdc:mga0k408_325016_c1 3300050493 Bacteria 918
523 nmdc:mga0k408_330591_c2 3300050493 Bacteria 616
524 nmdc:mga0k408_42473_c2 3300050493 Bacteria 2002
525 nmdc:mga0k408_799567_c1 3300050493 Bacteria 550
526 nmdc:mga06z11_199706_c1 3300050494 Bacteria 1161
527 nmdc:mga06z11_272407_c1 3300050494 Bacteria 1001
528 nmdc:mga06z11_548628_c1 3300050494 Bacteria 702
529 nmdc:mga06z11_69100_c1 3300050494 Bacteria 1864
530 nmdc:mga04h51_256017_c1 3300050495 Bacteria 703
531 nmdc:mga07m45_216693_c1 3300050496 Bacteria 1113
532 nmdc:mga07m45_319831_c1 3300050496 Bacteria 902
533 nmdc:mga07m45_48677_c1 3300050496 Bacteria 2384
534 nmdc:mga05p37_646173_c1 3300050507 Bacteria 1185
535 nmdc:mga08y16_778081_c1 3300050511 Bacteria 951
536 nmdc:mga08y16_908355_c1 3300050511 Bacteria 866
537 nmdc:mga0n895_1956682_c1 3300050512 Bacteria 544
538 nmdc:mga0sz30_137258_c1 3300050516 Bacteria 1079
539 nmdc:mga0sz30_41305_c1 3300050516 Bacteria 1939
540 nmdc:mga0sz30_41844_c1 3300050516 Bacteria 1525
541 nmdc:mga0sz30_4363_c1 3300050516 Bacteria 5108
542 Ga0495601_0111128 3300053077 Bacteria 1775
543 Ga0495601_0763057 3300053077 Bacteria 615
544 Ga0495595_0017581 3300053084 Bacteria 3078
545 Ga0495619_0073814 3300053085 Bacteria 2286
546 Ga0495619_0311177 3300053085 Bacteria 1091
547 Ga0500647_0029848 3300053091 Bacteria 2588
548 Ga0500651_0758677 3300053093 Bacteria 515
549 Ga0500641_0001470 3300053096 Bacteria 8395
550 Ga0500642_0423081 3300053130 Bacteria 577
551 Ga0500616_0003394 3300053153 Bacteria 12221
552 Ga0587073_0058770 3300059492 Bacteria 895
553 Ga0587085_063198 3300059506 Bacteria 706
554 Ga0587091_124129 3300059511 Bacteria 630
555 Ga0587117_069296 3300059627 Bacteria 622
556 Ga0587078_025748 3300059646 Bacteria 769
557 Ga0587079_080307 3300059647 Bacteria 745

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_0272757 Ga0451800_0272757_174_413 70
2 3300005329 Ga0070683_100085043 Ga0070683_1000850432 73
3 3300005336 Ga0070680_100466763 Ga0070680_1004667632 73
4 3300005344 Ga0070661_100060490 Ga0070661_1000604903 73
5 3300005444 Ga0070694_101537726 Ga0070694_1015377262 73
6 3300005535 Ga0070684_100915793 Ga0070684_1009157932 73
7 3300005539 Ga0068853_100989297 Ga0068853_1009892972 73
8 3300005564 Ga0070664_100022461 Ga0070664_1000224616 73
9 3300005614 Ga0068856_100025379 Ga0068856_1000253795 73
10 3300005618 Ga0068864_100258895 Ga0068864_1002588953 73
11 3300013308 Ga0157375_11275147 Ga0157375_112751472 73
12 3300014497 Ga0182008_10075655 Ga0182008_100756553 73
13 3300025920 Ga0207649_10037683 Ga0207649_100376834 73
14 3300025924 Ga0207694_10242155 Ga0207694_102421552 73
15 3300025932 Ga0207690_10208686 Ga0207690_102086861 73
16 3300025933 Ga0207706_10434146 Ga0207706_104341462 73
17 3300025941 Ga0207711_11854714 Ga0207711_118547142 73
18 3300025945 Ga0207679_10229242 Ga0207679_102292423 73
19 3300025949 Ga0207667_10274714 Ga0207667_102747142 73
20 3300025981 Ga0207640_10236048 Ga0207640_102360482 73
21 3300026041 Ga0207639_10788323 Ga0207639_107883232 73
22 3300026078 Ga0207702_10179401 Ga0207702_101794012 73
23 3300035084 Ga0373928_0049987 Ga0373928_0049987_522_743 73
24 3300035111 Ga0373923_0254675 Ga0373923_0254675_501_722 73
25 3300035170 Ga0373943_0124147 Ga0373943_0124147_1022_1243 73
26 3300035171 Ga0373946_0111286 Ga0373946_0111286_14_235 73
27 3300035172 Ga0373955_0009610 Ga0373955_0009610_1337_1558 73
28 3300035692 Ga0373935_0059605 Ga0373935_0059605_1018_1239 73
29 3300035725 Ga0373947_0024924 Ga0373947_0024924_2994_3215 73
30 3300035725 Ga0373947_0064341 Ga0373947_0064341_1881_2102 73
31 3300036401 Ga0373937_0010008 Ga0373937_0010008_5720_5941 73
32 3300037068 Ga0373925_0044845 Ga0373925_0044845_1704_1925 73
33 3300037312 Ga0395899_0314503 Ga0395899_0314503_453_674 73
34 3300037418 Ga0395900_0035147 Ga0395900_0035147_2803_3024 73
35 3300037853 Ga0436364_0191957 Ga0436364_0191957_122_346 73
36 3300038443 Ga0395901_0055930 Ga0395901_0055930_1593_1814 73
37 3300039437 Ga0436365_0151417 Ga0436365_0151417_293_517 73
38 3300039438 Ga0436360_1256092 Ga0436360_1256092_1507_1740 73
39 3300039450 Ga0436363_0563692 Ga0436363_0563692_983_1204 73
40 3300039450 Ga0436363_0811460 Ga0436363_0811460_239_463 73
41 3300039450 Ga0436363_0926035 Ga0436363_0926035_1454_1678 73
42 3300039453 Ga0436362_0509888 Ga0436362_0509888_3837_4061 73
43 3300042005 Ga0439448_0093978 Ga0439448_0093978_622_843 73
44 3300042876 Ga0451577_1421430 Ga0451577_1421430_167_388 73
45 3300044712 Ga0453684_1471607 Ga0453684_1471607_335_556 73
46 3300045051 Ga0451576_0718372 Ga0451576_0718372_53_274 73
47 3300046454 Ga0495592_0778519 Ga0495592_0778519_113_334 73
48 3300046459 Ga0495629_0754616 Ga0495629_0754616_265_486 73
49 3300046462 Ga0495651_0004432 Ga0495651_0004432_5038_5259 73
50 3300046463 Ga0495653_0084595 Ga0495653_0084595_2081_2302 73
51 3300046476 Ga0495662_0500569 Ga0495662_0500569_77_298 73
52 3300046517 Ga0495630_0321925 Ga0495630_0321925_100_321 73
53 3300046533 Ga0495640_0857988 Ga0495640_0857988_98_319 73
54 3300046536 Ga0495587_0297350 Ga0495587_0297350_605_826 73
55 3300046543 Ga0495645_0155119 Ga0495645_0155119_1270_1491 73
56 3300046559 Ga0495667_0247465 Ga0495667_0247465_52_273 73
57 3300046663 Ga0495635_0109208 Ga0495635_0109208_141_362 73
58 3300046663 Ga0495635_0632346 Ga0495635_0632346_75_296 73
59 3300046675 Ga0495657_0134658 Ga0495657_0134658_1123_1344 73
60 3300046678 Ga0495599_0521311 Ga0495599_0521311_57_278 73
61 3300046680 Ga0495646_0444740 Ga0495646_0444740_409_630 73
62 3300046680 Ga0495646_0672880 Ga0495646_0672880_97_318 73
63 3300046809 Ga0495600_0226191 Ga0495600_0226191_610_831 73
64 3300047444 Ga0495675_0228621 Ga0495675_0228621_92_313 73
65 3300047471 Ga0495684_0048400 Ga0495684_0048400_2598_2819 73
66 3300047471 Ga0495684_0214123 Ga0495684_0214123_1094_1315 73
67 3300048905 Ga0496102_0958949 Ga0496102_0958949_503_724 73
68 3300053077 Ga0495601_0763057 Ga0495601_0763057_313_534 73
69 3300005457 Ga0070662_100521666 Ga0070662_1005216662 74
70 3300005548 Ga0070665_100039027 Ga0070665_1000390277 74
71 3300025919 Ga0207657_11406431 Ga0207657_114064312 74
72 3300026121 Ga0207683_10630963 Ga0207683_106309632 74
73 3300035116 Ga0373945_0193558 Ga0373945_0193558_411_635 74
74 3300037068 Ga0373925_0236845 Ga0373925_0236845_442_666 74
75 3300041458 Ga0451798_0946080 Ga0451798_0946080_134_358 74
76 3300046681 Ga0495647_0586663 Ga0495647_0586663_156_380 74
77 iso_pu_bacteria 2894772417 2894774396 75
78 iso_pu_bacteria 3002141150 3002144372 75
79 iso_pu_bacteria 2511231221 2512032431 76
80 iso_pu_bacteria 2522572158 2523102643 76
81 iso_pu_bacteria 2524023250 2524609455 76
82 iso_pu_bacteria 2597490356 2599105399 76
83 iso_pu_bacteria 2842775625 2842777954 76
84 iso_pu_bacteria 2846952575 2846954919 76
85 iso_pu_bacteria 2848858292 2848860543 76
86 iso_pu_bacteria 2897803580 2897806183 76
87 iso_pu_bacteria 8054002106 8054005978 76
88 3300005327 Ga0070658_10034663 Ga0070658_100346634 79
89 3300005328 Ga0070676_10616048 Ga0070676_106160481 79
90 3300005329 Ga0070683_100730207 Ga0070683_1007302072 79
91 3300005337 Ga0070682_101432808 Ga0070682_1014328082 79
92 3300005338 Ga0068868_100099235 Ga0068868_1000992354 79
93 3300005339 Ga0070660_100014637 Ga0070660_1000146375 79
94 3300005366 Ga0070659_100028695 Ga0070659_1000286952 79
95 3300005455 Ga0070663_100048820 Ga0070663_1000488204 79
96 3300005455 Ga0070663_100182298 Ga0070663_1001822982 79
97 3300005457 Ga0070662_100815435 Ga0070662_1008154352 79
98 3300005530 Ga0070679_101188516 Ga0070679_1011885162 79
99 3300005535 Ga0070684_100102560 Ga0070684_1001025603 79
100 3300005539 Ga0068853_100002194 Ga0068853_1000021948 79
101 3300005539 Ga0068853_100032562 Ga0068853_1000325622 79
102 3300005563 Ga0068855_100097061 Ga0068855_1000970612 79
103 3300005563 Ga0068855_100129089 Ga0068855_1001290894 79
104 3300005563 Ga0068855_100208652 Ga0068855_1002086524 79
105 3300005563 Ga0068855_100214721 Ga0068855_1002147213 79
106 3300005563 Ga0068855_100511763 Ga0068855_1005117632 79
107 3300005564 Ga0070664_100333366 Ga0070664_1003333662 79
108 3300005577 Ga0068857_100404447 Ga0068857_1004044472 79
109 3300005577 Ga0068857_100946225 Ga0068857_1009462252 79
110 3300005578 Ga0068854_100003320 Ga0068854_1000033209 79
111 3300005578 Ga0068854_100024710 Ga0068854_1000247105 79
112 3300005578 Ga0068854_102288845 Ga0068854_1022888452 79
113 3300005614 Ga0068856_100072854 Ga0068856_1000728544 79
114 3300005614 Ga0068856_100234683 Ga0068856_1002346832 79
115 3300005614 Ga0068856_101100017 Ga0068856_1011000172 79
116 3300005616 Ga0068852_100003488 Ga0068852_10000348810 79
117 3300005616 Ga0068852_100007647 Ga0068852_1000076474 79
118 3300005616 Ga0068852_100013493 Ga0068852_1000134939 79
119 3300005618 Ga0068864_100511379 Ga0068864_1005113791 79
120 3300005834 Ga0068851_10001935 Ga0068851_100019357 79
121 3300006048 Ga0075363_100033775 Ga0075363_1000337752 79
122 3300006048 Ga0075363_100056901 Ga0075363_1000569012 79
123 3300006051 Ga0075364_10024791 Ga0075364_100247913 79
124 3300006051 Ga0075364_10296770 Ga0075364_102967702 79
125 3300006051 Ga0075364_10332005 Ga0075364_103320052 79
126 3300006058 Ga0075432_10374250 Ga0075432_103742502 79
127 3300006177 Ga0075362_10007197 Ga0075362_100071975 79
128 3300006177 Ga0075362_10029282 Ga0075362_100292822 79
129 3300006177 Ga0075362_10190704 Ga0075362_101907042 79
130 3300006178 Ga0075367_10019329 Ga0075367_100193293 79
131 3300006178 Ga0075367_10206897 Ga0075367_102068972 79
132 3300006186 Ga0075369_10446792 Ga0075369_104467922 79
133 3300006195 Ga0075366_10013866 Ga0075366_100138665 79
134 3300006237 Ga0097621_100164766 Ga0097621_1001647662 79
135 3300009093 Ga0105240_10158518 Ga0105240_101585182 79
136 3300009093 Ga0105240_10391683 Ga0105240_103916832 79
137 3300009098 Ga0105245_11657140 Ga0105245_116571402 79
138 3300009098 Ga0105245_13111524 Ga0105245_131115241 79
139 3300009147 Ga0114129_12531245 Ga0114129_125312452 79
140 3300009148 Ga0105243_10549941 Ga0105243_105499411 79
141 3300009174 Ga0105241_10037479 Ga0105241_100374792 79
142 3300009174 Ga0105241_10071407 Ga0105241_100714073 79
143 3300009176 Ga0105242_10742254 Ga0105242_107422542 79
144 3300009176 Ga0105242_12236310 Ga0105242_122363101 79
145 3300009177 Ga0105248_12291157 Ga0105248_122911572 79
146 3300009545 Ga0105237_10041468 Ga0105237_100414686 79
147 3300009551 Ga0105238_10035940 Ga0105238_100359406 79
148 3300009551 Ga0105238_10172179 Ga0105238_101721792 79
149 3300009551 Ga0105238_10676007 Ga0105238_106760072 79
150 3300010375 Ga0105239_10025681 Ga0105239_100256814 79
151 3300010375 Ga0105239_10695661 Ga0105239_106956612 79
152 3300013100 Ga0157373_10137675 Ga0157373_101376751 79
153 3300013102 Ga0157371_10009845 Ga0157371_100098458 79
154 3300013104 Ga0157370_10022575 Ga0157370_100225755 79
155 3300013104 Ga0157370_10076887 Ga0157370_100768871 79
156 3300013104 Ga0157370_10589434 Ga0157370_105894342 79
157 3300013104 Ga0157370_11831837 Ga0157370_118318371 79
158 3300013297 Ga0157378_10231632 Ga0157378_102316322 79
159 3300013297 Ga0157378_11260453 Ga0157378_112604532 79
160 3300013307 Ga0157372_10842844 Ga0157372_108428442 79
161 3300013307 Ga0157372_11828603 Ga0157372_118286032 79
162 3300014325 Ga0163163_10134983 Ga0163163_101349833 79
163 3300014968 Ga0157379_10960899 Ga0157379_109608992 79
164 3300014969 Ga0157376_11417293 Ga0157376_114172932 79
165 3300025321 Ga0207656_10000887 Ga0207656_100008879 79
166 3300025909 Ga0207705_10053858 Ga0207705_100538583 79
167 3300025911 Ga0207654_10188307 Ga0207654_101883072 79
168 3300025911 Ga0207654_10221032 Ga0207654_102210322 79
169 3300025911 Ga0207654_10288492 Ga0207654_102884922 79
170 3300025912 Ga0207707_10520344 Ga0207707_105203442 79
171 3300025913 Ga0207695_10119337 Ga0207695_101193372 79
172 3300025913 Ga0207695_10249637 Ga0207695_102496373 79
173 3300025919 Ga0207657_10026748 Ga0207657_100267487 79
174 3300025920 Ga0207649_10025971 Ga0207649_100259714 79
175 3300025924 Ga0207694_10019272 Ga0207694_100192726 79
176 3300025927 Ga0207687_11074604 Ga0207687_110746042 79
177 3300025927 Ga0207687_11588566 Ga0207687_115885662 79
178 3300025932 Ga0207690_10299649 Ga0207690_102996491 79
179 3300025933 Ga0207706_10110350 Ga0207706_101103502 79
180 3300025935 Ga0207709_10307807 Ga0207709_103078072 79
181 3300025937 Ga0207669_11407244 Ga0207669_114072441 79
182 3300025939 Ga0207665_10509987 Ga0207665_105099872 79
183 3300025944 Ga0207661_11188547 Ga0207661_111885471 79
184 3300025949 Ga0207667_10057735 Ga0207667_100577358 79
185 3300025949 Ga0207667_10070173 Ga0207667_100701733 79
186 3300025981 Ga0207640_10003952 Ga0207640_100039528 79
187 3300025981 Ga0207640_10118464 Ga0207640_101184642 79
188 3300026023 Ga0207677_10129927 Ga0207677_101299272 79
189 3300026041 Ga0207639_10010460 Ga0207639_100104607 79
190 3300026041 Ga0207639_10125442 Ga0207639_101254425 79
191 3300026041 Ga0207639_10673112 Ga0207639_106731122 79
192 3300026067 Ga0207678_10152286 Ga0207678_101522863 79
193 3300026078 Ga0207702_10017610 Ga0207702_100176107 79
194 3300026078 Ga0207702_10156439 Ga0207702_101564394 79
195 3300026078 Ga0207702_10264461 Ga0207702_102644612 79
196 3300026089 Ga0207648_10569288 Ga0207648_105692883 79
197 3300026089 Ga0207648_11637745 Ga0207648_116377452 79
198 3300026116 Ga0207674_10017245 Ga0207674_1001724510 79
199 3300026116 Ga0207674_10330282 Ga0207674_103302822 79
200 3300026142 Ga0207698_10002528 Ga0207698_1000252810 79
201 3300026142 Ga0207698_10574496 Ga0207698_105744962 79
202 3300028379 Ga0268266_11693129 Ga0268266_116931292 79
203 3300028800 Ga0265338_10114946 Ga0265338_101149463 79
204 3300029957 Ga0265324_10053599 Ga0265324_100535992 79
205 3300031235 Ga0265330_10024058 Ga0265330_100240584 79
206 3300031241 Ga0265325_10056673 Ga0265325_100566732 79
207 3300031242 Ga0265329_10102590 Ga0265329_101025902 79
208 3300031249 Ga0265339_10000397 Ga0265339_1000039748 79
209 3300031344 Ga0265316_10086402 Ga0265316_100864024 79
210 3300031595 Ga0265313_10000032 Ga0265313_1000003214 79
211 3300031901 Ga0307406_10193302 Ga0307406_101933022 79
212 3300031995 Ga0307409_102370051 Ga0307409_1023700512 79
213 3300032004 Ga0307414_10588054 Ga0307414_105880542 79
214 3300032005 Ga0307411_11778026 Ga0307411_117780262 79
215 3300034816 Ga0373930_0020161 Ga0373930_0020161_782_1021 79
216 3300035084 Ga0373928_0263474 Ga0373928_0263474_250_489 79
217 3300035115 Ga0373941_0166525 Ga0373941_0166525_214_453 79
218 3300035691 Ga0373931_1088462 Ga0373931_1088462_283_522 79
219 3300035695 Ga0373927_0360830 Ga0373927_0360830_44_283 79
220 3300035695 Ga0373927_0947623 Ga0373927_0947623_264_521 79
221 3300037312 Ga0395899_0691402 Ga0395899_0691402_368_607 79
222 3300037418 Ga0395900_0468506 Ga0395900_0468506_451_690 79
223 3300037466 Ga0395898_0717477 Ga0395898_0717477_351_590 79
224 3300038443 Ga0395901_0713111 Ga0395901_0713111_308_547 79
225 3300039437 Ga0436365_0414779 Ga0436365_0414779_116_355 79
226 3300039437 Ga0436365_1686548 Ga0436365_1686548_117_356 79
227 3300039437 Ga0436365_1694241 Ga0436365_1694241_348_587 79
228 3300041441 Ga0451787_280404 Ga0451787_280404_263_502 79
229 3300041451 Ga0451791_1235116 Ga0451791_1235116_312_551 79
230 3300046506 Ga0495583_0272368 Ga0495583_0272368_174_413 79
231 3300049590 Ga0501074_1332310 Ga0501074_1332310_68_307 79
232 3300050489 nmdc:mga03683_130026_c1 nmdc:mga03683_130026_c1_91_330 79
233 3300050489 nmdc:mga03683_27877_c1 nmdc:mga03683_27877_c1_756_995 79
234 3300050489 nmdc:mga03683_47272_c1 nmdc:mga03683_47272_c1_1102_1341 79
235 3300050490 nmdc:mga03n38_192938_c1 nmdc:mga03n38_192938_c1_510_749 79
236 3300050490 nmdc:mga03n38_42434_c1 nmdc:mga03n38_42434_c1_503_742 79
237 3300050491 nmdc:mga00v17_464594_c1 nmdc:mga00v17_464594_c1_321_560 79
238 3300050491 nmdc:mga00v17_98512_c1 nmdc:mga00v17_98512_c1_497_736 79
239 3300050492 nmdc:mga0yw44_914654_c1 nmdc:mga0yw44_914654_c1_329_568 79
240 3300050493 nmdc:mga0k408_27336_c1 nmdc:mga0k408_27336_c1_2985_3224 79
241 3300050493 nmdc:mga0k408_799567_c1 nmdc:mga0k408_799567_c1_31_270 79
242 3300050494 nmdc:mga06z11_199706_c1 nmdc:mga06z11_199706_c1_137_376 79
243 3300050494 nmdc:mga06z11_272407_c1 nmdc:mga06z11_272407_c1_375_614 79
244 3300050496 nmdc:mga07m45_216693_c1 nmdc:mga07m45_216693_c1_662_901 79
245 3300050507 nmdc:mga05p37_646173_c1 nmdc:mga05p37_646173_c1_571_810 79
246 3300059492 Ga0587073_0058770 Ga0587073_0058770_20_259 79
247 3300059506 Ga0587085_063198 Ga0587085_063198_457_696 79
248 3300059627 Ga0587117_069296 Ga0587117_069296_369_608 79
249 3300059646 Ga0587078_025748 Ga0587078_025748_490_729 79
250 3300059647 Ga0587079_080307 Ga0587079_080307_89_328 79
251 2088090003 LJN_F7QKVOU01BQGDU LJN_00440130 80
252 3300003203 JGI25406J46586_10044658 JGI25406J46586_100446583 80
253 3300004799 Ga0058863_11645915 Ga0058863_116459152 80
254 3300005289 Ga0065704_10391639 Ga0065704_103916392 80
255 3300005327 Ga0070658_10008327 Ga0070658_100083278 80
256 3300005328 Ga0070676_11475455 Ga0070676_114754551 80
257 3300005330 Ga0070690_100673912 Ga0070690_1006739122 80
258 3300005336 Ga0070680_100015841 Ga0070680_1000158413 80
259 3300005338 Ga0068868_102209838 Ga0068868_1022098382 80
260 3300005339 Ga0070660_100291403 Ga0070660_1002914032 80
261 3300005341 Ga0070691_10015649 Ga0070691_100156494 80
262 3300005347 Ga0070668_101734544 Ga0070668_1017345442 80
263 3300005353 Ga0070669_101202777 Ga0070669_1012027772 80
264 3300005354 Ga0070675_101670677 Ga0070675_1016706771 80
265 3300005356 Ga0070674_100202871 Ga0070674_1002028712 80
266 3300005356 Ga0070674_101516461 Ga0070674_1015164612 80
267 3300005364 Ga0070673_101892796 Ga0070673_1018927962 80
268 3300005364 Ga0070673_102229601 Ga0070673_1022296011 80
269 3300005434 Ga0070709_10028618 Ga0070709_100286184 80
270 3300005435 Ga0070714_100004146 Ga0070714_1000041468 80
271 3300005436 Ga0070713_100000939 Ga0070713_10000093915 80
272 3300005436 Ga0070713_100086246 Ga0070713_1000862464 80
273 3300005436 Ga0070713_100352912 Ga0070713_1003529122 80
274 3300005436 Ga0070713_101082232 Ga0070713_1010822322 80
275 3300005437 Ga0070710_10053020 Ga0070710_100530201 80
276 3300005438 Ga0070701_10687886 Ga0070701_106878862 80
277 3300005439 Ga0070711_100008941 Ga0070711_1000089417 80
278 3300005440 Ga0070705_101254033 Ga0070705_1012540332 80
279 3300005441 Ga0070700_101821374 Ga0070700_1018213742 80
280 3300005441 Ga0070700_101892594 Ga0070700_1018925942 80
281 3300005456 Ga0070678_100044838 Ga0070678_1000448383 80
282 3300005458 Ga0070681_10029061 Ga0070681_100290613 80
283 3300005458 Ga0070681_10667553 Ga0070681_106675532 80
284 3300005458 Ga0070681_10813433 Ga0070681_108134332 80
285 3300005458 Ga0070681_11101739 Ga0070681_111017392 80
286 3300005467 Ga0070706_100347490 Ga0070706_1003474903 80
287 3300005467 Ga0070706_101484978 Ga0070706_1014849781 80
288 3300005518 Ga0070699_100057798 Ga0070699_1000577983 80
289 3300005530 Ga0070679_100002889 Ga0070679_10000288911 80
290 3300005535 Ga0070684_100585366 Ga0070684_1005853662 80
291 3300005536 Ga0070697_100072310 Ga0070697_1000723102 80
292 3300005545 Ga0070695_100122969 Ga0070695_1001229692 80
293 3300005546 Ga0070696_101371951 Ga0070696_1013719512 80
294 3300005547 Ga0070693_101619699 Ga0070693_1016196992 80
295 3300005548 Ga0070665_100044210 Ga0070665_1000442102 80
296 3300005548 Ga0070665_100493404 Ga0070665_1004934043 80
297 3300005548 Ga0070665_101267069 Ga0070665_1012670692 80
298 3300005563 Ga0068855_100094201 Ga0068855_1000942012 80
299 3300005577 Ga0068857_100041147 Ga0068857_1000411473 80
300 3300005577 Ga0068857_100831884 Ga0068857_1008318842 80
301 3300005614 Ga0068856_100199632 Ga0068856_1001996323 80
302 3300005614 Ga0068856_100219317 Ga0068856_1002193173 80
303 3300005614 Ga0068856_100515395 Ga0068856_1005153952 80
304 3300005617 Ga0068859_100181338 Ga0068859_1001813382 80
305 3300005840 Ga0068870_10678248 Ga0068870_106782482 80
306 3300005841 Ga0068863_100292262 Ga0068863_1002922623 80
307 3300005841 Ga0068863_101064418 Ga0068863_1010644182 80
308 3300005842 Ga0068858_102327032 Ga0068858_1023270321 80
309 3300005843 Ga0068860_101507793 Ga0068860_1015077932 80
310 3300005937 Ga0081455_10000434 Ga0081455_1000043428 80
311 3300005937 Ga0081455_10002143 Ga0081455_100021433 80
312 3300005981 Ga0081538_10031628 Ga0081538_100316284 80
313 3300005985 Ga0081539_10009772 Ga0081539_100097723 80
314 3300005985 Ga0081539_10011462 Ga0081539_100114628 80
315 3300005985 Ga0081539_10019052 Ga0081539_100190526 80
316 3300006038 Ga0075365_10029237 Ga0075365_100292373 80
317 3300006038 Ga0075365_10326099 Ga0075365_103260992 80
318 3300006038 Ga0075365_10346649 Ga0075365_103466492 80
319 3300006038 Ga0075365_10916917 Ga0075365_109169172 80
320 3300006038 Ga0075365_11126589 Ga0075365_111265892 80
321 3300006042 Ga0075368_10126789 Ga0075368_101267892 80
322 3300006051 Ga0075364_10256115 Ga0075364_102561152 80
323 3300006051 Ga0075364_11077529 Ga0075364_110775292 80
324 3300006163 Ga0070715_10579026 Ga0070715_105790261 80
325 3300006173 Ga0070716_100063676 Ga0070716_1000636763 80
326 3300006175 Ga0070712_100000779 Ga0070712_1000007797 80
327 3300006175 Ga0070712_100812336 Ga0070712_1008123362 80
328 3300006177 Ga0075362_10052564 Ga0075362_100525643 80
329 3300006177 Ga0075362_10127471 Ga0075362_101274712 80
330 3300006177 Ga0075362_10297494 Ga0075362_102974942 80
331 3300006186 Ga0075369_10000336 Ga0075369_100003366 80
332 3300006186 Ga0075369_10058572 Ga0075369_100585723 80
333 3300006186 Ga0075369_10236628 Ga0075369_102366282 80
334 3300006195 Ga0075366_10091553 Ga0075366_100915533 80
335 3300006195 Ga0075366_10188225 Ga0075366_101882252 80
336 3300006353 Ga0075370_10934287 Ga0075370_109342871 80
337 3300006931 Ga0097620_100181331 Ga0097620_1001813313 80
338 3300007265 Ga0099794_10351138 Ga0099794_103511382 80
339 3300007788 Ga0099795_10417585 Ga0099795_104175851 80
340 3300009093 Ga0105240_10346169 Ga0105240_103461692 80
341 3300009094 Ga0111539_10544564 Ga0111539_105445641 80
342 3300009098 Ga0105245_10483539 Ga0105245_104835393 80
343 3300009098 Ga0105245_11381971 Ga0105245_113819712 80
344 3300009101 Ga0105247_11036065 Ga0105247_110360652 80
345 3300009147 Ga0114129_11331828 Ga0114129_113318282 80
346 3300009147 Ga0114129_12334845 Ga0114129_123348451 80
347 3300009148 Ga0105243_11226887 Ga0105243_112268872 80
348 3300009148 Ga0105243_11602529 Ga0105243_116025292 80
349 3300009545 Ga0105237_11585720 Ga0105237_115857201 80
350 3300009545 Ga0105237_12602580 Ga0105237_126025802 80
351 3300009551 Ga0105238_11190233 Ga0105238_111902332 80
352 3300009988 Ga0105035_128506 Ga0105035_1285061 80
353 3300010159 Ga0099796_10184441 Ga0099796_101844412 80
354 3300010159 Ga0099796_10248679 Ga0099796_102486791 80
355 3300011119 Ga0105246_11833480 Ga0105246_118334802 80
356 3300012500 Ga0157314_1042027 Ga0157314_10420272 80
357 3300013104 Ga0157370_10009458 Ga0157370_100094587 80
358 3300013297 Ga0157378_11359364 Ga0157378_113593642 80
359 3300013306 Ga0163162_10783964 Ga0163162_107839642 80
360 3300013306 Ga0163162_11594950 Ga0163162_115949502 80
361 3300013307 Ga0157372_11891280 Ga0157372_118912802 80
362 3300013308 Ga0157375_13761565 Ga0157375_137615652 80
363 3300014325 Ga0163163_11812798 Ga0163163_118127982 80
364 3300014325 Ga0163163_12278755 Ga0163163_122787552 80
365 3300014326 Ga0157380_11269710 Ga0157380_112697102 80
366 3300014326 Ga0157380_12726352 Ga0157380_127263522 80
367 3300014497 Ga0182008_10019469 Ga0182008_100194694 80
368 3300014968 Ga0157379_11175648 Ga0157379_111756482 80
369 3300014969 Ga0157376_11228135 Ga0157376_112281352 80
370 3300020070 Ga0206356_11886213 Ga0206356_118862132 80
371 3300020076 Ga0206355_1135818 Ga0206355_11358181 80
372 3300021358 Ga0213873_10004937 Ga0213873_100049372 80
373 3300021361 Ga0213872_10272679 Ga0213872_102726792 80
374 3300021361 Ga0213872_10417208 Ga0213872_104172082 80
375 3300021388 Ga0213875_10028110 Ga0213875_100281103 80
376 3300021388 Ga0213875_10152381 Ga0213875_101523812 80
377 3300021441 Ga0213871_10006183 Ga0213871_100061833 80
378 3300021441 Ga0213871_10018139 Ga0213871_100181394 80
379 3300025291 Ga0209675_1000985 Ga0209675_100098514 80
380 3300025292 Ga0209676_1087330 Ga0209676_10873302 80
381 3300025904 Ga0207647_10568001 Ga0207647_105680012 80
382 3300025905 Ga0207685_10405396 Ga0207685_104053962 80
383 3300025905 Ga0207685_10645224 Ga0207685_106452242 80
384 3300025906 Ga0207699_10013245 Ga0207699_100132453 80
385 3300025907 Ga0207645_10771443 Ga0207645_107714432 80
386 3300025908 Ga0207643_10429658 Ga0207643_104296582 80
387 3300025909 Ga0207705_10041156 Ga0207705_100411563 80
388 3300025910 Ga0207684_10333564 Ga0207684_103335642 80
389 3300025910 Ga0207684_10632928 Ga0207684_106329281 80
390 3300025912 Ga0207707_10013882 Ga0207707_100138825 80
391 3300025912 Ga0207707_10661188 Ga0207707_106611881 80
392 3300025912 Ga0207707_10866874 Ga0207707_108668741 80
393 3300025913 Ga0207695_10067173 Ga0207695_100671733 80
394 3300025914 Ga0207671_11182681 Ga0207671_111826811 80
395 3300025915 Ga0207693_10011626 Ga0207693_100116262 80
396 3300025915 Ga0207693_10375123 Ga0207693_103751233 80
397 3300025916 Ga0207663_11464526 Ga0207663_114645262 80
398 3300025917 Ga0207660_10461161 Ga0207660_104611611 80
399 3300025919 Ga0207657_10252473 Ga0207657_102524732 80
400 3300025921 Ga0207652_10027622 Ga0207652_100276223 80
401 3300025923 Ga0207681_10070672 Ga0207681_100706722 80
402 3300025924 Ga0207694_10346764 Ga0207694_103467642 80
403 3300025924 Ga0207694_11259872 Ga0207694_112598722 80
404 3300025928 Ga0207700_10003857 Ga0207700_100038574 80
405 3300025929 Ga0207664_10008762 Ga0207664_100087625 80
406 3300025929 Ga0207664_10808971 Ga0207664_108089712 80
407 3300025937 Ga0207669_11150379 Ga0207669_111503792 80
408 3300025939 Ga0207665_10073547 Ga0207665_100735472 80
409 3300025939 Ga0207665_10418843 Ga0207665_104188432 80
410 3300025940 Ga0207691_10161690 Ga0207691_101616902 80
411 3300025942 Ga0207689_10535312 Ga0207689_105353122 80
412 3300025944 Ga0207661_10529855 Ga0207661_105298552 80
413 3300025945 Ga0207679_11798340 Ga0207679_117983402 80
414 3300025949 Ga0207667_10002364 Ga0207667_1000236424 80
415 3300025949 Ga0207667_11688995 Ga0207667_116889952 80
416 3300025961 Ga0207712_11032831 Ga0207712_110328311 80
417 3300026035 Ga0207703_11851107 Ga0207703_118511071 80
418 3300026041 Ga0207639_11786630 Ga0207639_117866301 80
419 3300026067 Ga0207678_11448653 Ga0207678_114486532 80
420 3300026075 Ga0207708_11118276 Ga0207708_111182762 80
421 3300026078 Ga0207702_10166638 Ga0207702_101666382 80
422 3300026078 Ga0207702_10494373 Ga0207702_104943732 80
423 3300026078 Ga0207702_12454450 Ga0207702_124544502 80
424 3300026095 Ga0207676_12438304 Ga0207676_124383042 80
425 3300026116 Ga0207674_10032698 Ga0207674_100326985 80
426 3300026116 Ga0207674_10192431 Ga0207674_101924313 80
427 3300026118 Ga0207675_100537358 Ga0207675_1005373582 80
428 3300026121 Ga0207683_10069539 Ga0207683_100695393 80
429 3300027866 Ga0209813_10158147 Ga0209813_101581472 80
430 3300028379 Ga0268266_10186323 Ga0268266_101863232 80
431 3300028379 Ga0268266_10346541 Ga0268266_103465412 80
432 3300028379 Ga0268266_10590099 Ga0268266_105900992 80
433 3300028380 Ga0268265_10887224 Ga0268265_108872242 80
434 3300028573 Ga0265334_10041312 Ga0265334_100413121 80
435 3300028786 Ga0307517_10445086 Ga0307517_104450862 80
436 3300030521 Ga0307511_10213818 Ga0307511_102138182 80
437 3300031242 Ga0265329_10230058 Ga0265329_102300582 80
438 3300031247 Ga0265340_10137109 Ga0265340_101371091 80
439 3300031731 Ga0307405_10064977 Ga0307405_100649772 80
440 3300031901 Ga0307406_10786535 Ga0307406_107865351 80
441 3300031911 Ga0307412_10881190 Ga0307412_108811902 80
442 3300031995 Ga0307409_100078824 Ga0307409_1000788246 80
443 3300032002 Ga0307416_100635065 Ga0307416_1006350652 80
444 3300032004 Ga0307414_10637001 Ga0307414_106370012 80
445 3300032126 Ga0307415_100391663 Ga0307415_1003916632 80
446 3300035085 Ga0373929_0179325 Ga0373929_0179325_126_368 80
447 3300035086 Ga0373934_0028064 Ga0373934_0028064_1473_1715 80
448 3300035088 Ga0373940_0065355 Ga0373940_0065355_400_642 80
449 3300035111 Ga0373923_0119568 Ga0373923_0119568_735_977 80
450 3300035112 Ga0373932_0229769 Ga0373932_0229769_258_500 80
451 3300035113 Ga0373936_0131550 Ga0373936_0131550_207_449 80
452 3300035114 Ga0373939_0127742 Ga0373939_0127742_339_581 80
453 3300035115 Ga0373941_0155144 Ga0373941_0155144_298_540 80
454 3300035117 Ga0373953_0118550 Ga0373953_0118550_424_666 80
455 3300035170 Ga0373943_0323040 Ga0373943_0323040_41_283 80
456 3300035170 Ga0373943_0326197 Ga0373943_0326197_106_348 80
457 3300035172 Ga0373955_0108703 Ga0373955_0108703_1244_1486 80
458 3300035172 Ga0373955_0164251 Ga0373955_0164251_91_333 80
459 3300035172 Ga0373955_0740259 Ga0373955_0740259_99_341 80
460 3300035410 Ga0373924_0062969 Ga0373924_0062969_1149_1391 80
461 3300035692 Ga0373935_0373484 Ga0373935_0373484_33_275 80
462 3300035692 Ga0373935_0508271 Ga0373935_0508271_213_455 80
463 3300035692 Ga0373935_0656545 Ga0373935_0656545_38_280 80
464 3300035695 Ga0373927_0098382 Ga0373927_0098382_72_314 80
465 3300035695 Ga0373927_0622732 Ga0373927_0622732_92_334 80
466 3300035724 Ga0373933_0001236 Ga0373933_0001236_2910_3152 80
467 3300035725 Ga0373947_0335811 Ga0373947_0335811_738_980 80
468 3300035725 Ga0373947_0446030 Ga0373947_0446030_580_822 80
469 3300036401 Ga0373937_0005149 Ga0373937_0005149_5498_5740 80
470 3300036401 Ga0373937_0257543 Ga0373937_0257543_295_537 80
471 3300037068 Ga0373925_0023574 Ga0373925_0023574_598_840 80
472 3300037068 Ga0373925_0768771 Ga0373925_0768771_163_405 80
473 3300037312 Ga0395899_0027167 Ga0395899_0027167_857_1099 80
474 3300037312 Ga0395899_0178224 Ga0395899_0178224_180_422 80
475 3300037418 Ga0395900_0102804 Ga0395900_0102804_1786_2028 80
476 3300037466 Ga0395898_0016415 Ga0395898_0016415_2911_3153 80
477 3300037471 Ga0395905_1070902 Ga0395905_1070902_177_419 80
478 3300037853 Ga0436364_0821358 Ga0436364_0821358_3204_3449 80
479 3300037853 Ga0436364_1239827 Ga0436364_1239827_1917_2159 80
480 3300038443 Ga0395901_0001851 Ga0395901_0001851_20214_20456 80
481 3300038443 Ga0395901_0034540 Ga0395901_0034540_750_992 80
482 3300039438 Ga0436360_0405006 Ga0436360_0405006_1034_1276 80
483 3300039438 Ga0436360_0848685 Ga0436360_0848685_129_371 80
484 3300039438 Ga0436360_1286833 Ga0436360_1286833_2189_2431 80
485 3300039447 Ga0436361_0305263 Ga0436361_0305263_1217_1459 80
486 3300039447 Ga0436361_0767627 Ga0436361_0767627_1895_2137 80
487 3300039447 Ga0436361_1163612 Ga0436361_1163612_142_384 80
488 3300039453 Ga0436362_0338910 Ga0436362_0338910_229_471 80
489 3300041460 Ga0451802_1078191 Ga0451802_1078191_272_514 80
490 3300041496 Ga0451839_0008132 Ga0451839_0008132_155_397 80
491 3300041512 Ga0451853_3561479 Ga0451853_3561479_107_349 80
492 3300042438 Ga0439459_0035812 Ga0439459_0035812_697_939 80
493 3300042461 Ga0439460_0091211 Ga0439460_0091211_507_752 80
494 3300046475 Ga0495639_0370691 Ga0495639_0370691_352_594 80
495 3300046511 Ga0495608_0070537 Ga0495608_0070537_1102_1344 80
496 3300046516 Ga0495628_0539461 Ga0495628_0539461_580_822 80
497 3300046536 Ga0495587_0014044 Ga0495587_0014044_2884_3126 80
498 3300046543 Ga0495645_0562672 Ga0495645_0562672_91_333 80
499 3300046559 Ga0495667_0081426 Ga0495667_0081426_260_502 80
500 3300046559 Ga0495667_0310071 Ga0495667_0310071_722_964 80
501 3300046616 Ga0495668_0201172 Ga0495668_0201172_652_894 80
502 3300046663 Ga0495635_0111009 Ga0495635_0111009_711_953 80
503 3300046675 Ga0495657_0152607 Ga0495657_0152607_1101_1343 80
504 3300046678 Ga0495599_0164936 Ga0495599_0164936_690_932 80
505 3300046679 Ga0495623_0024082 Ga0495623_0024082_3570_3812 80
506 3300046680 Ga0495646_0283135 Ga0495646_0283135_66_308 80
507 3300046692 Ga0495671_0467038 Ga0495671_0467038_112_354 80
508 3300046809 Ga0495600_0022905 Ga0495600_0022905_1360_1602 80
509 3300047319 Ga0495674_1176241 Ga0495674_1176241_204_446 80
510 3300047322 Ga0495680_0040284 Ga0495680_0040284_1095_1337 80
511 3300047444 Ga0495675_0157551 Ga0495675_0157551_56_298 80
512 3300048088 Ga0495602_0023216 Ga0495602_0023216_3206_3448 80
513 3300048915 Ga0496112_1461879 Ga0496112_1461879_250_492 80
514 3300048916 Ga0496113_1086356 Ga0496113_1086356_192_434 80
515 3300048922 Ga0496119_0003988 Ga0496119_0003988_4085_4327 80
516 3300048923 Ga0496120_0080651 Ga0496120_0080651_480_722 80
517 3300048925 Ga0496122_0067264 Ga0496122_0067264_17_259 80
518 3300049534 Ga0501318_003228 Ga0501318_003228_293_535 80
519 3300049569 Ga0501032_0169566 Ga0501032_0169566_1107_1349 80
520 3300049570 Ga0501033_0541758 Ga0501033_0541758_536_778 80
521 3300049571 Ga0501034_0017532 Ga0501034_0017532_7014_7268 80
522 3300049571 Ga0501034_0037546 Ga0501034_0037546_1241_1483 80
523 3300049572 Ga0501036_1708392 Ga0501036_1708392_224_466 80
524 3300049575 Ga0501039_1544209 Ga0501039_1544209_217_459 80
525 3300049584 Ga0501068_0140025 Ga0501068_0140025_1221_1475 80
526 3300049586 Ga0501070_0685556 Ga0501070_0685556_72_326 80
527 3300049586 Ga0501070_0795355 Ga0501070_0795355_94_336 80
528 3300049590 Ga0501074_1044795 Ga0501074_1044795_126_368 80
529 3300049593 Ga0501077_0270191 Ga0501077_0270191_73_315 80
530 3300049822 Ga0501035_0744268 Ga0501035_0744268_324_566 80
531 3300049823 Ga0501044_0117070 Ga0501044_0117070_1050_1292 80
532 3300049823 Ga0501044_1413941 Ga0501044_1413941_43_297 80
533 3300050489 nmdc:mga03683_121593_c1 nmdc:mga03683_121593_c1_499_741 80
534 3300050489 nmdc:mga03683_17888_c1 nmdc:mga03683_17888_c1_85_327 80
535 3300050489 nmdc:mga03683_216721_c1 nmdc:mga03683_216721_c1_249_491 80
536 3300050490 nmdc:mga03n38_82602_c1 nmdc:mga03n38_82602_c1_46_288 80
537 3300050490 nmdc:mga03n38_964652_c1 nmdc:mga03n38_964652_c1_204_446 80
538 3300050491 nmdc:mga00v17_961827_c1 nmdc:mga00v17_961827_c1_162_404 80
539 3300050492 nmdc:mga0yw44_11213_c1 nmdc:mga0yw44_11213_c1_4102_4344 80
540 3300050492 nmdc:mga0yw44_65149_c1 nmdc:mga0yw44_65149_c1_714_956 80
541 3300050492 nmdc:mga0yw44_744456_c1 nmdc:mga0yw44_744456_c1_20_262 80
542 3300050492 nmdc:mga0yw44_893222_c1 nmdc:mga0yw44_893222_c1_181_423 80
543 3300050492 nmdc:mga0yw44_99739_c1 nmdc:mga0yw44_99739_c1_925_1167 80
544 3300050493 nmdc:mga0k408_325016_c1 nmdc:mga0k408_325016_c1_165_407 80
545 3300050493 nmdc:mga0k408_330591_c2 nmdc:mga0k408_330591_c2_97_339 80
546 3300050493 nmdc:mga0k408_42473_c2 nmdc:mga0k408_42473_c2_658_900 80
547 3300050494 nmdc:mga06z11_548628_c1 nmdc:mga06z11_548628_c1_442_684 80
548 3300050494 nmdc:mga06z11_69100_c1 nmdc:mga06z11_69100_c1_516_758 80
549 3300050495 nmdc:mga04h51_256017_c1 nmdc:mga04h51_256017_c1_371_613 80
550 3300050496 nmdc:mga07m45_319831_c1 nmdc:mga07m45_319831_c1_223_465 80
551 3300050496 nmdc:mga07m45_48677_c1 nmdc:mga07m45_48677_c1_295_537 80
552 3300050511 nmdc:mga08y16_778081_c1 nmdc:mga08y16_778081_c1_667_909 80
553 3300050511 nmdc:mga08y16_908355_c1 nmdc:mga08y16_908355_c1_318_560 80
554 3300050512 nmdc:mga0n895_1956682_c1 nmdc:mga0n895_1956682_c1_55_297 80
555 3300050516 nmdc:mga0sz30_137258_c1 nmdc:mga0sz30_137258_c1_466_708 80
556 3300050516 nmdc:mga0sz30_41305_c1 nmdc:mga0sz30_41305_c1_455_697 80
557 3300050516 nmdc:mga0sz30_41844_c1 nmdc:mga0sz30_41844_c1_928_1170 80
558 3300050516 nmdc:mga0sz30_4363_c1 nmdc:mga0sz30_4363_c1_3515_3757 80
559 3300053077 Ga0495601_0111128 Ga0495601_0111128_298_540 80
560 3300053084 Ga0495595_0017581 Ga0495595_0017581_1743_1985 80
561 3300053085 Ga0495619_0073814 Ga0495619_0073814_64_306 80
562 3300053085 Ga0495619_0311177 Ga0495619_0311177_221_463 80
563 3300053091 Ga0500647_0029848 Ga0500647_0029848_1257_1499 80
564 3300053093 Ga0500651_0758677 Ga0500651_0758677_113_355 80
565 3300053096 Ga0500641_0001470 Ga0500641_0001470_409_651 80
566 3300053130 Ga0500642_0423081 Ga0500642_0423081_278_520 80
567 3300053153 Ga0500616_0003394 Ga0500616_0003394_466_708 80
568 3300059511 Ga0587091_124129 Ga0587091_124129_105_347 80

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

2

82

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zny-assembly2.cif.gz_C crystal structure of the ffrp 0.6537 1 79
2bxj-assembly2.cif.gz_B double mutant of the ribosomal protein s6 0.6533 1 80
2bxj-assembly2.cif.gz_B double mutant of the ribosomal protein s6 0.6465 1 80
7p7r-assembly1.cif.gz_g poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state i 0.6409 1 80
6zi1-assembly1.cif.gz_AAA crystal structure of the isolated h. influenzae vapd toxin (d7n mutant) 0.637 1 80
ID Description Score Start End Superfamily
2cyyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6464 2 80 3.30.70.920
af_P10869_349_504_3.30.2130.10 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.6312 2 77 3.30.2130.10
4pquC02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.6211 2 70 3.30.70.270
af_P9WH31_1_96_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.6164 2 77 3.30.70.60
2hiyB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.6136 2 77 3.30.70.1280
ID Description Score Start End GO Terms
AF-A0A259UYU5-F1-model_v4 deleted 0.6795 2 78
AF-A0A410JU04-F1-model_v4 Uncharacterized protein 0.6691 1 76
AF-A0A1I2BUA9-F1-model_v4 Uncharacterized protein 0.6607 2 80 GO:0016020
AF-A0A259UYU5-F1-model_v4 deleted 0.6539 2 78
AF-A0A1I2BUA9-F1-model_v4 Uncharacterized protein 0.6481 2 80 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.04 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map