F464634
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 568 | 313 | 557 | 79 |
Family's Representative Sequence
| Representative Sequence | 3300025291|Ga0209675_1000985|Ga0209675_100098514 |
| Length | 84 |
| Sequence | MKARVHVSLKNGVLDPQGKAIGHALHGLGFKDVADVRQGKLIELELTGALASKPKAEIEAAVKEMAQKLLANTVIENFSVELVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 3 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 4 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 5 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 6 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 7 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 8 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 9 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 10 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 11 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 117 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 118 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 121 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 237 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 275 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 303 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 304 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 307 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.3 |
| Metatranscriptomes | 1.76 |
| Isolates | 1.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.85 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 80.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F7QKVOU01BQGDU | 2088090003 | Bacteria | 503 |
| 2 | JGI25406J46586_10044658 | 3300003203 | Bacteria | 1532 |
| 3 | Ga0058863_11645915 | 3300004799 | Bacteria | 512 |
| 4 | Ga0065704_10391639 | 3300005289 | Bacteria | 762 |
| 5 | Ga0070658_10008327 | 3300005327 | Bacteria | 8339 |
| 6 | Ga0070658_10034663 | 3300005327 | Bacteria | 4061 |
| 7 | Ga0070676_10616048 | 3300005328 | Bacteria | 784 |
| 8 | Ga0070676_11475455 | 3300005328 | Unclassified | 523 |
| 9 | Ga0070683_100085043 | 3300005329 | Bacteria | 2964 |
| 10 | Ga0070683_100730207 | 3300005329 | Bacteria | 949 |
| 11 | Ga0070690_100673912 | 3300005330 | Bacteria | 792 |
| 12 | Ga0070680_100015841 | 3300005336 | Bacteria | 5918 |
| 13 | Ga0070680_100466763 | 3300005336 | Bacteria | 1079 |
| 14 | Ga0070682_101432808 | 3300005337 | Bacteria | 592 |
| 15 | Ga0068868_100099235 | 3300005338 | Bacteria | 2355 |
| 16 | Ga0068868_102209838 | 3300005338 | Bacteria | 524 |
| 17 | Ga0070660_100014637 | 3300005339 | Bacteria | 5659 |
| 18 | Ga0070660_100291403 | 3300005339 | Bacteria | 1337 |
| 19 | Ga0070691_10015649 | 3300005341 | Bacteria | 3484 |
| 20 | Ga0070661_100060490 | 3300005344 | Bacteria | 2779 |
| 21 | Ga0070668_101734544 | 3300005347 | Bacteria | 574 |
| 22 | Ga0070669_101202777 | 3300005353 | Bacteria | 655 |
| 23 | Ga0070675_101670677 | 3300005354 | Bacteria | 588 |
| 24 | Ga0070674_100202871 | 3300005356 | Bacteria | 1532 |
| 25 | Ga0070674_101516461 | 3300005356 | Bacteria | 603 |
| 26 | Ga0070673_101892796 | 3300005364 | Bacteria | 566 |
| 27 | Ga0070673_102229601 | 3300005364 | Bacteria | 520 |
| 28 | Ga0070659_100028695 | 3300005366 | Bacteria | 4299 |
| 29 | Ga0070709_10028618 | 3300005434 | Bacteria | 3325 |
| 30 | Ga0070714_100004146 | 3300005435 | Bacteria | 10891 |
| 31 | Ga0070713_100000939 | 3300005436 | Bacteria | 18616 |
| 32 | Ga0070713_100086246 | 3300005436 | Bacteria | 2692 |
| 33 | Ga0070713_100352912 | 3300005436 | Bacteria | 1365 |
| 34 | Ga0070713_101082232 | 3300005436 | Bacteria | 775 |
| 35 | Ga0070710_10053020 | 3300005437 | Bacteria | 2283 |
| 36 | Ga0070701_10687886 | 3300005438 | Bacteria | 687 |
| 37 | Ga0070711_100008941 | 3300005439 | Bacteria | 6150 |
| 38 | Ga0070705_101254033 | 3300005440 | Bacteria | 613 |
| 39 | Ga0070700_101821374 | 3300005441 | Bacteria | 525 |
| 40 | Ga0070700_101892594 | 3300005441 | Bacteria | 515 |
| 41 | Ga0070694_101537726 | 3300005444 | Bacteria | 564 |
| 42 | Ga0070663_100048820 | 3300005455 | Bacteria | 3003 |
| 43 | Ga0070663_100182298 | 3300005455 | Bacteria | 1630 |
| 44 | Ga0070678_100044838 | 3300005456 | Bacteria | 3160 |
| 45 | Ga0070662_100521666 | 3300005457 | Bacteria | 993 |
| 46 | Ga0070662_100815435 | 3300005457 | Bacteria | 794 |
| 47 | Ga0070681_10029061 | 3300005458 | Bacteria | 5550 |
| 48 | Ga0070681_10667553 | 3300005458 | Bacteria | 955 |
| 49 | Ga0070681_10813433 | 3300005458 | Bacteria | 852 |
| 50 | Ga0070681_11101739 | 3300005458 | Bacteria | 715 |
| 51 | Ga0070706_100347490 | 3300005467 | Bacteria | 1382 |
| 52 | Ga0070706_101484978 | 3300005467 | Bacteria | 620 |
| 53 | Ga0070699_100057798 | 3300005518 | Bacteria | 3359 |
| 54 | Ga0070679_100002889 | 3300005530 | Bacteria | 15609 |
| 55 | Ga0070679_101188516 | 3300005530 | Bacteria | 708 |
| 56 | Ga0070684_100102560 | 3300005535 | Bacteria | 2558 |
| 57 | Ga0070684_100585366 | 3300005535 | Bacteria | 1037 |
| 58 | Ga0070684_100915793 | 3300005535 | Bacteria | 822 |
| 59 | Ga0070697_100072310 | 3300005536 | Bacteria | 2830 |
| 60 | Ga0068853_100002194 | 3300005539 | Bacteria | 14566 |
| 61 | Ga0068853_100032562 | 3300005539 | Bacteria | 4416 |
| 62 | Ga0068853_100989297 | 3300005539 | Bacteria | 809 |
| 63 | Ga0070695_100122969 | 3300005545 | Bacteria | 1778 |
| 64 | Ga0070696_101371951 | 3300005546 | Bacteria | 602 |
| 65 | Ga0070693_101619699 | 3300005547 | Bacteria | 509 |
| 66 | Ga0070665_100039027 | 3300005548 | Bacteria | 4775 |
| 67 | Ga0070665_100044210 | 3300005548 | Bacteria | 4473 |
| 68 | Ga0070665_100493404 | 3300005548 | Bacteria | 1236 |
| 69 | Ga0070665_101267069 | 3300005548 | Bacteria | 747 |
| 70 | Ga0068855_100094201 | 3300005563 | Bacteria | 3453 |
| 71 | Ga0068855_100097061 | 3300005563 | Bacteria | 3394 |
| 72 | Ga0068855_100129089 | 3300005563 | Bacteria | 2888 |
| 73 | Ga0068855_100208652 | 3300005563 | Bacteria | 2196 |
| 74 | Ga0068855_100214721 | 3300005563 | Bacteria | 2160 |
| 75 | Ga0068855_100511763 | 3300005563 | Bacteria | 1303 |
| 76 | Ga0070664_100022461 | 3300005564 | Bacteria | 5201 |
| 77 | Ga0070664_100333366 | 3300005564 | Bacteria | 1377 |
| 78 | Ga0068857_100041147 | 3300005577 | Bacteria | 4098 |
| 79 | Ga0068857_100404447 | 3300005577 | Bacteria | 1271 |
| 80 | Ga0068857_100831884 | 3300005577 | Bacteria | 883 |
| 81 | Ga0068857_100946225 | 3300005577 | Bacteria | 827 |
| 82 | Ga0068854_100003320 | 3300005578 | Bacteria | 10024 |
| 83 | Ga0068854_100024710 | 3300005578 | Bacteria | 4117 |
| 84 | Ga0068854_102288845 | 3300005578 | Bacteria | 501 |
| 85 | Ga0068856_100025379 | 3300005614 | Bacteria | 5779 |
| 86 | Ga0068856_100072854 | 3300005614 | Bacteria | 3401 |
| 87 | Ga0068856_100199632 | 3300005614 | Bacteria | 2015 |
| 88 | Ga0068856_100219317 | 3300005614 | Bacteria | 1917 |
| 89 | Ga0068856_100234683 | 3300005614 | Bacteria | 1850 |
| 90 | Ga0068856_100515395 | 3300005614 | Bacteria | 1217 |
| 91 | Ga0068856_101100017 | 3300005614 | Bacteria | 812 |
| 92 | Ga0068852_100003488 | 3300005616 | Bacteria | 10996 |
| 93 | Ga0068852_100007647 | 3300005616 | Bacteria | 7903 |
| 94 | Ga0068852_100013493 | 3300005616 | Bacteria | 6254 |
| 95 | Ga0068859_100181338 | 3300005617 | Bacteria | 2188 |
| 96 | Ga0068864_100258895 | 3300005618 | Bacteria | 1618 |
| 97 | Ga0068864_100511379 | 3300005618 | Bacteria | 1157 |
| 98 | Ga0068851_10001935 | 3300005834 | Bacteria | 9099 |
| 99 | Ga0068870_10678248 | 3300005840 | Bacteria | 709 |
| 100 | Ga0068863_100292262 | 3300005841 | Bacteria | 1580 |
| 101 | Ga0068863_101064418 | 3300005841 | Bacteria | 813 |
| 102 | Ga0068858_102327032 | 3300005842 | Bacteria | 530 |
| 103 | Ga0068860_101507793 | 3300005843 | Bacteria | 694 |
| 104 | Ga0081455_10000434 | 3300005937 | Bacteria | 54939 |
| 105 | Ga0081455_10002143 | 3300005937 | Bacteria | 23543 |
| 106 | Ga0081538_10031628 | 3300005981 | Bacteria | 3564 |
| 107 | Ga0081539_10009772 | 3300005985 | Bacteria | 7934 |
| 108 | Ga0081539_10011462 | 3300005985 | Bacteria | 7001 |
| 109 | Ga0081539_10019052 | 3300005985 | Bacteria | 4721 |
| 110 | Ga0075365_10029237 | 3300006038 | Bacteria | 3520 |
| 111 | Ga0075365_10326099 | 3300006038 | Bacteria | 1081 |
| 112 | Ga0075365_10346649 | 3300006038 | Bacteria | 1047 |
| 113 | Ga0075365_10916917 | 3300006038 | Bacteria | 618 |
| 114 | Ga0075365_11126589 | 3300006038 | Bacteria | 552 |
| 115 | Ga0075368_10126789 | 3300006042 | Bacteria | 1059 |
| 116 | Ga0075363_100033775 | 3300006048 | Bacteria | 2667 |
| 117 | Ga0075363_100056901 | 3300006048 | Bacteria | 2097 |
| 118 | Ga0075364_10024791 | 3300006051 | Bacteria | 3812 |
| 119 | Ga0075364_10256115 | 3300006051 | Bacteria | 1189 |
| 120 | Ga0075364_10296770 | 3300006051 | Bacteria | 1100 |
| 121 | Ga0075364_10332005 | 3300006051 | Bacteria | 1036 |
| 122 | Ga0075364_11077529 | 3300006051 | Bacteria | 546 |
| 123 | Ga0075432_10374250 | 3300006058 | Bacteria | 609 |
| 124 | Ga0070715_10579026 | 3300006163 | Bacteria | 655 |
| 125 | Ga0070716_100063676 | 3300006173 | Bacteria | 2142 |
| 126 | Ga0070712_100000779 | 3300006175 | Bacteria | 18831 |
| 127 | Ga0070712_100812336 | 3300006175 | Bacteria | 803 |
| 128 | Ga0075362_10007197 | 3300006177 | Bacteria | 4199 |
| 129 | Ga0075362_10029282 | 3300006177 | Bacteria | 2372 |
| 130 | Ga0075362_10052564 | 3300006177 | Bacteria | 1826 |
| 131 | Ga0075362_10127471 | 3300006177 | Bacteria | 1208 |
| 132 | Ga0075362_10190704 | 3300006177 | Bacteria | 995 |
| 133 | Ga0075362_10297494 | 3300006177 | Bacteria | 800 |
| 134 | Ga0075367_10019329 | 3300006178 | Bacteria | 3777 |
| 135 | Ga0075367_10206897 | 3300006178 | Bacteria | 1227 |
| 136 | Ga0075369_10000336 | 3300006186 | Bacteria | 14025 |
| 137 | Ga0075369_10058572 | 3300006186 | Bacteria | 1677 |
| 138 | Ga0075369_10236628 | 3300006186 | Bacteria | 847 |
| 139 | Ga0075369_10446792 | 3300006186 | Bacteria | 612 |
| 140 | Ga0075366_10013866 | 3300006195 | Bacteria | 4594 |
| 141 | Ga0075366_10091553 | 3300006195 | Bacteria | 1821 |
| 142 | Ga0075366_10188225 | 3300006195 | Bacteria | 1254 |
| 143 | Ga0097621_100164766 | 3300006237 | Bacteria | 1908 |
| 144 | Ga0075370_10934287 | 3300006353 | Bacteria | 531 |
| 145 | Ga0097620_100181331 | 3300006931 | Bacteria | 2188 |
| 146 | Ga0099794_10351138 | 3300007265 | Bacteria | 767 |
| 147 | Ga0099795_10417585 | 3300007788 | Bacteria | 612 |
| 148 | Ga0105240_10158518 | 3300009093 | Bacteria | 2690 |
| 149 | Ga0105240_10346169 | 3300009093 | Bacteria | 1687 |
| 150 | Ga0105240_10391683 | 3300009093 | Bacteria | 1567 |
| 151 | Ga0111539_10544564 | 3300009094 | Bacteria | 1352 |
| 152 | Ga0105245_10483539 | 3300009098 | Bacteria | 1252 |
| 153 | Ga0105245_11381971 | 3300009098 | Bacteria | 754 |
| 154 | Ga0105245_11657140 | 3300009098 | Bacteria | 692 |
| 155 | Ga0105245_13111524 | 3300009098 | Bacteria | 514 |
| 156 | Ga0105247_11036065 | 3300009101 | Bacteria | 643 |
| 157 | Ga0114129_11331828 | 3300009147 | Bacteria | 889 |
| 158 | Ga0114129_12334845 | 3300009147 | Bacteria | 641 |
| 159 | Ga0114129_12531245 | 3300009147 | Bacteria | 613 |
| 160 | Ga0105243_10549941 | 3300009148 | Bacteria | 1103 |
| 161 | Ga0105243_11226887 | 3300009148 | Bacteria | 764 |
| 162 | Ga0105243_11602529 | 3300009148 | Bacteria | 678 |
| 163 | Ga0105241_10037479 | 3300009174 | Bacteria | 3653 |
| 164 | Ga0105241_10071407 | 3300009174 | Bacteria | 2695 |
| 165 | Ga0105242_10742254 | 3300009176 | Bacteria | 965 |
| 166 | Ga0105242_12236310 | 3300009176 | Bacteria | 592 |
| 167 | Ga0105248_12291157 | 3300009177 | Bacteria | 615 |
| 168 | Ga0105237_10041468 | 3300009545 | Bacteria | 4642 |
| 169 | Ga0105237_11585720 | 3300009545 | Bacteria | 661 |
| 170 | Ga0105237_12602580 | 3300009545 | Bacteria | 517 |
| 171 | Ga0105238_10035940 | 3300009551 | Bacteria | 5036 |
| 172 | Ga0105238_10172179 | 3300009551 | Bacteria | 2141 |
| 173 | Ga0105238_10676007 | 3300009551 | Bacteria | 1044 |
| 174 | Ga0105238_11190233 | 3300009551 | Bacteria | 786 |
| 175 | Ga0105035_128506 | 3300009988 | Bacteria | 542 |
| 176 | Ga0099796_10184441 | 3300010159 | Bacteria | 839 |
| 177 | Ga0099796_10248679 | 3300010159 | Bacteria | 738 |
| 178 | Ga0105239_10025681 | 3300010375 | Bacteria | 6487 |
| 179 | Ga0105239_10695661 | 3300010375 | Bacteria | 1162 |
| 180 | Ga0105246_11833480 | 3300011119 | Bacteria | 580 |
| 181 | Ga0157314_1042027 | 3300012500 | Bacteria | 556 |
| 182 | Ga0157373_10137675 | 3300013100 | Bacteria | 1717 |
| 183 | Ga0157371_10009845 | 3300013102 | Bacteria | 7489 |
| 184 | Ga0157370_10009458 | 3300013104 | Bacteria | 10410 |
| 185 | Ga0157370_10022575 | 3300013104 | Bacteria | 6262 |
| 186 | Ga0157370_10076887 | 3300013104 | Bacteria | 3144 |
| 187 | Ga0157370_10589434 | 3300013104 | Bacteria | 1018 |
| 188 | Ga0157370_11831837 | 3300013104 | Bacteria | 544 |
| 189 | Ga0157378_10231632 | 3300013297 | Bacteria | 1760 |
| 190 | Ga0157378_11260453 | 3300013297 | Bacteria | 780 |
| 191 | Ga0157378_11359364 | 3300013297 | Bacteria | 752 |
| 192 | Ga0163162_10783964 | 3300013306 | Bacteria | 1071 |
| 193 | Ga0163162_11594950 | 3300013306 | Bacteria | 744 |
| 194 | Ga0157372_10842844 | 3300013307 | Bacteria | 1064 |
| 195 | Ga0157372_11828603 | 3300013307 | Bacteria | 698 |
| 196 | Ga0157372_11891280 | 3300013307 | Bacteria | 686 |
| 197 | Ga0157375_11275147 | 3300013308 | Bacteria | 863 |
| 198 | Ga0157375_13761565 | 3300013308 | Bacteria | 504 |
| 199 | Ga0163163_10134983 | 3300014325 | Bacteria | 2508 |
| 200 | Ga0163163_11812798 | 3300014325 | Bacteria | 670 |
| 201 | Ga0163163_12278755 | 3300014325 | Bacteria | 600 |
| 202 | Ga0157380_11269710 | 3300014326 | Bacteria | 783 |
| 203 | Ga0157380_12726352 | 3300014326 | Bacteria | 561 |
| 204 | Ga0182008_10019469 | 3300014497 | Bacteria | 3502 |
| 205 | Ga0182008_10075655 | 3300014497 | Bacteria | 1656 |
| 206 | Ga0157379_10960899 | 3300014968 | Bacteria | 813 |
| 207 | Ga0157379_11175648 | 3300014968 | Bacteria | 737 |
| 208 | Ga0157376_11228135 | 3300014969 | Unclassified | 778 |
| 209 | Ga0157376_11417293 | 3300014969 | Bacteria | 727 |
| 210 | Ga0206356_11886213 | 3300020070 | Bacteria | 559 |
| 211 | Ga0206355_1135818 | 3300020076 | Bacteria | 567 |
| 212 | Ga0213873_10004937 | 3300021358 | Bacteria | 2522 |
| 213 | Ga0213872_10272679 | 3300021361 | Bacteria | 708 |
| 214 | Ga0213872_10417208 | 3300021361 | Bacteria | 542 |
| 215 | Ga0213875_10028110 | 3300021388 | Bacteria | 2674 |
| 216 | Ga0213875_10152381 | 3300021388 | Bacteria | 1083 |
| 217 | Ga0213871_10006183 | 3300021441 | Bacteria | 2520 |
| 218 | Ga0213871_10018139 | 3300021441 | Bacteria | 1718 |
| 219 | Ga0209675_1000985 | 3300025291 | Bacteria | 18017 |
| 220 | Ga0209676_1087330 | 3300025292 | Bacteria | 694 |
| 221 | Ga0207656_10000887 | 3300025321 | Bacteria | 9763 |
| 222 | Ga0207647_10568001 | 3300025904 | Bacteria | 628 |
| 223 | Ga0207685_10405396 | 3300025905 | Bacteria | 700 |
| 224 | Ga0207685_10645224 | 3300025905 | Bacteria | 572 |
| 225 | Ga0207699_10013245 | 3300025906 | Bacteria | 4216 |
| 226 | Ga0207645_10771443 | 3300025907 | Bacteria | 654 |
| 227 | Ga0207643_10429658 | 3300025908 | Bacteria | 838 |
| 228 | Ga0207705_10041156 | 3300025909 | Bacteria | 3314 |
| 229 | Ga0207705_10053858 | 3300025909 | Bacteria | 2899 |
| 230 | Ga0207684_10333564 | 3300025910 | Bacteria | 1306 |
| 231 | Ga0207684_10632928 | 3300025910 | Bacteria | 912 |
| 232 | Ga0207654_10188307 | 3300025911 | Bacteria | 1351 |
| 233 | Ga0207654_10221032 | 3300025911 | Bacteria | 1256 |
| 234 | Ga0207654_10288492 | 3300025911 | Bacteria | 1112 |
| 235 | Ga0207707_10013882 | 3300025912 | Bacteria | 7024 |
| 236 | Ga0207707_10520344 | 3300025912 | Bacteria | 1013 |
| 237 | Ga0207707_10661188 | 3300025912 | Bacteria | 880 |
| 238 | Ga0207707_10866874 | 3300025912 | Bacteria | 748 |
| 239 | Ga0207695_10067173 | 3300025913 | Bacteria | 3679 |
| 240 | Ga0207695_10119337 | 3300025913 | Bacteria | 2607 |
| 241 | Ga0207695_10249637 | 3300025913 | Bacteria | 1674 |
| 242 | Ga0207671_11182681 | 3300025914 | Bacteria | 599 |
| 243 | Ga0207693_10011626 | 3300025915 | Bacteria | 7122 |
| 244 | Ga0207693_10375123 | 3300025915 | Bacteria | 1113 |
| 245 | Ga0207663_11464526 | 3300025916 | Bacteria | 550 |
| 246 | Ga0207660_10461161 | 3300025917 | Bacteria | 1028 |
| 247 | Ga0207657_10026748 | 3300025919 | Bacteria | 5295 |
| 248 | Ga0207657_10252473 | 3300025919 | Bacteria | 1405 |
| 249 | Ga0207657_11406431 | 3300025919 | Bacteria | 524 |
| 250 | Ga0207649_10025971 | 3300025920 | Bacteria | 3421 |
| 251 | Ga0207649_10037683 | 3300025920 | Bacteria | 2922 |
| 252 | Ga0207652_10027622 | 3300025921 | Bacteria | 4729 |
| 253 | Ga0207681_10070672 | 3300025923 | Bacteria | 2432 |
| 254 | Ga0207694_10019272 | 3300025924 | Bacteria | 5158 |
| 255 | Ga0207694_10242155 | 3300025924 | Bacteria | 1474 |
| 256 | Ga0207694_10346764 | 3300025924 | Bacteria | 1229 |
| 257 | Ga0207694_11259872 | 3300025924 | Bacteria | 625 |
| 258 | Ga0207687_11074604 | 3300025927 | Bacteria | 691 |
| 259 | Ga0207687_11588566 | 3300025927 | Bacteria | 561 |
| 260 | Ga0207700_10003857 | 3300025928 | Bacteria | 8757 |
| 261 | Ga0207664_10008762 | 3300025929 | Bacteria | 7075 |
| 262 | Ga0207664_10808971 | 3300025929 | Bacteria | 843 |
| 263 | Ga0207690_10208686 | 3300025932 | Bacteria | 1488 |
| 264 | Ga0207690_10299649 | 3300025932 | Bacteria | 1257 |
| 265 | Ga0207706_10110350 | 3300025933 | Bacteria | 2420 |
| 266 | Ga0207706_10434146 | 3300025933 | Bacteria | 1137 |
| 267 | Ga0207709_10307807 | 3300025935 | Bacteria | 1181 |
| 268 | Ga0207669_11150379 | 3300025937 | Bacteria | 656 |
| 269 | Ga0207669_11407244 | 3300025937 | Bacteria | 594 |
| 270 | Ga0207665_10073547 | 3300025939 | Bacteria | 2337 |
| 271 | Ga0207665_10418843 | 3300025939 | Bacteria | 1023 |
| 272 | Ga0207665_10509987 | 3300025939 | Bacteria | 930 |
| 273 | Ga0207691_10161690 | 3300025940 | Bacteria | 1964 |
| 274 | Ga0207711_11854714 | 3300025941 | Bacteria | 546 |
| 275 | Ga0207689_10535312 | 3300025942 | Bacteria | 983 |
| 276 | Ga0207661_10529855 | 3300025944 | Bacteria | 1078 |
| 277 | Ga0207661_11188547 | 3300025944 | Bacteria | 702 |
| 278 | Ga0207679_10229242 | 3300025945 | Bacteria | 1567 |
| 279 | Ga0207679_11798340 | 3300025945 | Bacteria | 560 |
| 280 | Ga0207667_10002364 | 3300025949 | Bacteria | 23627 |
| 281 | Ga0207667_10057735 | 3300025949 | Bacteria | 4073 |
| 282 | Ga0207667_10070173 | 3300025949 | Bacteria | 3647 |
| 283 | Ga0207667_10274714 | 3300025949 | Bacteria | 1723 |
| 284 | Ga0207667_11688995 | 3300025949 | Bacteria | 600 |
| 285 | Ga0207712_11032831 | 3300025961 | Bacteria | 730 |
| 286 | Ga0207640_10003952 | 3300025981 | Bacteria | 8000 |
| 287 | Ga0207640_10118464 | 3300025981 | Bacteria | 1892 |
| 288 | Ga0207640_10236048 | 3300025981 | Bacteria | 1410 |
| 289 | Ga0207677_10129927 | 3300026023 | Bacteria | 1911 |
| 290 | Ga0207703_11851107 | 3300026035 | Bacteria | 580 |
| 291 | Ga0207639_10010460 | 3300026041 | Bacteria | 6428 |
| 292 | Ga0207639_10125442 | 3300026041 | Bacteria | 2116 |
| 293 | Ga0207639_10673112 | 3300026041 | Bacteria | 958 |
| 294 | Ga0207639_10788323 | 3300026041 | Bacteria | 885 |
| 295 | Ga0207639_11786630 | 3300026041 | Bacteria | 575 |
| 296 | Ga0207678_10152286 | 3300026067 | Bacteria | 1975 |
| 297 | Ga0207678_11448653 | 3300026067 | Bacteria | 607 |
| 298 | Ga0207708_11118276 | 3300026075 | Bacteria | 687 |
| 299 | Ga0207702_10017610 | 3300026078 | Bacteria | 5911 |
| 300 | Ga0207702_10156439 | 3300026078 | Bacteria | 2078 |
| 301 | Ga0207702_10166638 | 3300026078 | Bacteria | 2016 |
| 302 | Ga0207702_10179401 | 3300026078 | Bacteria | 1949 |
| 303 | Ga0207702_10264461 | 3300026078 | Bacteria | 1621 |
| 304 | Ga0207702_10494373 | 3300026078 | Bacteria | 1192 |
| 305 | Ga0207702_12454450 | 3300026078 | Bacteria | 508 |
| 306 | Ga0207648_10569288 | 3300026089 | Bacteria | 1042 |
| 307 | Ga0207648_11637745 | 3300026089 | Bacteria | 605 |
| 308 | Ga0207676_12438304 | 3300026095 | Bacteria | 520 |
| 309 | Ga0207674_10017245 | 3300026116 | Bacteria | 7877 |
| 310 | Ga0207674_10032698 | 3300026116 | Bacteria | 5453 |
| 311 | Ga0207674_10192431 | 3300026116 | Bacteria | 1990 |
| 312 | Ga0207674_10330282 | 3300026116 | Bacteria | 1475 |
| 313 | Ga0207675_100537358 | 3300026118 | Bacteria | 1167 |
| 314 | Ga0207683_10069539 | 3300026121 | Bacteria | 3109 |
| 315 | Ga0207683_10630963 | 3300026121 | Bacteria | 992 |
| 316 | Ga0207698_10002528 | 3300026142 | Bacteria | 10858 |
| 317 | Ga0207698_10574496 | 3300026142 | Bacteria | 1108 |
| 318 | Ga0209813_10158147 | 3300027866 | Bacteria | 816 |
| 319 | Ga0268266_10186323 | 3300028379 | Bacteria | 1892 |
| 320 | Ga0268266_10346541 | 3300028379 | Bacteria | 1395 |
| 321 | Ga0268266_10590099 | 3300028379 | Bacteria | 1067 |
| 322 | Ga0268266_11693129 | 3300028379 | Bacteria | 608 |
| 323 | Ga0268265_10887224 | 3300028380 | Bacteria | 875 |
| 324 | Ga0265334_10041312 | 3300028573 | Bacteria | 1803 |
| 325 | Ga0307517_10445086 | 3300028786 | Bacteria | 673 |
| 326 | Ga0265338_10114946 | 3300028800 | Bacteria | 2158 |
| 327 | Ga0265324_10053599 | 3300029957 | Bacteria | 1385 |
| 328 | Ga0307511_10213818 | 3300030521 | Bacteria | 980 |
| 329 | Ga0265330_10024058 | 3300031235 | Bacteria | 2763 |
| 330 | Ga0265325_10056673 | 3300031241 | Bacteria | 2000 |
| 331 | Ga0265329_10102590 | 3300031242 | Bacteria | 911 |
| 332 | Ga0265329_10230058 | 3300031242 | Bacteria | 615 |
| 333 | Ga0265340_10137109 | 3300031247 | Bacteria | 1120 |
| 334 | Ga0265339_10000397 | 3300031249 | Bacteria | 34367 |
| 335 | Ga0265316_10086402 | 3300031344 | Bacteria | 2398 |
| 336 | Ga0265313_10000032 | 3300031595 | Bacteria | 128964 |
| 337 | Ga0307405_10064977 | 3300031731 | Bacteria | 2321 |
| 338 | Ga0307406_10193302 | 3300031901 | Bacteria | 1492 |
| 339 | Ga0307406_10786535 | 3300031901 | Bacteria | 802 |
| 340 | Ga0307412_10881190 | 3300031911 | Bacteria | 783 |
| 341 | Ga0307409_100078824 | 3300031995 | Bacteria | 2652 |
| 342 | Ga0307409_102370051 | 3300031995 | Bacteria | 560 |
| 343 | Ga0307416_100635065 | 3300032002 | Bacteria | 1151 |
| 344 | Ga0307414_10588054 | 3300032004 | Bacteria | 997 |
| 345 | Ga0307414_10637001 | 3300032004 | Bacteria | 960 |
| 346 | Ga0307411_11778026 | 3300032005 | Bacteria | 572 |
| 347 | Ga0307415_100391663 | 3300032126 | Bacteria | 1183 |
| 348 | Ga0373930_0020161 | 3300034816 | Bacteria | 1298 |
| 349 | Ga0373928_0049987 | 3300035084 | Bacteria | 985 |
| 350 | Ga0373928_0263474 | 3300035084 | Bacteria | 517 |
| 351 | Ga0373929_0179325 | 3300035085 | Bacteria | 583 |
| 352 | Ga0373934_0028064 | 3300035086 | Bacteria | 2191 |
| 353 | Ga0373940_0065355 | 3300035088 | Bacteria | 1049 |
| 354 | Ga0373923_0119568 | 3300035111 | Bacteria | 1176 |
| 355 | Ga0373923_0254675 | 3300035111 | Bacteria | 822 |
| 356 | Ga0373932_0229769 | 3300035112 | Bacteria | 670 |
| 357 | Ga0373936_0131550 | 3300035113 | Bacteria | 1076 |
| 358 | Ga0373939_0127742 | 3300035114 | Bacteria | 904 |
| 359 | Ga0373941_0155144 | 3300035115 | Bacteria | 843 |
| 360 | Ga0373941_0166525 | 3300035115 | Bacteria | 819 |
| 361 | Ga0373945_0193558 | 3300035116 | Bacteria | 842 |
| 362 | Ga0373953_0118550 | 3300035117 | Bacteria | 1123 |
| 363 | Ga0373943_0124147 | 3300035170 | Bacteria | 1375 |
| 364 | Ga0373943_0323040 | 3300035170 | Bacteria | 880 |
| 365 | Ga0373943_0326197 | 3300035170 | Bacteria | 876 |
| 366 | Ga0373946_0111286 | 3300035171 | Bacteria | 1240 |
| 367 | Ga0373955_0009610 | 3300035172 | Bacteria | 4539 |
| 368 | Ga0373955_0108703 | 3300035172 | Bacteria | 1601 |
| 369 | Ga0373955_0164251 | 3300035172 | Bacteria | 1312 |
| 370 | Ga0373955_0740259 | 3300035172 | Bacteria | 604 |
| 371 | Ga0373924_0062969 | 3300035410 | Bacteria | 1554 |
| 372 | Ga0373931_1088462 | 3300035691 | Bacteria | 544 |
| 373 | Ga0373935_0059605 | 3300035692 | Bacteria | 2440 |
| 374 | Ga0373935_0373484 | 3300035692 | Bacteria | 1020 |
| 375 | Ga0373935_0508271 | 3300035692 | Bacteria | 875 |
| 376 | Ga0373935_0656545 | 3300035692 | Bacteria | 769 |
| 377 | Ga0373927_0098382 | 3300035695 | Bacteria | 1902 |
| 378 | Ga0373927_0360830 | 3300035695 | Bacteria | 958 |
| 379 | Ga0373927_0622732 | 3300035695 | Bacteria | 713 |
| 380 | Ga0373927_0947623 | 3300035695 | Bacteria | 568 |
| 381 | Ga0373933_0001236 | 3300035724 | Bacteria | 15103 |
| 382 | Ga0373947_0024924 | 3300035725 | Bacteria | 3488 |
| 383 | Ga0373947_0064341 | 3300035725 | Bacteria | 2236 |
| 384 | Ga0373947_0335811 | 3300035725 | Bacteria | 1012 |
| 385 | Ga0373947_0446030 | 3300035725 | Bacteria | 876 |
| 386 | Ga0373937_0005149 | 3300036401 | Bacteria | 11147 |
| 387 | Ga0373937_0010008 | 3300036401 | Bacteria | 8269 |
| 388 | Ga0373937_0257543 | 3300036401 | Bacteria | 1645 |
| 389 | Ga0373925_0023574 | 3300037068 | Bacteria | 4491 |
| 390 | Ga0373925_0044845 | 3300037068 | Bacteria | 3283 |
| 391 | Ga0373925_0236845 | 3300037068 | Bacteria | 1461 |
| 392 | Ga0373925_0768771 | 3300037068 | Bacteria | 794 |
| 393 | Ga0395899_0027167 | 3300037312 | Bacteria | 4317 |
| 394 | Ga0395899_0178224 | 3300037312 | Bacteria | 1493 |
| 395 | Ga0395899_0314503 | 3300037312 | Bacteria | 1056 |
| 396 | Ga0395899_0691402 | 3300037312 | Bacteria | 640 |
| 397 | Ga0395900_0035147 | 3300037418 | Bacteria | 5162 |
| 398 | Ga0395900_0102804 | 3300037418 | Bacteria | 2935 |
| 399 | Ga0395900_0468506 | 3300037418 | Bacteria | 1213 |
| 400 | Ga0395898_0016415 | 3300037466 | Bacteria | 7578 |
| 401 | Ga0395898_0717477 | 3300037466 | Bacteria | 941 |
| 402 | Ga0395905_1070902 | 3300037471 | Bacteria | 709 |
| 403 | Ga0436364_0191957 | 3300037853 | Bacteria | 809 |
| 404 | Ga0436364_0821358 | 3300037853 | Bacteria | 4845 |
| 405 | Ga0436364_1239827 | 3300037853 | Bacteria | 5018 |
| 406 | Ga0395901_0001851 | 3300038443 | Bacteria | 21879 |
| 407 | Ga0395901_0034540 | 3300038443 | Bacteria | 5222 |
| 408 | Ga0395901_0055930 | 3300038443 | Bacteria | 4104 |
| 409 | Ga0395901_0713111 | 3300038443 | Bacteria | 999 |
| 410 | Ga0436365_0151417 | 3300039437 | Bacteria | 1671 |
| 411 | Ga0436365_0414779 | 3300039437 | Bacteria | 621 |
| 412 | Ga0436365_1686548 | 3300039437 | Bacteria | 510 |
| 413 | Ga0436365_1694241 | 3300039437 | Bacteria | 625 |
| 414 | Ga0436360_0405006 | 3300039438 | Bacteria | 1319 |
| 415 | Ga0436360_0848685 | 3300039438 | Bacteria | 716 |
| 416 | Ga0436360_1256092 | 3300039438 | Bacteria | 1751 |
| 417 | Ga0436360_1286833 | 3300039438 | Bacteria | 2543 |
| 418 | Ga0436361_0305263 | 3300039447 | Bacteria | 1764 |
| 419 | Ga0436361_0767627 | 3300039447 | Bacteria | 2848 |
| 420 | Ga0436361_1163612 | 3300039447 | Bacteria | 1508 |
| 421 | Ga0436363_0563692 | 3300039450 | Bacteria | 1235 |
| 422 | Ga0436363_0811460 | 3300039450 | Bacteria | 539 |
| 423 | Ga0436363_0926035 | 3300039450 | Bacteria | 2661 |
| 424 | Ga0436362_0338910 | 3300039453 | Bacteria | 561 |
| 425 | Ga0436362_0509888 | 3300039453 | Bacteria | 4499 |
| 426 | Ga0451787_280404 | 3300041441 | Unclassified | 844 |
| 427 | Ga0451791_1235116 | 3300041451 | Bacteria | 563 |
| 428 | Ga0451798_0946080 | 3300041458 | Bacteria | 522 |
| 429 | Ga0451800_0272757 | 3300041459 | Bacteria | 592 |
| 430 | Ga0451802_1078191 | 3300041460 | Bacteria | 621 |
| 431 | Ga0451839_0008132 | 3300041496 | Bacteria | 521 |
| 432 | Ga0451853_3561479 | 3300041512 | Bacteria | 563 |
| 433 | Ga0439448_0093978 | 3300042005 | Bacteria | 1015 |
| 434 | Ga0439459_0035812 | 3300042438 | Bacteria | 1033 |
| 435 | Ga0439460_0091211 | 3300042461 | Bacteria | 969 |
| 436 | Ga0451577_1421430 | 3300042876 | Bacteria | 615 |
| 437 | Ga0453684_1471607 | 3300044712 | Bacteria | 704 |
| 438 | Ga0451576_0718372 | 3300045051 | Bacteria | 1050 |
| 439 | Ga0495592_0778519 | 3300046454 | Bacteria | 570 |
| 440 | Ga0495629_0754616 | 3300046459 | Bacteria | 644 |
| 441 | Ga0495651_0004432 | 3300046462 | Bacteria | 10760 |
| 442 | Ga0495653_0084595 | 3300046463 | Bacteria | 2336 |
| 443 | Ga0495639_0370691 | 3300046475 | Bacteria | 721 |
| 444 | Ga0495662_0500569 | 3300046476 | Bacteria | 596 |
| 445 | Ga0495583_0272368 | 3300046506 | Bacteria | 676 |
| 446 | Ga0495608_0070537 | 3300046511 | Bacteria | 2280 |
| 447 | Ga0495628_0539461 | 3300046516 | Bacteria | 839 |
| 448 | Ga0495630_0321925 | 3300046517 | Bacteria | 1182 |
| 449 | Ga0495640_0857988 | 3300046533 | Bacteria | 539 |
| 450 | Ga0495587_0014044 | 3300046536 | Bacteria | 5029 |
| 451 | Ga0495587_0297350 | 3300046536 | Bacteria | 903 |
| 452 | Ga0495645_0155119 | 3300046543 | Bacteria | 1587 |
| 453 | Ga0495645_0562672 | 3300046543 | Bacteria | 705 |
| 454 | Ga0495667_0081426 | 3300046559 | Bacteria | 2104 |
| 455 | Ga0495667_0247465 | 3300046559 | Bacteria | 1135 |
| 456 | Ga0495667_0310071 | 3300046559 | Bacteria | 999 |
| 457 | Ga0495668_0201172 | 3300046616 | Bacteria | 1091 |
| 458 | Ga0495635_0109208 | 3300046663 | Bacteria | 1890 |
| 459 | Ga0495635_0111009 | 3300046663 | Bacteria | 1873 |
| 460 | Ga0495635_0632346 | 3300046663 | Bacteria | 697 |
| 461 | Ga0495657_0134658 | 3300046675 | Bacteria | 1545 |
| 462 | Ga0495657_0152607 | 3300046675 | Bacteria | 1433 |
| 463 | Ga0495599_0164936 | 3300046678 | Bacteria | 1368 |
| 464 | Ga0495599_0521311 | 3300046678 | Bacteria | 698 |
| 465 | Ga0495623_0024082 | 3300046679 | Bacteria | 3927 |
| 466 | Ga0495646_0283135 | 3300046680 | Bacteria | 880 |
| 467 | Ga0495646_0444740 | 3300046680 | Bacteria | 670 |
| 468 | Ga0495646_0672880 | 3300046680 | Bacteria | 522 |
| 469 | Ga0495647_0586663 | 3300046681 | Bacteria | 523 |
| 470 | Ga0495671_0467038 | 3300046692 | Bacteria | 603 |
| 471 | Ga0495600_0022905 | 3300046809 | Bacteria | 4015 |
| 472 | Ga0495600_0226191 | 3300046809 | Bacteria | 1196 |
| 473 | Ga0495674_1176241 | 3300047319 | Bacteria | 581 |
| 474 | Ga0495680_0040284 | 3300047322 | Bacteria | 3723 |
| 475 | Ga0495675_0157551 | 3300047444 | Bacteria | 1399 |
| 476 | Ga0495675_0228621 | 3300047444 | Bacteria | 1123 |
| 477 | Ga0495684_0048400 | 3300047471 | Bacteria | 3251 |
| 478 | Ga0495684_0214123 | 3300047471 | Bacteria | 1415 |
| 479 | Ga0495602_0023216 | 3300048088 | Bacteria | 6050 |
| 480 | Ga0496102_0958949 | 3300048905 | Bacteria | 776 |
| 481 | Ga0496112_1461879 | 3300048915 | Bacteria | 598 |
| 482 | Ga0496113_1086356 | 3300048916 | Bacteria | 628 |
| 483 | Ga0496119_0003988 | 3300048922 | Bacteria | 14944 |
| 484 | Ga0496120_0080651 | 3300048923 | Bacteria | 1763 |
| 485 | Ga0496122_0067264 | 3300048925 | Bacteria | 2582 |
| 486 | Ga0501318_003228 | 3300049534 | Bacteria | 1481 |
| 487 | Ga0501032_0169566 | 3300049569 | Bacteria | 1432 |
| 488 | Ga0501033_0541758 | 3300049570 | Bacteria | 802 |
| 489 | Ga0501034_0017532 | 3300049571 | Bacteria | 7345 |
| 490 | Ga0501034_0037546 | 3300049571 | Bacteria | 4905 |
| 491 | Ga0501036_1708392 | 3300049572 | Bacteria | 507 |
| 492 | Ga0501039_1544209 | 3300049575 | Bacteria | 510 |
| 493 | Ga0501068_0140025 | 3300049584 | Bacteria | 1516 |
| 494 | Ga0501070_0685556 | 3300049586 | Bacteria | 811 |
| 495 | Ga0501070_0795355 | 3300049586 | Bacteria | 743 |
| 496 | Ga0501074_1044795 | 3300049590 | Bacteria | 574 |
| 497 | Ga0501074_1332310 | 3300049590 | Bacteria | 503 |
| 498 | Ga0501077_0270191 | 3300049593 | Bacteria | 1082 |
| 499 | Ga0501035_0744268 | 3300049822 | Bacteria | 787 |
| 500 | Ga0501044_0117070 | 3300049823 | Bacteria | 2669 |
| 501 | Ga0501044_1413941 | 3300049823 | Bacteria | 561 |
| 502 | nmdc:mga03683_121593_c1 | 3300050489 | Bacteria | 1161 |
| 503 | nmdc:mga03683_130026_c1 | 3300050489 | Bacteria | 1126 |
| 504 | nmdc:mga03683_17888_c1 | 3300050489 | Bacteria | 2688 |
| 505 | nmdc:mga03683_216721_c1 | 3300050489 | Bacteria | 882 |
| 506 | nmdc:mga03683_27877_c1 | 3300050489 | Bacteria | 2241 |
| 507 | nmdc:mga03683_47272_c1 | 3300050489 | Bacteria | 1785 |
| 508 | nmdc:mga03n38_192938_c1 | 3300050490 | Bacteria | 1050 |
| 509 | nmdc:mga03n38_42434_c1 | 3300050490 | Bacteria | 1988 |
| 510 | nmdc:mga03n38_82602_c1 | 3300050490 | Bacteria | 1513 |
| 511 | nmdc:mga03n38_964652_c1 | 3300050490 | Bacteria | 504 |
| 512 | nmdc:mga00v17_464594_c1 | 3300050491 | Bacteria | 821 |
| 513 | nmdc:mga00v17_961827_c1 | 3300050491 | Bacteria | 539 |
| 514 | nmdc:mga00v17_98512_c1 | 3300050491 | Bacteria | 1843 |
| 515 | nmdc:mga0yw44_11213_c1 | 3300050492 | Bacteria | 4614 |
| 516 | nmdc:mga0yw44_65149_c1 | 3300050492 | Bacteria | 2245 |
| 517 | nmdc:mga0yw44_744456_c1 | 3300050492 | Bacteria | 666 |
| 518 | nmdc:mga0yw44_893222_c1 | 3300050492 | Bacteria | 603 |
| 519 | nmdc:mga0yw44_914654_c1 | 3300050492 | Bacteria | 595 |
| 520 | nmdc:mga0yw44_99739_c1 | 3300050492 | Bacteria | 1848 |
| 521 | nmdc:mga0k408_27336_c1 | 3300050493 | Bacteria | 3240 |
| 522 | nmdc:mga0k408_325016_c1 | 3300050493 | Bacteria | 918 |
| 523 | nmdc:mga0k408_330591_c2 | 3300050493 | Bacteria | 616 |
| 524 | nmdc:mga0k408_42473_c2 | 3300050493 | Bacteria | 2002 |
| 525 | nmdc:mga0k408_799567_c1 | 3300050493 | Bacteria | 550 |
| 526 | nmdc:mga06z11_199706_c1 | 3300050494 | Bacteria | 1161 |
| 527 | nmdc:mga06z11_272407_c1 | 3300050494 | Bacteria | 1001 |
| 528 | nmdc:mga06z11_548628_c1 | 3300050494 | Bacteria | 702 |
| 529 | nmdc:mga06z11_69100_c1 | 3300050494 | Bacteria | 1864 |
| 530 | nmdc:mga04h51_256017_c1 | 3300050495 | Bacteria | 703 |
| 531 | nmdc:mga07m45_216693_c1 | 3300050496 | Bacteria | 1113 |
| 532 | nmdc:mga07m45_319831_c1 | 3300050496 | Bacteria | 902 |
| 533 | nmdc:mga07m45_48677_c1 | 3300050496 | Bacteria | 2384 |
| 534 | nmdc:mga05p37_646173_c1 | 3300050507 | Bacteria | 1185 |
| 535 | nmdc:mga08y16_778081_c1 | 3300050511 | Bacteria | 951 |
| 536 | nmdc:mga08y16_908355_c1 | 3300050511 | Bacteria | 866 |
| 537 | nmdc:mga0n895_1956682_c1 | 3300050512 | Bacteria | 544 |
| 538 | nmdc:mga0sz30_137258_c1 | 3300050516 | Bacteria | 1079 |
| 539 | nmdc:mga0sz30_41305_c1 | 3300050516 | Bacteria | 1939 |
| 540 | nmdc:mga0sz30_41844_c1 | 3300050516 | Bacteria | 1525 |
| 541 | nmdc:mga0sz30_4363_c1 | 3300050516 | Bacteria | 5108 |
| 542 | Ga0495601_0111128 | 3300053077 | Bacteria | 1775 |
| 543 | Ga0495601_0763057 | 3300053077 | Bacteria | 615 |
| 544 | Ga0495595_0017581 | 3300053084 | Bacteria | 3078 |
| 545 | Ga0495619_0073814 | 3300053085 | Bacteria | 2286 |
| 546 | Ga0495619_0311177 | 3300053085 | Bacteria | 1091 |
| 547 | Ga0500647_0029848 | 3300053091 | Bacteria | 2588 |
| 548 | Ga0500651_0758677 | 3300053093 | Bacteria | 515 |
| 549 | Ga0500641_0001470 | 3300053096 | Bacteria | 8395 |
| 550 | Ga0500642_0423081 | 3300053130 | Bacteria | 577 |
| 551 | Ga0500616_0003394 | 3300053153 | Bacteria | 12221 |
| 552 | Ga0587073_0058770 | 3300059492 | Bacteria | 895 |
| 553 | Ga0587085_063198 | 3300059506 | Bacteria | 706 |
| 554 | Ga0587091_124129 | 3300059511 | Bacteria | 630 |
| 555 | Ga0587117_069296 | 3300059627 | Bacteria | 622 |
| 556 | Ga0587078_025748 | 3300059646 | Bacteria | 769 |
| 557 | Ga0587079_080307 | 3300059647 | Bacteria | 745 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041459 | Ga0451800_0272757 | Ga0451800_0272757_174_413 | 70 |
| 2 | 3300005329 | Ga0070683_100085043 | Ga0070683_1000850432 | 73 |
| 3 | 3300005336 | Ga0070680_100466763 | Ga0070680_1004667632 | 73 |
| 4 | 3300005344 | Ga0070661_100060490 | Ga0070661_1000604903 | 73 |
| 5 | 3300005444 | Ga0070694_101537726 | Ga0070694_1015377262 | 73 |
| 6 | 3300005535 | Ga0070684_100915793 | Ga0070684_1009157932 | 73 |
| 7 | 3300005539 | Ga0068853_100989297 | Ga0068853_1009892972 | 73 |
| 8 | 3300005564 | Ga0070664_100022461 | Ga0070664_1000224616 | 73 |
| 9 | 3300005614 | Ga0068856_100025379 | Ga0068856_1000253795 | 73 |
| 10 | 3300005618 | Ga0068864_100258895 | Ga0068864_1002588953 | 73 |
| 11 | 3300013308 | Ga0157375_11275147 | Ga0157375_112751472 | 73 |
| 12 | 3300014497 | Ga0182008_10075655 | Ga0182008_100756553 | 73 |
| 13 | 3300025920 | Ga0207649_10037683 | Ga0207649_100376834 | 73 |
| 14 | 3300025924 | Ga0207694_10242155 | Ga0207694_102421552 | 73 |
| 15 | 3300025932 | Ga0207690_10208686 | Ga0207690_102086861 | 73 |
| 16 | 3300025933 | Ga0207706_10434146 | Ga0207706_104341462 | 73 |
| 17 | 3300025941 | Ga0207711_11854714 | Ga0207711_118547142 | 73 |
| 18 | 3300025945 | Ga0207679_10229242 | Ga0207679_102292423 | 73 |
| 19 | 3300025949 | Ga0207667_10274714 | Ga0207667_102747142 | 73 |
| 20 | 3300025981 | Ga0207640_10236048 | Ga0207640_102360482 | 73 |
| 21 | 3300026041 | Ga0207639_10788323 | Ga0207639_107883232 | 73 |
| 22 | 3300026078 | Ga0207702_10179401 | Ga0207702_101794012 | 73 |
| 23 | 3300035084 | Ga0373928_0049987 | Ga0373928_0049987_522_743 | 73 |
| 24 | 3300035111 | Ga0373923_0254675 | Ga0373923_0254675_501_722 | 73 |
| 25 | 3300035170 | Ga0373943_0124147 | Ga0373943_0124147_1022_1243 | 73 |
| 26 | 3300035171 | Ga0373946_0111286 | Ga0373946_0111286_14_235 | 73 |
| 27 | 3300035172 | Ga0373955_0009610 | Ga0373955_0009610_1337_1558 | 73 |
| 28 | 3300035692 | Ga0373935_0059605 | Ga0373935_0059605_1018_1239 | 73 |
| 29 | 3300035725 | Ga0373947_0024924 | Ga0373947_0024924_2994_3215 | 73 |
| 30 | 3300035725 | Ga0373947_0064341 | Ga0373947_0064341_1881_2102 | 73 |
| 31 | 3300036401 | Ga0373937_0010008 | Ga0373937_0010008_5720_5941 | 73 |
| 32 | 3300037068 | Ga0373925_0044845 | Ga0373925_0044845_1704_1925 | 73 |
| 33 | 3300037312 | Ga0395899_0314503 | Ga0395899_0314503_453_674 | 73 |
| 34 | 3300037418 | Ga0395900_0035147 | Ga0395900_0035147_2803_3024 | 73 |
| 35 | 3300037853 | Ga0436364_0191957 | Ga0436364_0191957_122_346 | 73 |
| 36 | 3300038443 | Ga0395901_0055930 | Ga0395901_0055930_1593_1814 | 73 |
| 37 | 3300039437 | Ga0436365_0151417 | Ga0436365_0151417_293_517 | 73 |
| 38 | 3300039438 | Ga0436360_1256092 | Ga0436360_1256092_1507_1740 | 73 |
| 39 | 3300039450 | Ga0436363_0563692 | Ga0436363_0563692_983_1204 | 73 |
| 40 | 3300039450 | Ga0436363_0811460 | Ga0436363_0811460_239_463 | 73 |
| 41 | 3300039450 | Ga0436363_0926035 | Ga0436363_0926035_1454_1678 | 73 |
| 42 | 3300039453 | Ga0436362_0509888 | Ga0436362_0509888_3837_4061 | 73 |
| 43 | 3300042005 | Ga0439448_0093978 | Ga0439448_0093978_622_843 | 73 |
| 44 | 3300042876 | Ga0451577_1421430 | Ga0451577_1421430_167_388 | 73 |
| 45 | 3300044712 | Ga0453684_1471607 | Ga0453684_1471607_335_556 | 73 |
| 46 | 3300045051 | Ga0451576_0718372 | Ga0451576_0718372_53_274 | 73 |
| 47 | 3300046454 | Ga0495592_0778519 | Ga0495592_0778519_113_334 | 73 |
| 48 | 3300046459 | Ga0495629_0754616 | Ga0495629_0754616_265_486 | 73 |
| 49 | 3300046462 | Ga0495651_0004432 | Ga0495651_0004432_5038_5259 | 73 |
| 50 | 3300046463 | Ga0495653_0084595 | Ga0495653_0084595_2081_2302 | 73 |
| 51 | 3300046476 | Ga0495662_0500569 | Ga0495662_0500569_77_298 | 73 |
| 52 | 3300046517 | Ga0495630_0321925 | Ga0495630_0321925_100_321 | 73 |
| 53 | 3300046533 | Ga0495640_0857988 | Ga0495640_0857988_98_319 | 73 |
| 54 | 3300046536 | Ga0495587_0297350 | Ga0495587_0297350_605_826 | 73 |
| 55 | 3300046543 | Ga0495645_0155119 | Ga0495645_0155119_1270_1491 | 73 |
| 56 | 3300046559 | Ga0495667_0247465 | Ga0495667_0247465_52_273 | 73 |
| 57 | 3300046663 | Ga0495635_0109208 | Ga0495635_0109208_141_362 | 73 |
| 58 | 3300046663 | Ga0495635_0632346 | Ga0495635_0632346_75_296 | 73 |
| 59 | 3300046675 | Ga0495657_0134658 | Ga0495657_0134658_1123_1344 | 73 |
| 60 | 3300046678 | Ga0495599_0521311 | Ga0495599_0521311_57_278 | 73 |
| 61 | 3300046680 | Ga0495646_0444740 | Ga0495646_0444740_409_630 | 73 |
| 62 | 3300046680 | Ga0495646_0672880 | Ga0495646_0672880_97_318 | 73 |
| 63 | 3300046809 | Ga0495600_0226191 | Ga0495600_0226191_610_831 | 73 |
| 64 | 3300047444 | Ga0495675_0228621 | Ga0495675_0228621_92_313 | 73 |
| 65 | 3300047471 | Ga0495684_0048400 | Ga0495684_0048400_2598_2819 | 73 |
| 66 | 3300047471 | Ga0495684_0214123 | Ga0495684_0214123_1094_1315 | 73 |
| 67 | 3300048905 | Ga0496102_0958949 | Ga0496102_0958949_503_724 | 73 |
| 68 | 3300053077 | Ga0495601_0763057 | Ga0495601_0763057_313_534 | 73 |
| 69 | 3300005457 | Ga0070662_100521666 | Ga0070662_1005216662 | 74 |
| 70 | 3300005548 | Ga0070665_100039027 | Ga0070665_1000390277 | 74 |
| 71 | 3300025919 | Ga0207657_11406431 | Ga0207657_114064312 | 74 |
| 72 | 3300026121 | Ga0207683_10630963 | Ga0207683_106309632 | 74 |
| 73 | 3300035116 | Ga0373945_0193558 | Ga0373945_0193558_411_635 | 74 |
| 74 | 3300037068 | Ga0373925_0236845 | Ga0373925_0236845_442_666 | 74 |
| 75 | 3300041458 | Ga0451798_0946080 | Ga0451798_0946080_134_358 | 74 |
| 76 | 3300046681 | Ga0495647_0586663 | Ga0495647_0586663_156_380 | 74 |
| 77 | iso_pu_bacteria | 2894772417 | 2894774396 | 75 |
| 78 | iso_pu_bacteria | 3002141150 | 3002144372 | 75 |
| 79 | iso_pu_bacteria | 2511231221 | 2512032431 | 76 |
| 80 | iso_pu_bacteria | 2522572158 | 2523102643 | 76 |
| 81 | iso_pu_bacteria | 2524023250 | 2524609455 | 76 |
| 82 | iso_pu_bacteria | 2597490356 | 2599105399 | 76 |
| 83 | iso_pu_bacteria | 2842775625 | 2842777954 | 76 |
| 84 | iso_pu_bacteria | 2846952575 | 2846954919 | 76 |
| 85 | iso_pu_bacteria | 2848858292 | 2848860543 | 76 |
| 86 | iso_pu_bacteria | 2897803580 | 2897806183 | 76 |
| 87 | iso_pu_bacteria | 8054002106 | 8054005978 | 76 |
| 88 | 3300005327 | Ga0070658_10034663 | Ga0070658_100346634 | 79 |
| 89 | 3300005328 | Ga0070676_10616048 | Ga0070676_106160481 | 79 |
| 90 | 3300005329 | Ga0070683_100730207 | Ga0070683_1007302072 | 79 |
| 91 | 3300005337 | Ga0070682_101432808 | Ga0070682_1014328082 | 79 |
| 92 | 3300005338 | Ga0068868_100099235 | Ga0068868_1000992354 | 79 |
| 93 | 3300005339 | Ga0070660_100014637 | Ga0070660_1000146375 | 79 |
| 94 | 3300005366 | Ga0070659_100028695 | Ga0070659_1000286952 | 79 |
| 95 | 3300005455 | Ga0070663_100048820 | Ga0070663_1000488204 | 79 |
| 96 | 3300005455 | Ga0070663_100182298 | Ga0070663_1001822982 | 79 |
| 97 | 3300005457 | Ga0070662_100815435 | Ga0070662_1008154352 | 79 |
| 98 | 3300005530 | Ga0070679_101188516 | Ga0070679_1011885162 | 79 |
| 99 | 3300005535 | Ga0070684_100102560 | Ga0070684_1001025603 | 79 |
| 100 | 3300005539 | Ga0068853_100002194 | Ga0068853_1000021948 | 79 |
| 101 | 3300005539 | Ga0068853_100032562 | Ga0068853_1000325622 | 79 |
| 102 | 3300005563 | Ga0068855_100097061 | Ga0068855_1000970612 | 79 |
| 103 | 3300005563 | Ga0068855_100129089 | Ga0068855_1001290894 | 79 |
| 104 | 3300005563 | Ga0068855_100208652 | Ga0068855_1002086524 | 79 |
| 105 | 3300005563 | Ga0068855_100214721 | Ga0068855_1002147213 | 79 |
| 106 | 3300005563 | Ga0068855_100511763 | Ga0068855_1005117632 | 79 |
| 107 | 3300005564 | Ga0070664_100333366 | Ga0070664_1003333662 | 79 |
| 108 | 3300005577 | Ga0068857_100404447 | Ga0068857_1004044472 | 79 |
| 109 | 3300005577 | Ga0068857_100946225 | Ga0068857_1009462252 | 79 |
| 110 | 3300005578 | Ga0068854_100003320 | Ga0068854_1000033209 | 79 |
| 111 | 3300005578 | Ga0068854_100024710 | Ga0068854_1000247105 | 79 |
| 112 | 3300005578 | Ga0068854_102288845 | Ga0068854_1022888452 | 79 |
| 113 | 3300005614 | Ga0068856_100072854 | Ga0068856_1000728544 | 79 |
| 114 | 3300005614 | Ga0068856_100234683 | Ga0068856_1002346832 | 79 |
| 115 | 3300005614 | Ga0068856_101100017 | Ga0068856_1011000172 | 79 |
| 116 | 3300005616 | Ga0068852_100003488 | Ga0068852_10000348810 | 79 |
| 117 | 3300005616 | Ga0068852_100007647 | Ga0068852_1000076474 | 79 |
| 118 | 3300005616 | Ga0068852_100013493 | Ga0068852_1000134939 | 79 |
| 119 | 3300005618 | Ga0068864_100511379 | Ga0068864_1005113791 | 79 |
| 120 | 3300005834 | Ga0068851_10001935 | Ga0068851_100019357 | 79 |
| 121 | 3300006048 | Ga0075363_100033775 | Ga0075363_1000337752 | 79 |
| 122 | 3300006048 | Ga0075363_100056901 | Ga0075363_1000569012 | 79 |
| 123 | 3300006051 | Ga0075364_10024791 | Ga0075364_100247913 | 79 |
| 124 | 3300006051 | Ga0075364_10296770 | Ga0075364_102967702 | 79 |
| 125 | 3300006051 | Ga0075364_10332005 | Ga0075364_103320052 | 79 |
| 126 | 3300006058 | Ga0075432_10374250 | Ga0075432_103742502 | 79 |
| 127 | 3300006177 | Ga0075362_10007197 | Ga0075362_100071975 | 79 |
| 128 | 3300006177 | Ga0075362_10029282 | Ga0075362_100292822 | 79 |
| 129 | 3300006177 | Ga0075362_10190704 | Ga0075362_101907042 | 79 |
| 130 | 3300006178 | Ga0075367_10019329 | Ga0075367_100193293 | 79 |
| 131 | 3300006178 | Ga0075367_10206897 | Ga0075367_102068972 | 79 |
| 132 | 3300006186 | Ga0075369_10446792 | Ga0075369_104467922 | 79 |
| 133 | 3300006195 | Ga0075366_10013866 | Ga0075366_100138665 | 79 |
| 134 | 3300006237 | Ga0097621_100164766 | Ga0097621_1001647662 | 79 |
| 135 | 3300009093 | Ga0105240_10158518 | Ga0105240_101585182 | 79 |
| 136 | 3300009093 | Ga0105240_10391683 | Ga0105240_103916832 | 79 |
| 137 | 3300009098 | Ga0105245_11657140 | Ga0105245_116571402 | 79 |
| 138 | 3300009098 | Ga0105245_13111524 | Ga0105245_131115241 | 79 |
| 139 | 3300009147 | Ga0114129_12531245 | Ga0114129_125312452 | 79 |
| 140 | 3300009148 | Ga0105243_10549941 | Ga0105243_105499411 | 79 |
| 141 | 3300009174 | Ga0105241_10037479 | Ga0105241_100374792 | 79 |
| 142 | 3300009174 | Ga0105241_10071407 | Ga0105241_100714073 | 79 |
| 143 | 3300009176 | Ga0105242_10742254 | Ga0105242_107422542 | 79 |
| 144 | 3300009176 | Ga0105242_12236310 | Ga0105242_122363101 | 79 |
| 145 | 3300009177 | Ga0105248_12291157 | Ga0105248_122911572 | 79 |
| 146 | 3300009545 | Ga0105237_10041468 | Ga0105237_100414686 | 79 |
| 147 | 3300009551 | Ga0105238_10035940 | Ga0105238_100359406 | 79 |
| 148 | 3300009551 | Ga0105238_10172179 | Ga0105238_101721792 | 79 |
| 149 | 3300009551 | Ga0105238_10676007 | Ga0105238_106760072 | 79 |
| 150 | 3300010375 | Ga0105239_10025681 | Ga0105239_100256814 | 79 |
| 151 | 3300010375 | Ga0105239_10695661 | Ga0105239_106956612 | 79 |
| 152 | 3300013100 | Ga0157373_10137675 | Ga0157373_101376751 | 79 |
| 153 | 3300013102 | Ga0157371_10009845 | Ga0157371_100098458 | 79 |
| 154 | 3300013104 | Ga0157370_10022575 | Ga0157370_100225755 | 79 |
| 155 | 3300013104 | Ga0157370_10076887 | Ga0157370_100768871 | 79 |
| 156 | 3300013104 | Ga0157370_10589434 | Ga0157370_105894342 | 79 |
| 157 | 3300013104 | Ga0157370_11831837 | Ga0157370_118318371 | 79 |
| 158 | 3300013297 | Ga0157378_10231632 | Ga0157378_102316322 | 79 |
| 159 | 3300013297 | Ga0157378_11260453 | Ga0157378_112604532 | 79 |
| 160 | 3300013307 | Ga0157372_10842844 | Ga0157372_108428442 | 79 |
| 161 | 3300013307 | Ga0157372_11828603 | Ga0157372_118286032 | 79 |
| 162 | 3300014325 | Ga0163163_10134983 | Ga0163163_101349833 | 79 |
| 163 | 3300014968 | Ga0157379_10960899 | Ga0157379_109608992 | 79 |
| 164 | 3300014969 | Ga0157376_11417293 | Ga0157376_114172932 | 79 |
| 165 | 3300025321 | Ga0207656_10000887 | Ga0207656_100008879 | 79 |
| 166 | 3300025909 | Ga0207705_10053858 | Ga0207705_100538583 | 79 |
| 167 | 3300025911 | Ga0207654_10188307 | Ga0207654_101883072 | 79 |
| 168 | 3300025911 | Ga0207654_10221032 | Ga0207654_102210322 | 79 |
| 169 | 3300025911 | Ga0207654_10288492 | Ga0207654_102884922 | 79 |
| 170 | 3300025912 | Ga0207707_10520344 | Ga0207707_105203442 | 79 |
| 171 | 3300025913 | Ga0207695_10119337 | Ga0207695_101193372 | 79 |
| 172 | 3300025913 | Ga0207695_10249637 | Ga0207695_102496373 | 79 |
| 173 | 3300025919 | Ga0207657_10026748 | Ga0207657_100267487 | 79 |
| 174 | 3300025920 | Ga0207649_10025971 | Ga0207649_100259714 | 79 |
| 175 | 3300025924 | Ga0207694_10019272 | Ga0207694_100192726 | 79 |
| 176 | 3300025927 | Ga0207687_11074604 | Ga0207687_110746042 | 79 |
| 177 | 3300025927 | Ga0207687_11588566 | Ga0207687_115885662 | 79 |
| 178 | 3300025932 | Ga0207690_10299649 | Ga0207690_102996491 | 79 |
| 179 | 3300025933 | Ga0207706_10110350 | Ga0207706_101103502 | 79 |
| 180 | 3300025935 | Ga0207709_10307807 | Ga0207709_103078072 | 79 |
| 181 | 3300025937 | Ga0207669_11407244 | Ga0207669_114072441 | 79 |
| 182 | 3300025939 | Ga0207665_10509987 | Ga0207665_105099872 | 79 |
| 183 | 3300025944 | Ga0207661_11188547 | Ga0207661_111885471 | 79 |
| 184 | 3300025949 | Ga0207667_10057735 | Ga0207667_100577358 | 79 |
| 185 | 3300025949 | Ga0207667_10070173 | Ga0207667_100701733 | 79 |
| 186 | 3300025981 | Ga0207640_10003952 | Ga0207640_100039528 | 79 |
| 187 | 3300025981 | Ga0207640_10118464 | Ga0207640_101184642 | 79 |
| 188 | 3300026023 | Ga0207677_10129927 | Ga0207677_101299272 | 79 |
| 189 | 3300026041 | Ga0207639_10010460 | Ga0207639_100104607 | 79 |
| 190 | 3300026041 | Ga0207639_10125442 | Ga0207639_101254425 | 79 |
| 191 | 3300026041 | Ga0207639_10673112 | Ga0207639_106731122 | 79 |
| 192 | 3300026067 | Ga0207678_10152286 | Ga0207678_101522863 | 79 |
| 193 | 3300026078 | Ga0207702_10017610 | Ga0207702_100176107 | 79 |
| 194 | 3300026078 | Ga0207702_10156439 | Ga0207702_101564394 | 79 |
| 195 | 3300026078 | Ga0207702_10264461 | Ga0207702_102644612 | 79 |
| 196 | 3300026089 | Ga0207648_10569288 | Ga0207648_105692883 | 79 |
| 197 | 3300026089 | Ga0207648_11637745 | Ga0207648_116377452 | 79 |
| 198 | 3300026116 | Ga0207674_10017245 | Ga0207674_1001724510 | 79 |
| 199 | 3300026116 | Ga0207674_10330282 | Ga0207674_103302822 | 79 |
| 200 | 3300026142 | Ga0207698_10002528 | Ga0207698_1000252810 | 79 |
| 201 | 3300026142 | Ga0207698_10574496 | Ga0207698_105744962 | 79 |
| 202 | 3300028379 | Ga0268266_11693129 | Ga0268266_116931292 | 79 |
| 203 | 3300028800 | Ga0265338_10114946 | Ga0265338_101149463 | 79 |
| 204 | 3300029957 | Ga0265324_10053599 | Ga0265324_100535992 | 79 |
| 205 | 3300031235 | Ga0265330_10024058 | Ga0265330_100240584 | 79 |
| 206 | 3300031241 | Ga0265325_10056673 | Ga0265325_100566732 | 79 |
| 207 | 3300031242 | Ga0265329_10102590 | Ga0265329_101025902 | 79 |
| 208 | 3300031249 | Ga0265339_10000397 | Ga0265339_1000039748 | 79 |
| 209 | 3300031344 | Ga0265316_10086402 | Ga0265316_100864024 | 79 |
| 210 | 3300031595 | Ga0265313_10000032 | Ga0265313_1000003214 | 79 |
| 211 | 3300031901 | Ga0307406_10193302 | Ga0307406_101933022 | 79 |
| 212 | 3300031995 | Ga0307409_102370051 | Ga0307409_1023700512 | 79 |
| 213 | 3300032004 | Ga0307414_10588054 | Ga0307414_105880542 | 79 |
| 214 | 3300032005 | Ga0307411_11778026 | Ga0307411_117780262 | 79 |
| 215 | 3300034816 | Ga0373930_0020161 | Ga0373930_0020161_782_1021 | 79 |
| 216 | 3300035084 | Ga0373928_0263474 | Ga0373928_0263474_250_489 | 79 |
| 217 | 3300035115 | Ga0373941_0166525 | Ga0373941_0166525_214_453 | 79 |
| 218 | 3300035691 | Ga0373931_1088462 | Ga0373931_1088462_283_522 | 79 |
| 219 | 3300035695 | Ga0373927_0360830 | Ga0373927_0360830_44_283 | 79 |
| 220 | 3300035695 | Ga0373927_0947623 | Ga0373927_0947623_264_521 | 79 |
| 221 | 3300037312 | Ga0395899_0691402 | Ga0395899_0691402_368_607 | 79 |
| 222 | 3300037418 | Ga0395900_0468506 | Ga0395900_0468506_451_690 | 79 |
| 223 | 3300037466 | Ga0395898_0717477 | Ga0395898_0717477_351_590 | 79 |
| 224 | 3300038443 | Ga0395901_0713111 | Ga0395901_0713111_308_547 | 79 |
| 225 | 3300039437 | Ga0436365_0414779 | Ga0436365_0414779_116_355 | 79 |
| 226 | 3300039437 | Ga0436365_1686548 | Ga0436365_1686548_117_356 | 79 |
| 227 | 3300039437 | Ga0436365_1694241 | Ga0436365_1694241_348_587 | 79 |
| 228 | 3300041441 | Ga0451787_280404 | Ga0451787_280404_263_502 | 79 |
| 229 | 3300041451 | Ga0451791_1235116 | Ga0451791_1235116_312_551 | 79 |
| 230 | 3300046506 | Ga0495583_0272368 | Ga0495583_0272368_174_413 | 79 |
| 231 | 3300049590 | Ga0501074_1332310 | Ga0501074_1332310_68_307 | 79 |
| 232 | 3300050489 | nmdc:mga03683_130026_c1 | nmdc:mga03683_130026_c1_91_330 | 79 |
| 233 | 3300050489 | nmdc:mga03683_27877_c1 | nmdc:mga03683_27877_c1_756_995 | 79 |
| 234 | 3300050489 | nmdc:mga03683_47272_c1 | nmdc:mga03683_47272_c1_1102_1341 | 79 |
| 235 | 3300050490 | nmdc:mga03n38_192938_c1 | nmdc:mga03n38_192938_c1_510_749 | 79 |
| 236 | 3300050490 | nmdc:mga03n38_42434_c1 | nmdc:mga03n38_42434_c1_503_742 | 79 |
| 237 | 3300050491 | nmdc:mga00v17_464594_c1 | nmdc:mga00v17_464594_c1_321_560 | 79 |
| 238 | 3300050491 | nmdc:mga00v17_98512_c1 | nmdc:mga00v17_98512_c1_497_736 | 79 |
| 239 | 3300050492 | nmdc:mga0yw44_914654_c1 | nmdc:mga0yw44_914654_c1_329_568 | 79 |
| 240 | 3300050493 | nmdc:mga0k408_27336_c1 | nmdc:mga0k408_27336_c1_2985_3224 | 79 |
| 241 | 3300050493 | nmdc:mga0k408_799567_c1 | nmdc:mga0k408_799567_c1_31_270 | 79 |
| 242 | 3300050494 | nmdc:mga06z11_199706_c1 | nmdc:mga06z11_199706_c1_137_376 | 79 |
| 243 | 3300050494 | nmdc:mga06z11_272407_c1 | nmdc:mga06z11_272407_c1_375_614 | 79 |
| 244 | 3300050496 | nmdc:mga07m45_216693_c1 | nmdc:mga07m45_216693_c1_662_901 | 79 |
| 245 | 3300050507 | nmdc:mga05p37_646173_c1 | nmdc:mga05p37_646173_c1_571_810 | 79 |
| 246 | 3300059492 | Ga0587073_0058770 | Ga0587073_0058770_20_259 | 79 |
| 247 | 3300059506 | Ga0587085_063198 | Ga0587085_063198_457_696 | 79 |
| 248 | 3300059627 | Ga0587117_069296 | Ga0587117_069296_369_608 | 79 |
| 249 | 3300059646 | Ga0587078_025748 | Ga0587078_025748_490_729 | 79 |
| 250 | 3300059647 | Ga0587079_080307 | Ga0587079_080307_89_328 | 79 |
| 251 | 2088090003 | LJN_F7QKVOU01BQGDU | LJN_00440130 | 80 |
| 252 | 3300003203 | JGI25406J46586_10044658 | JGI25406J46586_100446583 | 80 |
| 253 | 3300004799 | Ga0058863_11645915 | Ga0058863_116459152 | 80 |
| 254 | 3300005289 | Ga0065704_10391639 | Ga0065704_103916392 | 80 |
| 255 | 3300005327 | Ga0070658_10008327 | Ga0070658_100083278 | 80 |
| 256 | 3300005328 | Ga0070676_11475455 | Ga0070676_114754551 | 80 |
| 257 | 3300005330 | Ga0070690_100673912 | Ga0070690_1006739122 | 80 |
| 258 | 3300005336 | Ga0070680_100015841 | Ga0070680_1000158413 | 80 |
| 259 | 3300005338 | Ga0068868_102209838 | Ga0068868_1022098382 | 80 |
| 260 | 3300005339 | Ga0070660_100291403 | Ga0070660_1002914032 | 80 |
| 261 | 3300005341 | Ga0070691_10015649 | Ga0070691_100156494 | 80 |
| 262 | 3300005347 | Ga0070668_101734544 | Ga0070668_1017345442 | 80 |
| 263 | 3300005353 | Ga0070669_101202777 | Ga0070669_1012027772 | 80 |
| 264 | 3300005354 | Ga0070675_101670677 | Ga0070675_1016706771 | 80 |
| 265 | 3300005356 | Ga0070674_100202871 | Ga0070674_1002028712 | 80 |
| 266 | 3300005356 | Ga0070674_101516461 | Ga0070674_1015164612 | 80 |
| 267 | 3300005364 | Ga0070673_101892796 | Ga0070673_1018927962 | 80 |
| 268 | 3300005364 | Ga0070673_102229601 | Ga0070673_1022296011 | 80 |
| 269 | 3300005434 | Ga0070709_10028618 | Ga0070709_100286184 | 80 |
| 270 | 3300005435 | Ga0070714_100004146 | Ga0070714_1000041468 | 80 |
| 271 | 3300005436 | Ga0070713_100000939 | Ga0070713_10000093915 | 80 |
| 272 | 3300005436 | Ga0070713_100086246 | Ga0070713_1000862464 | 80 |
| 273 | 3300005436 | Ga0070713_100352912 | Ga0070713_1003529122 | 80 |
| 274 | 3300005436 | Ga0070713_101082232 | Ga0070713_1010822322 | 80 |
| 275 | 3300005437 | Ga0070710_10053020 | Ga0070710_100530201 | 80 |
| 276 | 3300005438 | Ga0070701_10687886 | Ga0070701_106878862 | 80 |
| 277 | 3300005439 | Ga0070711_100008941 | Ga0070711_1000089417 | 80 |
| 278 | 3300005440 | Ga0070705_101254033 | Ga0070705_1012540332 | 80 |
| 279 | 3300005441 | Ga0070700_101821374 | Ga0070700_1018213742 | 80 |
| 280 | 3300005441 | Ga0070700_101892594 | Ga0070700_1018925942 | 80 |
| 281 | 3300005456 | Ga0070678_100044838 | Ga0070678_1000448383 | 80 |
| 282 | 3300005458 | Ga0070681_10029061 | Ga0070681_100290613 | 80 |
| 283 | 3300005458 | Ga0070681_10667553 | Ga0070681_106675532 | 80 |
| 284 | 3300005458 | Ga0070681_10813433 | Ga0070681_108134332 | 80 |
| 285 | 3300005458 | Ga0070681_11101739 | Ga0070681_111017392 | 80 |
| 286 | 3300005467 | Ga0070706_100347490 | Ga0070706_1003474903 | 80 |
| 287 | 3300005467 | Ga0070706_101484978 | Ga0070706_1014849781 | 80 |
| 288 | 3300005518 | Ga0070699_100057798 | Ga0070699_1000577983 | 80 |
| 289 | 3300005530 | Ga0070679_100002889 | Ga0070679_10000288911 | 80 |
| 290 | 3300005535 | Ga0070684_100585366 | Ga0070684_1005853662 | 80 |
| 291 | 3300005536 | Ga0070697_100072310 | Ga0070697_1000723102 | 80 |
| 292 | 3300005545 | Ga0070695_100122969 | Ga0070695_1001229692 | 80 |
| 293 | 3300005546 | Ga0070696_101371951 | Ga0070696_1013719512 | 80 |
| 294 | 3300005547 | Ga0070693_101619699 | Ga0070693_1016196992 | 80 |
| 295 | 3300005548 | Ga0070665_100044210 | Ga0070665_1000442102 | 80 |
| 296 | 3300005548 | Ga0070665_100493404 | Ga0070665_1004934043 | 80 |
| 297 | 3300005548 | Ga0070665_101267069 | Ga0070665_1012670692 | 80 |
| 298 | 3300005563 | Ga0068855_100094201 | Ga0068855_1000942012 | 80 |
| 299 | 3300005577 | Ga0068857_100041147 | Ga0068857_1000411473 | 80 |
| 300 | 3300005577 | Ga0068857_100831884 | Ga0068857_1008318842 | 80 |
| 301 | 3300005614 | Ga0068856_100199632 | Ga0068856_1001996323 | 80 |
| 302 | 3300005614 | Ga0068856_100219317 | Ga0068856_1002193173 | 80 |
| 303 | 3300005614 | Ga0068856_100515395 | Ga0068856_1005153952 | 80 |
| 304 | 3300005617 | Ga0068859_100181338 | Ga0068859_1001813382 | 80 |
| 305 | 3300005840 | Ga0068870_10678248 | Ga0068870_106782482 | 80 |
| 306 | 3300005841 | Ga0068863_100292262 | Ga0068863_1002922623 | 80 |
| 307 | 3300005841 | Ga0068863_101064418 | Ga0068863_1010644182 | 80 |
| 308 | 3300005842 | Ga0068858_102327032 | Ga0068858_1023270321 | 80 |
| 309 | 3300005843 | Ga0068860_101507793 | Ga0068860_1015077932 | 80 |
| 310 | 3300005937 | Ga0081455_10000434 | Ga0081455_1000043428 | 80 |
| 311 | 3300005937 | Ga0081455_10002143 | Ga0081455_100021433 | 80 |
| 312 | 3300005981 | Ga0081538_10031628 | Ga0081538_100316284 | 80 |
| 313 | 3300005985 | Ga0081539_10009772 | Ga0081539_100097723 | 80 |
| 314 | 3300005985 | Ga0081539_10011462 | Ga0081539_100114628 | 80 |
| 315 | 3300005985 | Ga0081539_10019052 | Ga0081539_100190526 | 80 |
| 316 | 3300006038 | Ga0075365_10029237 | Ga0075365_100292373 | 80 |
| 317 | 3300006038 | Ga0075365_10326099 | Ga0075365_103260992 | 80 |
| 318 | 3300006038 | Ga0075365_10346649 | Ga0075365_103466492 | 80 |
| 319 | 3300006038 | Ga0075365_10916917 | Ga0075365_109169172 | 80 |
| 320 | 3300006038 | Ga0075365_11126589 | Ga0075365_111265892 | 80 |
| 321 | 3300006042 | Ga0075368_10126789 | Ga0075368_101267892 | 80 |
| 322 | 3300006051 | Ga0075364_10256115 | Ga0075364_102561152 | 80 |
| 323 | 3300006051 | Ga0075364_11077529 | Ga0075364_110775292 | 80 |
| 324 | 3300006163 | Ga0070715_10579026 | Ga0070715_105790261 | 80 |
| 325 | 3300006173 | Ga0070716_100063676 | Ga0070716_1000636763 | 80 |
| 326 | 3300006175 | Ga0070712_100000779 | Ga0070712_1000007797 | 80 |
| 327 | 3300006175 | Ga0070712_100812336 | Ga0070712_1008123362 | 80 |
| 328 | 3300006177 | Ga0075362_10052564 | Ga0075362_100525643 | 80 |
| 329 | 3300006177 | Ga0075362_10127471 | Ga0075362_101274712 | 80 |
| 330 | 3300006177 | Ga0075362_10297494 | Ga0075362_102974942 | 80 |
| 331 | 3300006186 | Ga0075369_10000336 | Ga0075369_100003366 | 80 |
| 332 | 3300006186 | Ga0075369_10058572 | Ga0075369_100585723 | 80 |
| 333 | 3300006186 | Ga0075369_10236628 | Ga0075369_102366282 | 80 |
| 334 | 3300006195 | Ga0075366_10091553 | Ga0075366_100915533 | 80 |
| 335 | 3300006195 | Ga0075366_10188225 | Ga0075366_101882252 | 80 |
| 336 | 3300006353 | Ga0075370_10934287 | Ga0075370_109342871 | 80 |
| 337 | 3300006931 | Ga0097620_100181331 | Ga0097620_1001813313 | 80 |
| 338 | 3300007265 | Ga0099794_10351138 | Ga0099794_103511382 | 80 |
| 339 | 3300007788 | Ga0099795_10417585 | Ga0099795_104175851 | 80 |
| 340 | 3300009093 | Ga0105240_10346169 | Ga0105240_103461692 | 80 |
| 341 | 3300009094 | Ga0111539_10544564 | Ga0111539_105445641 | 80 |
| 342 | 3300009098 | Ga0105245_10483539 | Ga0105245_104835393 | 80 |
| 343 | 3300009098 | Ga0105245_11381971 | Ga0105245_113819712 | 80 |
| 344 | 3300009101 | Ga0105247_11036065 | Ga0105247_110360652 | 80 |
| 345 | 3300009147 | Ga0114129_11331828 | Ga0114129_113318282 | 80 |
| 346 | 3300009147 | Ga0114129_12334845 | Ga0114129_123348451 | 80 |
| 347 | 3300009148 | Ga0105243_11226887 | Ga0105243_112268872 | 80 |
| 348 | 3300009148 | Ga0105243_11602529 | Ga0105243_116025292 | 80 |
| 349 | 3300009545 | Ga0105237_11585720 | Ga0105237_115857201 | 80 |
| 350 | 3300009545 | Ga0105237_12602580 | Ga0105237_126025802 | 80 |
| 351 | 3300009551 | Ga0105238_11190233 | Ga0105238_111902332 | 80 |
| 352 | 3300009988 | Ga0105035_128506 | Ga0105035_1285061 | 80 |
| 353 | 3300010159 | Ga0099796_10184441 | Ga0099796_101844412 | 80 |
| 354 | 3300010159 | Ga0099796_10248679 | Ga0099796_102486791 | 80 |
| 355 | 3300011119 | Ga0105246_11833480 | Ga0105246_118334802 | 80 |
| 356 | 3300012500 | Ga0157314_1042027 | Ga0157314_10420272 | 80 |
| 357 | 3300013104 | Ga0157370_10009458 | Ga0157370_100094587 | 80 |
| 358 | 3300013297 | Ga0157378_11359364 | Ga0157378_113593642 | 80 |
| 359 | 3300013306 | Ga0163162_10783964 | Ga0163162_107839642 | 80 |
| 360 | 3300013306 | Ga0163162_11594950 | Ga0163162_115949502 | 80 |
| 361 | 3300013307 | Ga0157372_11891280 | Ga0157372_118912802 | 80 |
| 362 | 3300013308 | Ga0157375_13761565 | Ga0157375_137615652 | 80 |
| 363 | 3300014325 | Ga0163163_11812798 | Ga0163163_118127982 | 80 |
| 364 | 3300014325 | Ga0163163_12278755 | Ga0163163_122787552 | 80 |
| 365 | 3300014326 | Ga0157380_11269710 | Ga0157380_112697102 | 80 |
| 366 | 3300014326 | Ga0157380_12726352 | Ga0157380_127263522 | 80 |
| 367 | 3300014497 | Ga0182008_10019469 | Ga0182008_100194694 | 80 |
| 368 | 3300014968 | Ga0157379_11175648 | Ga0157379_111756482 | 80 |
| 369 | 3300014969 | Ga0157376_11228135 | Ga0157376_112281352 | 80 |
| 370 | 3300020070 | Ga0206356_11886213 | Ga0206356_118862132 | 80 |
| 371 | 3300020076 | Ga0206355_1135818 | Ga0206355_11358181 | 80 |
| 372 | 3300021358 | Ga0213873_10004937 | Ga0213873_100049372 | 80 |
| 373 | 3300021361 | Ga0213872_10272679 | Ga0213872_102726792 | 80 |
| 374 | 3300021361 | Ga0213872_10417208 | Ga0213872_104172082 | 80 |
| 375 | 3300021388 | Ga0213875_10028110 | Ga0213875_100281103 | 80 |
| 376 | 3300021388 | Ga0213875_10152381 | Ga0213875_101523812 | 80 |
| 377 | 3300021441 | Ga0213871_10006183 | Ga0213871_100061833 | 80 |
| 378 | 3300021441 | Ga0213871_10018139 | Ga0213871_100181394 | 80 |
| 379 | 3300025291 | Ga0209675_1000985 | Ga0209675_100098514 | 80 |
| 380 | 3300025292 | Ga0209676_1087330 | Ga0209676_10873302 | 80 |
| 381 | 3300025904 | Ga0207647_10568001 | Ga0207647_105680012 | 80 |
| 382 | 3300025905 | Ga0207685_10405396 | Ga0207685_104053962 | 80 |
| 383 | 3300025905 | Ga0207685_10645224 | Ga0207685_106452242 | 80 |
| 384 | 3300025906 | Ga0207699_10013245 | Ga0207699_100132453 | 80 |
| 385 | 3300025907 | Ga0207645_10771443 | Ga0207645_107714432 | 80 |
| 386 | 3300025908 | Ga0207643_10429658 | Ga0207643_104296582 | 80 |
| 387 | 3300025909 | Ga0207705_10041156 | Ga0207705_100411563 | 80 |
| 388 | 3300025910 | Ga0207684_10333564 | Ga0207684_103335642 | 80 |
| 389 | 3300025910 | Ga0207684_10632928 | Ga0207684_106329281 | 80 |
| 390 | 3300025912 | Ga0207707_10013882 | Ga0207707_100138825 | 80 |
| 391 | 3300025912 | Ga0207707_10661188 | Ga0207707_106611881 | 80 |
| 392 | 3300025912 | Ga0207707_10866874 | Ga0207707_108668741 | 80 |
| 393 | 3300025913 | Ga0207695_10067173 | Ga0207695_100671733 | 80 |
| 394 | 3300025914 | Ga0207671_11182681 | Ga0207671_111826811 | 80 |
| 395 | 3300025915 | Ga0207693_10011626 | Ga0207693_100116262 | 80 |
| 396 | 3300025915 | Ga0207693_10375123 | Ga0207693_103751233 | 80 |
| 397 | 3300025916 | Ga0207663_11464526 | Ga0207663_114645262 | 80 |
| 398 | 3300025917 | Ga0207660_10461161 | Ga0207660_104611611 | 80 |
| 399 | 3300025919 | Ga0207657_10252473 | Ga0207657_102524732 | 80 |
| 400 | 3300025921 | Ga0207652_10027622 | Ga0207652_100276223 | 80 |
| 401 | 3300025923 | Ga0207681_10070672 | Ga0207681_100706722 | 80 |
| 402 | 3300025924 | Ga0207694_10346764 | Ga0207694_103467642 | 80 |
| 403 | 3300025924 | Ga0207694_11259872 | Ga0207694_112598722 | 80 |
| 404 | 3300025928 | Ga0207700_10003857 | Ga0207700_100038574 | 80 |
| 405 | 3300025929 | Ga0207664_10008762 | Ga0207664_100087625 | 80 |
| 406 | 3300025929 | Ga0207664_10808971 | Ga0207664_108089712 | 80 |
| 407 | 3300025937 | Ga0207669_11150379 | Ga0207669_111503792 | 80 |
| 408 | 3300025939 | Ga0207665_10073547 | Ga0207665_100735472 | 80 |
| 409 | 3300025939 | Ga0207665_10418843 | Ga0207665_104188432 | 80 |
| 410 | 3300025940 | Ga0207691_10161690 | Ga0207691_101616902 | 80 |
| 411 | 3300025942 | Ga0207689_10535312 | Ga0207689_105353122 | 80 |
| 412 | 3300025944 | Ga0207661_10529855 | Ga0207661_105298552 | 80 |
| 413 | 3300025945 | Ga0207679_11798340 | Ga0207679_117983402 | 80 |
| 414 | 3300025949 | Ga0207667_10002364 | Ga0207667_1000236424 | 80 |
| 415 | 3300025949 | Ga0207667_11688995 | Ga0207667_116889952 | 80 |
| 416 | 3300025961 | Ga0207712_11032831 | Ga0207712_110328311 | 80 |
| 417 | 3300026035 | Ga0207703_11851107 | Ga0207703_118511071 | 80 |
| 418 | 3300026041 | Ga0207639_11786630 | Ga0207639_117866301 | 80 |
| 419 | 3300026067 | Ga0207678_11448653 | Ga0207678_114486532 | 80 |
| 420 | 3300026075 | Ga0207708_11118276 | Ga0207708_111182762 | 80 |
| 421 | 3300026078 | Ga0207702_10166638 | Ga0207702_101666382 | 80 |
| 422 | 3300026078 | Ga0207702_10494373 | Ga0207702_104943732 | 80 |
| 423 | 3300026078 | Ga0207702_12454450 | Ga0207702_124544502 | 80 |
| 424 | 3300026095 | Ga0207676_12438304 | Ga0207676_124383042 | 80 |
| 425 | 3300026116 | Ga0207674_10032698 | Ga0207674_100326985 | 80 |
| 426 | 3300026116 | Ga0207674_10192431 | Ga0207674_101924313 | 80 |
| 427 | 3300026118 | Ga0207675_100537358 | Ga0207675_1005373582 | 80 |
| 428 | 3300026121 | Ga0207683_10069539 | Ga0207683_100695393 | 80 |
| 429 | 3300027866 | Ga0209813_10158147 | Ga0209813_101581472 | 80 |
| 430 | 3300028379 | Ga0268266_10186323 | Ga0268266_101863232 | 80 |
| 431 | 3300028379 | Ga0268266_10346541 | Ga0268266_103465412 | 80 |
| 432 | 3300028379 | Ga0268266_10590099 | Ga0268266_105900992 | 80 |
| 433 | 3300028380 | Ga0268265_10887224 | Ga0268265_108872242 | 80 |
| 434 | 3300028573 | Ga0265334_10041312 | Ga0265334_100413121 | 80 |
| 435 | 3300028786 | Ga0307517_10445086 | Ga0307517_104450862 | 80 |
| 436 | 3300030521 | Ga0307511_10213818 | Ga0307511_102138182 | 80 |
| 437 | 3300031242 | Ga0265329_10230058 | Ga0265329_102300582 | 80 |
| 438 | 3300031247 | Ga0265340_10137109 | Ga0265340_101371091 | 80 |
| 439 | 3300031731 | Ga0307405_10064977 | Ga0307405_100649772 | 80 |
| 440 | 3300031901 | Ga0307406_10786535 | Ga0307406_107865351 | 80 |
| 441 | 3300031911 | Ga0307412_10881190 | Ga0307412_108811902 | 80 |
| 442 | 3300031995 | Ga0307409_100078824 | Ga0307409_1000788246 | 80 |
| 443 | 3300032002 | Ga0307416_100635065 | Ga0307416_1006350652 | 80 |
| 444 | 3300032004 | Ga0307414_10637001 | Ga0307414_106370012 | 80 |
| 445 | 3300032126 | Ga0307415_100391663 | Ga0307415_1003916632 | 80 |
| 446 | 3300035085 | Ga0373929_0179325 | Ga0373929_0179325_126_368 | 80 |
| 447 | 3300035086 | Ga0373934_0028064 | Ga0373934_0028064_1473_1715 | 80 |
| 448 | 3300035088 | Ga0373940_0065355 | Ga0373940_0065355_400_642 | 80 |
| 449 | 3300035111 | Ga0373923_0119568 | Ga0373923_0119568_735_977 | 80 |
| 450 | 3300035112 | Ga0373932_0229769 | Ga0373932_0229769_258_500 | 80 |
| 451 | 3300035113 | Ga0373936_0131550 | Ga0373936_0131550_207_449 | 80 |
| 452 | 3300035114 | Ga0373939_0127742 | Ga0373939_0127742_339_581 | 80 |
| 453 | 3300035115 | Ga0373941_0155144 | Ga0373941_0155144_298_540 | 80 |
| 454 | 3300035117 | Ga0373953_0118550 | Ga0373953_0118550_424_666 | 80 |
| 455 | 3300035170 | Ga0373943_0323040 | Ga0373943_0323040_41_283 | 80 |
| 456 | 3300035170 | Ga0373943_0326197 | Ga0373943_0326197_106_348 | 80 |
| 457 | 3300035172 | Ga0373955_0108703 | Ga0373955_0108703_1244_1486 | 80 |
| 458 | 3300035172 | Ga0373955_0164251 | Ga0373955_0164251_91_333 | 80 |
| 459 | 3300035172 | Ga0373955_0740259 | Ga0373955_0740259_99_341 | 80 |
| 460 | 3300035410 | Ga0373924_0062969 | Ga0373924_0062969_1149_1391 | 80 |
| 461 | 3300035692 | Ga0373935_0373484 | Ga0373935_0373484_33_275 | 80 |
| 462 | 3300035692 | Ga0373935_0508271 | Ga0373935_0508271_213_455 | 80 |
| 463 | 3300035692 | Ga0373935_0656545 | Ga0373935_0656545_38_280 | 80 |
| 464 | 3300035695 | Ga0373927_0098382 | Ga0373927_0098382_72_314 | 80 |
| 465 | 3300035695 | Ga0373927_0622732 | Ga0373927_0622732_92_334 | 80 |
| 466 | 3300035724 | Ga0373933_0001236 | Ga0373933_0001236_2910_3152 | 80 |
| 467 | 3300035725 | Ga0373947_0335811 | Ga0373947_0335811_738_980 | 80 |
| 468 | 3300035725 | Ga0373947_0446030 | Ga0373947_0446030_580_822 | 80 |
| 469 | 3300036401 | Ga0373937_0005149 | Ga0373937_0005149_5498_5740 | 80 |
| 470 | 3300036401 | Ga0373937_0257543 | Ga0373937_0257543_295_537 | 80 |
| 471 | 3300037068 | Ga0373925_0023574 | Ga0373925_0023574_598_840 | 80 |
| 472 | 3300037068 | Ga0373925_0768771 | Ga0373925_0768771_163_405 | 80 |
| 473 | 3300037312 | Ga0395899_0027167 | Ga0395899_0027167_857_1099 | 80 |
| 474 | 3300037312 | Ga0395899_0178224 | Ga0395899_0178224_180_422 | 80 |
| 475 | 3300037418 | Ga0395900_0102804 | Ga0395900_0102804_1786_2028 | 80 |
| 476 | 3300037466 | Ga0395898_0016415 | Ga0395898_0016415_2911_3153 | 80 |
| 477 | 3300037471 | Ga0395905_1070902 | Ga0395905_1070902_177_419 | 80 |
| 478 | 3300037853 | Ga0436364_0821358 | Ga0436364_0821358_3204_3449 | 80 |
| 479 | 3300037853 | Ga0436364_1239827 | Ga0436364_1239827_1917_2159 | 80 |
| 480 | 3300038443 | Ga0395901_0001851 | Ga0395901_0001851_20214_20456 | 80 |
| 481 | 3300038443 | Ga0395901_0034540 | Ga0395901_0034540_750_992 | 80 |
| 482 | 3300039438 | Ga0436360_0405006 | Ga0436360_0405006_1034_1276 | 80 |
| 483 | 3300039438 | Ga0436360_0848685 | Ga0436360_0848685_129_371 | 80 |
| 484 | 3300039438 | Ga0436360_1286833 | Ga0436360_1286833_2189_2431 | 80 |
| 485 | 3300039447 | Ga0436361_0305263 | Ga0436361_0305263_1217_1459 | 80 |
| 486 | 3300039447 | Ga0436361_0767627 | Ga0436361_0767627_1895_2137 | 80 |
| 487 | 3300039447 | Ga0436361_1163612 | Ga0436361_1163612_142_384 | 80 |
| 488 | 3300039453 | Ga0436362_0338910 | Ga0436362_0338910_229_471 | 80 |
| 489 | 3300041460 | Ga0451802_1078191 | Ga0451802_1078191_272_514 | 80 |
| 490 | 3300041496 | Ga0451839_0008132 | Ga0451839_0008132_155_397 | 80 |
| 491 | 3300041512 | Ga0451853_3561479 | Ga0451853_3561479_107_349 | 80 |
| 492 | 3300042438 | Ga0439459_0035812 | Ga0439459_0035812_697_939 | 80 |
| 493 | 3300042461 | Ga0439460_0091211 | Ga0439460_0091211_507_752 | 80 |
| 494 | 3300046475 | Ga0495639_0370691 | Ga0495639_0370691_352_594 | 80 |
| 495 | 3300046511 | Ga0495608_0070537 | Ga0495608_0070537_1102_1344 | 80 |
| 496 | 3300046516 | Ga0495628_0539461 | Ga0495628_0539461_580_822 | 80 |
| 497 | 3300046536 | Ga0495587_0014044 | Ga0495587_0014044_2884_3126 | 80 |
| 498 | 3300046543 | Ga0495645_0562672 | Ga0495645_0562672_91_333 | 80 |
| 499 | 3300046559 | Ga0495667_0081426 | Ga0495667_0081426_260_502 | 80 |
| 500 | 3300046559 | Ga0495667_0310071 | Ga0495667_0310071_722_964 | 80 |
| 501 | 3300046616 | Ga0495668_0201172 | Ga0495668_0201172_652_894 | 80 |
| 502 | 3300046663 | Ga0495635_0111009 | Ga0495635_0111009_711_953 | 80 |
| 503 | 3300046675 | Ga0495657_0152607 | Ga0495657_0152607_1101_1343 | 80 |
| 504 | 3300046678 | Ga0495599_0164936 | Ga0495599_0164936_690_932 | 80 |
| 505 | 3300046679 | Ga0495623_0024082 | Ga0495623_0024082_3570_3812 | 80 |
| 506 | 3300046680 | Ga0495646_0283135 | Ga0495646_0283135_66_308 | 80 |
| 507 | 3300046692 | Ga0495671_0467038 | Ga0495671_0467038_112_354 | 80 |
| 508 | 3300046809 | Ga0495600_0022905 | Ga0495600_0022905_1360_1602 | 80 |
| 509 | 3300047319 | Ga0495674_1176241 | Ga0495674_1176241_204_446 | 80 |
| 510 | 3300047322 | Ga0495680_0040284 | Ga0495680_0040284_1095_1337 | 80 |
| 511 | 3300047444 | Ga0495675_0157551 | Ga0495675_0157551_56_298 | 80 |
| 512 | 3300048088 | Ga0495602_0023216 | Ga0495602_0023216_3206_3448 | 80 |
| 513 | 3300048915 | Ga0496112_1461879 | Ga0496112_1461879_250_492 | 80 |
| 514 | 3300048916 | Ga0496113_1086356 | Ga0496113_1086356_192_434 | 80 |
| 515 | 3300048922 | Ga0496119_0003988 | Ga0496119_0003988_4085_4327 | 80 |
| 516 | 3300048923 | Ga0496120_0080651 | Ga0496120_0080651_480_722 | 80 |
| 517 | 3300048925 | Ga0496122_0067264 | Ga0496122_0067264_17_259 | 80 |
| 518 | 3300049534 | Ga0501318_003228 | Ga0501318_003228_293_535 | 80 |
| 519 | 3300049569 | Ga0501032_0169566 | Ga0501032_0169566_1107_1349 | 80 |
| 520 | 3300049570 | Ga0501033_0541758 | Ga0501033_0541758_536_778 | 80 |
| 521 | 3300049571 | Ga0501034_0017532 | Ga0501034_0017532_7014_7268 | 80 |
| 522 | 3300049571 | Ga0501034_0037546 | Ga0501034_0037546_1241_1483 | 80 |
| 523 | 3300049572 | Ga0501036_1708392 | Ga0501036_1708392_224_466 | 80 |
| 524 | 3300049575 | Ga0501039_1544209 | Ga0501039_1544209_217_459 | 80 |
| 525 | 3300049584 | Ga0501068_0140025 | Ga0501068_0140025_1221_1475 | 80 |
| 526 | 3300049586 | Ga0501070_0685556 | Ga0501070_0685556_72_326 | 80 |
| 527 | 3300049586 | Ga0501070_0795355 | Ga0501070_0795355_94_336 | 80 |
| 528 | 3300049590 | Ga0501074_1044795 | Ga0501074_1044795_126_368 | 80 |
| 529 | 3300049593 | Ga0501077_0270191 | Ga0501077_0270191_73_315 | 80 |
| 530 | 3300049822 | Ga0501035_0744268 | Ga0501035_0744268_324_566 | 80 |
| 531 | 3300049823 | Ga0501044_0117070 | Ga0501044_0117070_1050_1292 | 80 |
| 532 | 3300049823 | Ga0501044_1413941 | Ga0501044_1413941_43_297 | 80 |
| 533 | 3300050489 | nmdc:mga03683_121593_c1 | nmdc:mga03683_121593_c1_499_741 | 80 |
| 534 | 3300050489 | nmdc:mga03683_17888_c1 | nmdc:mga03683_17888_c1_85_327 | 80 |
| 535 | 3300050489 | nmdc:mga03683_216721_c1 | nmdc:mga03683_216721_c1_249_491 | 80 |
| 536 | 3300050490 | nmdc:mga03n38_82602_c1 | nmdc:mga03n38_82602_c1_46_288 | 80 |
| 537 | 3300050490 | nmdc:mga03n38_964652_c1 | nmdc:mga03n38_964652_c1_204_446 | 80 |
| 538 | 3300050491 | nmdc:mga00v17_961827_c1 | nmdc:mga00v17_961827_c1_162_404 | 80 |
| 539 | 3300050492 | nmdc:mga0yw44_11213_c1 | nmdc:mga0yw44_11213_c1_4102_4344 | 80 |
| 540 | 3300050492 | nmdc:mga0yw44_65149_c1 | nmdc:mga0yw44_65149_c1_714_956 | 80 |
| 541 | 3300050492 | nmdc:mga0yw44_744456_c1 | nmdc:mga0yw44_744456_c1_20_262 | 80 |
| 542 | 3300050492 | nmdc:mga0yw44_893222_c1 | nmdc:mga0yw44_893222_c1_181_423 | 80 |
| 543 | 3300050492 | nmdc:mga0yw44_99739_c1 | nmdc:mga0yw44_99739_c1_925_1167 | 80 |
| 544 | 3300050493 | nmdc:mga0k408_325016_c1 | nmdc:mga0k408_325016_c1_165_407 | 80 |
| 545 | 3300050493 | nmdc:mga0k408_330591_c2 | nmdc:mga0k408_330591_c2_97_339 | 80 |
| 546 | 3300050493 | nmdc:mga0k408_42473_c2 | nmdc:mga0k408_42473_c2_658_900 | 80 |
| 547 | 3300050494 | nmdc:mga06z11_548628_c1 | nmdc:mga06z11_548628_c1_442_684 | 80 |
| 548 | 3300050494 | nmdc:mga06z11_69100_c1 | nmdc:mga06z11_69100_c1_516_758 | 80 |
| 549 | 3300050495 | nmdc:mga04h51_256017_c1 | nmdc:mga04h51_256017_c1_371_613 | 80 |
| 550 | 3300050496 | nmdc:mga07m45_319831_c1 | nmdc:mga07m45_319831_c1_223_465 | 80 |
| 551 | 3300050496 | nmdc:mga07m45_48677_c1 | nmdc:mga07m45_48677_c1_295_537 | 80 |
| 552 | 3300050511 | nmdc:mga08y16_778081_c1 | nmdc:mga08y16_778081_c1_667_909 | 80 |
| 553 | 3300050511 | nmdc:mga08y16_908355_c1 | nmdc:mga08y16_908355_c1_318_560 | 80 |
| 554 | 3300050512 | nmdc:mga0n895_1956682_c1 | nmdc:mga0n895_1956682_c1_55_297 | 80 |
| 555 | 3300050516 | nmdc:mga0sz30_137258_c1 | nmdc:mga0sz30_137258_c1_466_708 | 80 |
| 556 | 3300050516 | nmdc:mga0sz30_41305_c1 | nmdc:mga0sz30_41305_c1_455_697 | 80 |
| 557 | 3300050516 | nmdc:mga0sz30_41844_c1 | nmdc:mga0sz30_41844_c1_928_1170 | 80 |
| 558 | 3300050516 | nmdc:mga0sz30_4363_c1 | nmdc:mga0sz30_4363_c1_3515_3757 | 80 |
| 559 | 3300053077 | Ga0495601_0111128 | Ga0495601_0111128_298_540 | 80 |
| 560 | 3300053084 | Ga0495595_0017581 | Ga0495595_0017581_1743_1985 | 80 |
| 561 | 3300053085 | Ga0495619_0073814 | Ga0495619_0073814_64_306 | 80 |
| 562 | 3300053085 | Ga0495619_0311177 | Ga0495619_0311177_221_463 | 80 |
| 563 | 3300053091 | Ga0500647_0029848 | Ga0500647_0029848_1257_1499 | 80 |
| 564 | 3300053093 | Ga0500651_0758677 | Ga0500651_0758677_113_355 | 80 |
| 565 | 3300053096 | Ga0500641_0001470 | Ga0500641_0001470_409_651 | 80 |
| 566 | 3300053130 | Ga0500642_0423081 | Ga0500642_0423081_278_520 | 80 |
| 567 | 3300053153 | Ga0500616_0003394 | Ga0500616_0003394_466_708 | 80 |
| 568 | 3300059511 | Ga0587091_124129 | Ga0587091_124129_105_347 | 80 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zny-assembly2.cif.gz_C | crystal structure of the ffrp | 0.6537 | 1 | 79 |
| 2bxj-assembly2.cif.gz_B | double mutant of the ribosomal protein s6 | 0.6533 | 1 | 80 |
| 2bxj-assembly2.cif.gz_B | double mutant of the ribosomal protein s6 | 0.6465 | 1 | 80 |
| 7p7r-assembly1.cif.gz_g | poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state i | 0.6409 | 1 | 80 |
| 6zi1-assembly1.cif.gz_AAA | crystal structure of the isolated h. influenzae vapd toxin (d7n mutant) | 0.637 | 1 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cyyA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.6464 | 2 | 80 | 3.30.70.920 |
| af_P10869_349_504_3.30.2130.10 | Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like | 0.6312 | 2 | 77 | 3.30.2130.10 |
| 4pquC02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.6211 | 2 | 70 | 3.30.70.270 |
| af_P9WH31_1_96_3.30.70.60 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.6164 | 2 | 77 | 3.30.70.60 |
| 2hiyB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.6136 | 2 | 77 | 3.30.70.1280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259UYU5-F1-model_v4 | deleted | 0.6795 | 2 | 78 |
|
| AF-A0A410JU04-F1-model_v4 | Uncharacterized protein | 0.6691 | 1 | 76 |
|
| AF-A0A1I2BUA9-F1-model_v4 | Uncharacterized protein | 0.6607 | 2 | 80 |
GO:0016020
|
| AF-A0A259UYU5-F1-model_v4 | deleted | 0.6539 | 2 | 78 |
|
| AF-A0A1I2BUA9-F1-model_v4 | Uncharacterized protein | 0.6481 | 2 | 80 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar