F464623

General Info

Members Datasets Scaffolds Average Seq Length
568 306 526 195

Family's Representative Sequence

Representative Sequence 3300009993|Ga0105028_102764|Ga0105028_1027642
Length 234
Sequence LGLEELAAKAAPTKSNGQSKSPFIPLFQRWKHQKRGYAVIGRLKGILLHKQPPWLVVDVHGVGYELEAPMSTFYDLPEIGREVSLFTHYAQKEDSVSLYGFLAEAERRLFRDVQRVSGIGAKIALAVLSGVSVDEFARLVQTGDVTALTRIPGIGKKTAERMVVELRDRAADLLGGASPIAMGKGPADPLSEAIVALQQLGYKPAEAQRMAKTAAAEGDAAETIIRKALQSALR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2643221559 Lysobacter sp. Root559 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
18 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
19 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
20 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
21 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
22 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
23 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
24 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
25 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
26 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
27 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
28 2919513703 Luteimonas sp. 3794 Isolate Unclassified
29 2919675420 Luteimonas terrae 4099 Isolate Unclassified
30 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
31 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
32 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
33 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
34 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
35 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
36 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
37 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
38 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
47 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
191 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
192 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
193 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
194 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
195 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
210 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
211 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
212 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
213 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
218 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
219 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
220 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
221 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
224 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
292 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
295 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
301 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
302 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
303 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
304 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
305 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
306 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.25
Metatranscriptomes 0.35
Isolates 7.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 16.37
Nodule 0
Rhizoplane 3.7
Rhizosphere 66.55
Stem 0
Stem Tuber 0
Unclassified 13.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1115076 2162886007 Bacteria 3212
2 SwRhRL2b_contig_2451917 2162886007 Bacteria 2196
3 JGI24740J21852_10001629 3300001979 Bacteria 10344
4 JGI24739J22299_10000146 3300001989 Bacteria 22533
5 JGI24737J22298_10006361 3300001990 Bacteria 4038
6 JGI25152J39213_1000170 3300002773 Bacteria 43894
7 JGI25150J39212_1000122 3300002774 Bacteria 43890
8 JGI25151J46595_10000411 3300003187 Bacteria 43894
9 JGI25151J46595_10000500 3300003187 Bacteria 36759
10 JGI25153J46596_10000252 3300003215 Bacteria 43894
11 JGI26143J51219_1001329 3300003502 Bacteria 1000
12 Ga0006562J51391_1017735 3300003578 Bacteria 10150
13 Ga0006562J51391_1017736 3300003578 Bacteria 6012
14 Ga0055526_1000022 3300003771 Bacteria 172746
15 Ga0055526_1001381 3300003771 Bacteria 17361
16 Ga0055526_1024466 3300003771 Bacteria 1973
17 Ga0055537_1000085 3300003773 Bacteria 67908
18 Ga0055537_1000643 3300003773 Bacteria 18533
19 Ga0055524_1000036 3300003775 Bacteria 171459
20 Ga0055536_1007237 3300003781 Bacteria 5004
21 Ga0055536_1011472 3300003781 Bacteria 3394
22 Ga0055536_1011473 3300003781 Bacteria 3394
23 Ga0055536_1013429 3300003781 Bacteria 2956
24 Ga0055536_1017439 3300003781 Bacteria 2351
25 Ga0055536_1050781 3300003781 Bacteria 913
26 Ga0055534_1000010 3300003784 Bacteria 171486
27 Ga0055534_1000476 3300003784 Bacteria 22547
28 Ga0055528_1000014 3300003790 Bacteria 172746
29 Ga0055528_1000121 3300003790 Bacteria 62003
30 Ga0055530_10003719 3300003791 Bacteria 8478
31 Ga0055530_10004345 3300003791 Bacteria 7356
32 Ga0055531_10014631 3300003794 Bacteria 3520
33 Ga0055531_10015799 3300003794 Bacteria 3300
34 Ga0055531_10017613 3300003794 Bacteria 3004
35 Ga0055531_10029172 3300003794 Bacteria 1885
36 Ga0055531_10036635 3300003794 Bacteria 1508
37 Ga0055531_10050745 3300003794 Bacteria 1095
38 Ga0058692_1000011 3300003856 Bacteria 321321
39 Ga0058692_1000033 3300003856 Bacteria 174393
40 Ga0065165_1033560 3300005262 Bacteria 1596
41 Ga0065714_10012060 3300005288 Bacteria 2741
42 Ga0065704_10000377 3300005289 Bacteria 25325
43 Ga0065704_10071669 3300005289 Bacteria 10309
44 Ga0065704_10327581 3300005289 Bacteria 843
45 Ga0065715_10024945 3300005293 Bacteria 2215
46 Ga0065715_10063878 3300005293 Bacteria 831
47 Ga0070676_10229965 3300005328 Bacteria 1229
48 Ga0070690_100049799 3300005330 Bacteria 2672
49 Ga0070670_100137868 3300005331 Bacteria 2109
50 Ga0068869_100086340 3300005334 Bacteria 2352
51 Ga0070682_100120428 3300005337 Bacteria 1761
52 Ga0070660_100032872 3300005339 Bacteria 3907
53 Ga0070668_100002000 3300005347 Bacteria 14894
54 Ga0070668_100039720 3300005347 Bacteria 3599
55 Ga0070668_100112448 3300005347 Bacteria 2169
56 Ga0070668_100519796 3300005347 Bacteria 1033
57 Ga0070669_100904813 3300005353 Bacteria 754
58 Ga0070671_100052827 3300005355 Bacteria 3378
59 Ga0070671_100119403 3300005355 Bacteria 2218
60 Ga0070671_100298163 3300005355 Bacteria 1372
61 Ga0070674_100493127 3300005356 Bacteria 1019
62 Ga0070659_100028624 3300005366 Bacteria 4304
63 Ga0070659_100158029 3300005366 Bacteria 1852
64 Ga0070659_100258018 3300005366 Bacteria 1446
65 Ga0070667_100041584 3300005367 Bacteria 3856
66 Ga0070667_100729745 3300005367 Bacteria 918
67 Ga0070663_100447729 3300005455 Bacteria 1064
68 Ga0070663_100704043 3300005455 Bacteria 859
69 Ga0070678_100379390 3300005456 Bacteria 1223
70 Ga0068867_100174022 3300005459 Bacteria 1707
71 Ga0068853_100013094 3300005539 Bacteria 6766
72 Ga0068853_100042250 3300005539 Bacteria 3897
73 Ga0068853_100226008 3300005539 Bacteria 1711
74 Ga0070672_100058392 3300005543 Bacteria 3032
75 Ga0070672_100083740 3300005543 Bacteria 2560
76 Ga0070672_100325996 3300005543 Bacteria 1306
77 Ga0070665_100161665 3300005548 Bacteria 2241
78 Ga0070665_100180839 3300005548 Bacteria 2110
79 Ga0070665_100285374 3300005548 Bacteria 1653
80 Ga0070665_100554211 3300005548 Bacteria 1162
81 Ga0068855_100014356 3300005563 Bacteria 9537
82 Ga0068855_100093652 3300005563 Bacteria 3464
83 Ga0070664_100171320 3300005564 Bacteria 1926
84 Ga0070664_100312333 3300005564 Bacteria 1423
85 Ga0070664_100324834 3300005564 Bacteria 1395
86 Ga0068857_100000296 3300005577 Bacteria 34414
87 Ga0068857_100336025 3300005577 Bacteria 1397
88 Ga0068854_100025565 3300005578 Bacteria 4052
89 Ga0068854_100314033 3300005578 Bacteria 1272
90 Ga0068856_100000465 3300005614 Bacteria 44705
91 Ga0068856_100065466 3300005614 Bacteria 3592
92 Ga0068856_100170952 3300005614 Bacteria 2185
93 Ga0068852_100038917 3300005616 Bacteria 4000
94 Ga0068852_100436096 3300005616 Bacteria 1294
95 Ga0068859_100052868 3300005617 Bacteria 4085
96 Ga0068859_100338380 3300005617 Bacteria 1599
97 Ga0068864_100830360 3300005618 Bacteria 910
98 Ga0068866_10413665 3300005718 Bacteria 873
99 Ga0068861_101163677 3300005719 Bacteria 744
100 Ga0068851_10316089 3300005834 Bacteria 901
101 Ga0068863_100021195 3300005841 Bacteria 6204
102 Ga0068863_100180127 3300005841 Bacteria 2028
103 Ga0068863_100261627 3300005841 Bacteria 1673
104 Ga0068863_100667292 3300005841 Bacteria 1032
105 Ga0068858_100011969 3300005842 Bacteria 8178
106 Ga0068858_100032817 3300005842 Bacteria 4822
107 Ga0068858_100240995 3300005842 Bacteria 1716
108 Ga0068860_100019791 3300005843 Bacteria 6526
109 Ga0075363_100091437 3300006048 Bacteria 1675
110 Ga0075364_10039473 3300006051 Bacteria 3060
111 Ga0075364_10051844 3300006051 Bacteria 2680
112 Ga0075364_10074220 3300006051 Bacteria 2243
113 Ga0075364_10304821 3300006051 Bacteria 1084
114 Ga0075364_10388670 3300006051 Bacteria 952
115 Ga0075367_10268208 3300006178 Bacteria 1072
116 Ga0097621_100104213 3300006237 Bacteria 2390
117 Ga0068865_100412350 3300006881 Bacteria 1109
118 Ga0097620_100052867 3300006931 Bacteria 4085
119 Ga0097620_100338339 3300006931 Bacteria 1599
120 Ga0105251_10000076 3300009011 Bacteria 93688
121 Ga0105244_10076574 3300009036 Bacteria 1661
122 Ga0105240_10044369 3300009093 Bacteria 5650
123 Ga0105240_10050733 3300009093 Bacteria 5228
124 Ga0105240_10283230 3300009093 Bacteria 1903
125 Ga0105245_10141987 3300009098 Bacteria 2263
126 Ga0105245_10658108 3300009098 Bacteria 1078
127 Ga0105243_10164867 3300009148 Bacteria 1914
128 Ga0105241_10574509 3300009174 Bacteria 1015
129 Ga0105242_10078915 3300009176 Bacteria 2748
130 Ga0105248_10200542 3300009177 Bacteria 2248
131 Ga0105248_10249393 3300009177 Bacteria 1998
132 Ga0105237_10000084 3300009545 Bacteria 125742
133 Ga0105238_10050865 3300009551 Bacteria 4171
134 Ga0105238_10102803 3300009551 Bacteria 2839
135 Ga0105028_102764 3300009993 Bacteria 1846
136 Ga0105028_108849 3300009993 Bacteria 1053
137 Ga0105239_10032650 3300010375 Bacteria 5720
138 Ga0105239_10616646 3300010375 Bacteria 1238
139 Ga0105246_10005258 3300011119 Bacteria 7873
140 Ga0105246_10074299 3300011119 Bacteria 2403
141 Ga0105246_10885768 3300011119 Bacteria 799
142 Ga0157314_1000056 3300012500 Bacteria 11892
143 Ga0157314_1005470 3300012500 Bacteria 964
144 Ga0157373_10143867 3300013100 Bacteria 1677
145 Ga0157371_10004109 3300013102 Bacteria 12851
146 Ga0157371_10017058 3300013102 Bacteria 5402
147 Ga0157371_10045144 3300013102 Bacteria 3136
148 Ga0157370_10023065 3300013104 Bacteria 6187
149 Ga0157370_10277301 3300013104 Bacteria 1549
150 Ga0157369_10004138 3300013105 Bacteria 17181
151 Ga0157369_10036315 3300013105 Bacteria 5399
152 Ga0157369_10792365 3300013105 Bacteria 974
153 Ga0157374_10036874 3300013296 Bacteria 4481
154 Ga0157374_10865635 3300013296 Bacteria 921
155 Ga0157378_10064360 3300013297 Bacteria 3280
156 Ga0163162_10315666 3300013306 Bacteria 1695
157 Ga0157372_10222205 3300013307 Bacteria 2189
158 Ga0157375_10005495 3300013308 Bacteria 11024
159 Ga0157375_10644855 3300013308 Bacteria 1216
160 Ga0157375_10788002 3300013308 Bacteria 1100
161 Ga0163163_10000024 3300014325 Bacteria 185100
162 Ga0163163_10001536 3300014325 Bacteria 19438
163 Ga0163163_10117007 3300014325 Bacteria 2697
164 Ga0182008_10004777 3300014497 Bacteria 7842
165 Ga0182008_10016904 3300014497 Bacteria 3785
166 Ga0182008_10098395 3300014497 Bacteria 1444
167 Ga0157379_10003746 3300014968 Bacteria 12936
168 Ga0182006_1113140 3300015261 Bacteria 950
169 Ga0182007_10000026 3300015262 Bacteria 168694
170 Ga0182005_1000232 3300015265 Bacteria 36038
171 Ga0163161_10331599 3300017792 Bacteria 1205
172 Ga0207425_1000066 3300025245 Bacteria 125463
173 Ga0207425_1006681 3300025245 Bacteria 3128
174 Ga0209129_1000135 3300025258 Bacteria 125520
175 Ga0209565_1000001 3300025263 Bacteria 2950419
176 Ga0209565_1000023 3300025263 Bacteria 388244
177 Ga0209673_1000001 3300025273 Bacteria 3176258
178 Ga0209673_1000116 3300025273 Bacteria 175933
179 Ga0209673_1023716 3300025273 Bacteria 2081
180 Ga0209130_1002852 3300025284 Bacteria 8013
181 Ga0209130_1022605 3300025284 Bacteria 1399
182 Ga0209675_1000001 3300025291 Bacteria 2950293
183 Ga0209675_1000016 3300025291 Bacteria 391965
184 Ga0209675_1019995 3300025291 Bacteria 1827
185 Ga0209676_1000037 3300025292 Bacteria 457562
186 Ga0209676_1000129 3300025292 Bacteria 187495
187 Ga0209676_1000549 3300025292 Bacteria 57408
188 Ga0209676_1001552 3300025292 Bacteria 20603
189 Ga0209676_1001804 3300025292 Bacteria 17921
190 Ga0209676_1003577 3300025292 Bacteria 9387
191 Ga0209676_1035623 3300025292 Bacteria 1457
192 Ga0209676_1036911 3300025292 Bacteria 1416
193 Ga0209025_1000006 3300025294 Bacteria 1153444
194 Ga0209025_1000013 3300025294 Bacteria 871757
195 Ga0209025_1001865 3300025294 Bacteria 24707
196 Ga0209025_1039637 3300025294 Bacteria 2051
197 Ga0209025_1067454 3300025294 Bacteria 1293
198 Ga0209564_1000001 3300025295 Bacteria 3176258
199 Ga0209564_1001691 3300025295 Bacteria 20950
200 Ga0209564_1033891 3300025295 Bacteria 1508
201 Ga0209564_1042153 3300025295 Bacteria 1214
202 Ga0209758_1000014 3300025297 Bacteria 871757
203 Ga0209758_1018440 3300025297 Bacteria 3419
204 Ga0209758_1035076 3300025297 Bacteria 1982
205 Ga0209758_1052442 3300025297 Bacteria 1411
206 Ga0209050_1001795 3300025298 Bacteria 21074
207 Ga0209050_1004211 3300025298 Bacteria 9928
208 Ga0209050_1004412 3300025298 Bacteria 9524
209 Ga0209050_1016374 3300025298 Bacteria 3038
210 Ga0209050_1020249 3300025298 Bacteria 2483
211 Ga0209256_1000006 3300025299 Bacteria 1250310
212 Ga0209256_1019515 3300025299 Bacteria 2154
213 Ga0209256_1026701 3300025299 Bacteria 1658
214 Ga0207426_1037330 3300025302 Bacteria 1537
215 Ga0209051_1002501 3300025303 Bacteria 13095
216 Ga0209257_1000197 3300025304 Bacteria 149491
217 Ga0209257_1000219 3300025304 Bacteria 135666
218 Ga0209257_1000398 3300025304 Bacteria 85573
219 Ga0209257_1002658 3300025304 Bacteria 17158
220 Ga0209257_1005158 3300025304 Bacteria 9428
221 Ga0209257_1007310 3300025304 Bacteria 6713
222 Ga0209257_1052460 3300025304 Bacteria 1145
223 Ga0207655_1035491 3300025728 Bacteria 2225
224 Ga0207713_1000308 3300025735 Bacteria 55649
225 Ga0207680_10347997 3300025903 Bacteria 1041
226 Ga0207645_10443976 3300025907 Bacteria 875
227 Ga0207705_10220560 3300025909 Bacteria 1440
228 Ga0207707_10342249 3300025912 Bacteria 1289
229 Ga0207695_10096244 3300025913 Bacteria 2962
230 Ga0207695_10457337 3300025913 Bacteria 1159
231 Ga0207671_10154226 3300025914 Bacteria 1776
232 Ga0207657_10058452 3300025919 Bacteria 3318
233 Ga0207657_10070736 3300025919 Bacteria 2956
234 Ga0207652_10146368 3300025921 Bacteria 2115
235 Ga0207681_10007224 3300025923 Bacteria 6811
236 Ga0207694_10038584 3300025924 Bacteria 3673
237 Ga0207650_10002715 3300025925 Bacteria 12222
238 Ga0207650_10103124 3300025925 Bacteria 2199
239 Ga0207650_10179923 3300025925 Bacteria 1685
240 Ga0207687_10214790 3300025927 Bacteria 1511
241 Ga0207687_10328628 3300025927 Bacteria 1240
242 Ga0207644_10181968 3300025931 Bacteria 1648
243 Ga0207644_10226644 3300025931 Bacteria 1483
244 Ga0207644_10467463 3300025931 Bacteria 1037
245 Ga0207690_10154812 3300025932 Bacteria 1703
246 Ga0207669_10246726 3300025937 Bacteria 1327
247 Ga0207691_10005846 3300025940 Bacteria 11899
248 Ga0207691_10061448 3300025940 Bacteria 3412
249 Ga0207711_10036838 3300025941 Bacteria 4152
250 Ga0207679_10690337 3300025945 Bacteria 926
251 Ga0207667_10009464 3300025949 Bacteria 11473
252 Ga0207667_10010770 3300025949 Bacteria 10666
253 Ga0207667_10971268 3300025949 Bacteria 838
254 Ga0207651_10156355 3300025960 Bacteria 1782
255 Ga0207651_10647152 3300025960 Bacteria 928
256 Ga0207712_10113205 3300025961 Bacteria 2039
257 Ga0207668_10024530 3300025972 Bacteria 3894
258 Ga0207668_10045337 3300025972 Bacteria 2998
259 Ga0207640_10163346 3300025981 Bacteria 1650
260 Ga0207658_10613574 3300025986 Bacteria 978
261 Ga0207677_10135809 3300026023 Bacteria 1875
262 Ga0207639_10000875 3300026041 Bacteria 20410
263 Ga0207639_10029329 3300026041 Bacteria 4026
264 Ga0207678_10190706 3300026067 Bacteria 1751
265 Ga0207708_10942817 3300026075 Bacteria 748
266 Ga0207702_10000146 3300026078 Bacteria 82931
267 Ga0207702_10002055 3300026078 Bacteria 19488
268 Ga0207702_10176413 3300026078 Bacteria 1964
269 Ga0207702_10450038 3300026078 Bacteria 1249
270 Ga0207641_10006719 3300026088 Bacteria 9638
271 Ga0207641_10145240 3300026088 Bacteria 2144
272 Ga0207648_10039436 3300026089 Bacteria 4153
273 Ga0207648_10082373 3300026089 Bacteria 2806
274 Ga0207676_10049863 3300026095 Bacteria 3260
275 Ga0207674_10408010 3300026116 Bacteria 1313
276 Ga0207683_10017482 3300026121 Bacteria 6112
277 Ga0207683_10438810 3300026121 Bacteria 1203
278 Ga0207698_10504371 3300026142 Bacteria 1178
279 Ga0209371_1000007 3300027312 Bacteria 1050654
280 Ga0209371_1000088 3300027312 Bacteria 174446
281 Ga0209984_1004938 3300027424 Bacteria 1587
282 Ga0209999_1002279 3300027543 Bacteria 3374
283 Ga0209982_1001195 3300027552 Bacteria 3494
284 Ga0210002_1010976 3300027617 Bacteria 1397
285 Ga0209971_1000510 3300027682 Bacteria 10315
286 Ga0209974_10016931 3300027876 Bacteria 2419
287 Ga0268266_10350583 3300028379 Bacteria 1387
288 Ga0268266_10470814 3300028379 Bacteria 1196
289 Ga0268264_10019661 3300028381 Bacteria 5517
290 Ga0268264_10100415 3300028381 Bacteria 2513
291 Ga0268256_1000008 3300030500 Bacteria 1050654
292 Ga0268256_1000079 3300030500 Bacteria 174445
293 Ga0316177_1030551 3300030731 Bacteria 2214
294 Ga0316176_1219515 3300030732 Bacteria 2460
295 Ga0314311_1091964 3300030733 Bacteria 770
296 Ga0316183_1028100 3300030742 Bacteria 10382
297 Ga0316181_1105556 3300030744 Bacteria 927
298 Ga0316181_1159105 3300030744 Bacteria 1056
299 Ga0307513_10009744 3300031456 Bacteria 12133
300 Ga0307513_10222824 3300031456 Bacteria 1705
301 Ga0307513_10407653 3300031456 Bacteria 1092
302 Ga0307408_100333443 3300031548 Bacteria 1282
303 Ga0307413_10001486 3300031824 Bacteria 8939
304 Ga0307406_10000893 3300031901 Bacteria 16767
305 Ga0307412_10133323 3300031911 Bacteria 1808
306 Ga0307412_10615909 3300031911 Bacteria 921
307 Ga0307409_101037371 3300031995 Bacteria 839
308 Ga0307416_100025559 3300032002 Bacteria 4331
309 Ga0307416_100503419 3300032002 Bacteria 1276
310 Ga0307414_10001352 3300032004 Bacteria 12689
311 Ga0307414_10014804 3300032004 Bacteria 4689
312 Ga0307414_10053946 3300032004 Bacteria 2806
313 Ga0307414_10055842 3300032004 Bacteria 2766
314 Ga0307414_10059254 3300032004 Bacteria 2702
315 Ga0307414_10070568 3300032004 Bacteria 2516
316 Ga0307414_10089863 3300032004 Bacteria 2278
317 Ga0307414_10148199 3300032004 Bacteria 1847
318 Ga0307414_10207486 3300032004 Bacteria 1599
319 Ga0307414_10247902 3300032004 Bacteria 1478
320 Ga0307414_10334948 3300032004 Bacteria 1293
321 Ga0307414_10467162 3300032004 Bacteria 1110
322 Ga0307414_10569467 3300032004 Bacteria 1012
323 Ga0307414_10783852 3300032004 Bacteria 868
324 Ga0307411_10253182 3300032005 Bacteria 1386
325 Ga0307411_10561459 3300032005 Bacteria 975
326 Ga0307411_10714851 3300032005 Bacteria 874
327 Ga0307411_10757083 3300032005 Bacteria 851
328 Ga0307507_10082628 3300033179 Bacteria 2815
329 Ga0395900_0617477 3300037418 Bacteria 1023
330 Ga0395905_0024375 3300037471 Bacteria 5711
331 Ga0395905_0089715 3300037471 Bacteria 2881
332 Ga0395905_0652292 3300037471 Bacteria 954
333 Ga0395905_1033137 3300037471 Bacteria 725
334 Ga0395901_0744431 3300038443 Bacteria 974
335 Ga0237819_00086 3300038705 Bacteria 34074
336 Ga0237819_04279 3300038705 Bacteria 2367
337 Ga0237816_00871 3300039145 Bacteria 2484
338 Ga0439436_0005757 3300041404 Bacteria 3798
339 Ga0439436_0013082 3300041404 Bacteria 2513
340 Ga0439436_0027151 3300041404 Bacteria 1676
341 Ga0439447_002480 3300041407 Bacteria 6715
342 Ga0439466_0177339 3300041411 Bacteria 650
343 Ga0439465_0000188 3300041413 Bacteria 16060
344 Ga0439465_0037939 3300041413 Bacteria 1551
345 Ga0451791_1144279 3300041451 Bacteria 1147
346 Ga0451791_1395984 3300041451 Bacteria 2389
347 Ga0451793_1363583 3300041452 Bacteria 1155
348 Ga0451795_0386975 3300041456 Bacteria 3988
349 Ga0451798_0238264 3300041458 Bacteria 1110
350 Ga0451800_0050201 3300041459 Bacteria 3236
351 Ga0451802_2059014 3300041460 Bacteria 1420
352 Ga0451806_181564 3300041462 Bacteria 4991
353 Ga0451807_0167261 3300041486 Bacteria 3500
354 Ga0451807_1947013 3300041486 Bacteria 1106
355 Ga0451807_2311189 3300041486 Bacteria 1438
356 Ga0451841_1335413 3300041498 Bacteria 1606
357 Ga0451843_0275293 3300041509 Bacteria 976
358 Ga0451843_0554322 3300041509 Bacteria 2160
359 Ga0451843_0680867 3300041509 Bacteria 2246
360 Ga0451843_1443994 3300041509 Bacteria 1185
361 Ga0451843_1634157 3300041509 Bacteria 2171
362 Ga0439432_041679 3300042006 Bacteria 1453
363 Ga0439449_0000372 3300042007 Bacteria 16510
364 Ga0439449_0007700 3300042007 Bacteria 4088
365 Ga0439449_0014547 3300042007 Bacteria 2958
366 Ga0439449_0024320 3300042007 Bacteria 2265
367 Ga0439449_0037767 3300042007 Bacteria 1796
368 Ga0439449_0051399 3300042007 Bacteria 1524
369 Ga0439462_0019246 3300042015 Bacteria 1776
370 Ga0439462_0042820 3300042015 Bacteria 1210
371 Ga0439462_0054013 3300042015 Bacteria 1082
372 Ga0439462_0106542 3300042015 Bacteria 775
373 Ga0450898_075319 3300042134 Bacteria 681
374 Ga0439446_0116738 3300042156 Bacteria 856
375 Ga0450909_031099 3300042185 Bacteria 810
376 Ga0451577_0063323 3300042876 Bacteria 3298
377 Ga0451577_0288181 3300042876 Bacteria 1488
378 Ga0453684_0000136 3300044712 Bacteria 323402
379 Ga0451576_0000025 3300045051 Bacteria 427980
380 Ga0466967_0413839 3300045976 Bacteria 1313
381 Ga0495591_104611 3300046458 Bacteria 699
382 Ga0495638_0009889 3300046460 Bacteria 6658
383 Ga0495638_0050207 3300046460 Bacteria 2606
384 Ga0495638_0076352 3300046460 Bacteria 2041
385 Ga0495641_0109478 3300046461 Bacteria 1233
386 Ga0495607_0023460 3300046501 Bacteria 3862
387 Ga0495606_0021534 3300046507 Bacteria 4721
388 Ga0495616_0054766 3300046513 Bacteria 1977
389 Ga0495643_0003501 3300046522 Bacteria 11438
390 Ga0495663_0000508 3300046525 Bacteria 14012
391 Ga0495663_0016819 3300046525 Bacteria 2069
392 Ga0495663_0083935 3300046525 Bacteria 1029
393 Ga0495663_0108860 3300046525 Bacteria 919
394 Ga0495598_0006234 3300046537 Bacteria 2685
395 Ga0495598_0044892 3300046537 Bacteria 1307
396 Ga0495621_0001450 3300046539 Bacteria 6146
397 Ga0495621_0039165 3300046539 Bacteria 1657
398 Ga0495621_0106794 3300046539 Bacteria 1070
399 Ga0495633_0009804 3300046558 Bacteria 5264
400 Ga0495633_0118825 3300046558 Bacteria 1224
401 Ga0495656_0000871 3300046615 Bacteria 9767
402 Ga0495656_0003648 3300046615 Bacteria 5219
403 Ga0495656_0110559 3300046615 Bacteria 1284
404 Ga0495656_0412434 3300046615 Bacteria 708
405 Ga0495625_0157813 3300046660 Bacteria 1521
406 Ga0495670_0047404 3300046691 Bacteria 2148
407 Ga0495660_0149268 3300046810 Bacteria 1156
408 Ga0495636_0004393 3300047318 Bacteria 5526
409 Ga0495636_0004926 3300047318 Bacteria 5234
410 Ga0495636_0010126 3300047318 Bacteria 3717
411 Ga0495636_0212482 3300047318 Bacteria 886
412 Ga0495672_0000115 3300047320 Bacteria 127462
413 Ga0495681_0049736 3300047470 Bacteria 1980
414 Ga0495686_0011691 3300047472 Bacteria 6181
415 Ga0495686_0079153 3300047472 Bacteria 2010
416 Ga0496101_0057128 3300048904 Bacteria 2822
417 Ga0496105_0264641 3300048908 Bacteria 1390
418 Ga0496107_0024367 3300048910 Bacteria 4281
419 Ga0496108_0288375 3300048911 Bacteria 1429
420 Ga0496109_0032569 3300048912 Bacteria 4686
421 Ga0496110_0161290 3300048913 Bacteria 2032
422 Ga0496112_0036495 3300048915 Bacteria 4795
423 Ga0496113_0020472 3300048916 Bacteria 4651
424 Ga0496114_0025731 3300048917 Bacteria 4812
425 Ga0496114_0366094 3300048917 Bacteria 1275
426 Ga0496116_0044520 3300048919 Bacteria 3013
427 Ga0496116_0114526 3300048919 Bacteria 1575
428 Ga0496117_0003709 3300048920 Bacteria 17537
429 Ga0496117_0004975 3300048920 Bacteria 14253
430 Ga0496117_0082946 3300048920 Bacteria 2097
431 Ga0496117_0083237 3300048920 Bacteria 2092
432 Ga0496118_0005082 3300048921 Bacteria 15147
433 Ga0496118_0014552 3300048921 Bacteria 7355
434 Ga0496118_0027638 3300048921 Bacteria 4794
435 Ga0496118_0032519 3300048921 Bacteria 4295
436 Ga0496118_0209250 3300048921 Bacteria 1146
437 Ga0496118_0233652 3300048921 Bacteria 1059
438 Ga0496118_0274099 3300048921 Bacteria 943
439 Ga0496119_0000654 3300048922 Bacteria 46601
440 Ga0496119_0010493 3300048922 Bacteria 7787
441 Ga0496120_0000220 3300048923 Bacteria 98722
442 Ga0496120_0002845 3300048923 Bacteria 16670
443 Ga0496121_0001534 3300048924 Bacteria 38645
444 Ga0496121_0077833 3300048924 Bacteria 2639
445 Ga0496122_0017091 3300048925 Bacteria 6807
446 Ga0496122_0071726 3300048925 Bacteria 2467
447 Ga0496122_0129124 3300048925 Bacteria 1610
448 Ga0496123_0005623 3300048926 Bacteria 12520
449 Ga0496123_0137835 3300048926 Bacteria 1339
450 Ga0496124_0000052 3300048927 Bacteria 252750
451 Ga0496124_0016914 3300048927 Bacteria 6909
452 Ga0496124_0039548 3300048927 Bacteria 4087
453 Ga0496124_0059437 3300048927 Bacteria 3211
454 Ga0496124_0061500 3300048927 Bacteria 3147
455 Ga0496124_0088736 3300048927 Bacteria 2526
456 Ga0496124_0100562 3300048927 Bacteria 2343
457 Ga0496124_0335414 3300048927 Bacteria 1076
458 Ga0496124_0681734 3300048927 Bacteria 654
459 Ga0496125_0049579 3300048928 Bacteria 3487
460 Ga0496125_0069686 3300048928 Bacteria 2757
461 Ga0496125_0095019 3300048928 Bacteria 2219
462 Ga0496125_0106929 3300048928 Bacteria 2040
463 Ga0496125_0110962 3300048928 Bacteria 1986
464 Ga0496126_0025761 3300048929 Bacteria 5651
465 Ga0496126_0109189 3300048929 Bacteria 2411
466 Ga0501290_001703 3300049513 Bacteria 2946
467 Ga0501290_040793 3300049513 Bacteria 695
468 Ga0501031_0010185 3300049568 Bacteria 6125
469 Ga0501031_0013173 3300049568 Bacteria 5397
470 Ga0501031_0023652 3300049568 Bacteria 4005
471 Ga0501032_0000861 3300049569 Bacteria 24667
472 Ga0501032_0046728 3300049569 Bacteria 2925
473 Ga0501032_0352129 3300049569 Bacteria 949
474 Ga0501033_0002953 3300049570 Bacteria 14216
475 Ga0501034_0002645 3300049571 Bacteria 21210
476 Ga0501034_0004187 3300049571 Bacteria 16100
477 Ga0501034_0013841 3300049571 Bacteria 8303
478 Ga0501034_0014481 3300049571 Bacteria 8122
479 Ga0501034_0029607 3300049571 Bacteria 5567
480 Ga0501034_0070524 3300049571 Bacteria 3505
481 Ga0501034_0101270 3300049571 Bacteria 2874
482 Ga0501034_0347057 3300049571 Bacteria 1413
483 Ga0501036_0044821 3300049572 Bacteria 3747
484 Ga0501036_0249323 3300049572 Bacteria 1488
485 Ga0501036_0285427 3300049572 Bacteria 1381
486 Ga0501037_0025191 3300049573 Bacteria 4396
487 Ga0501038_0021654 3300049574 Bacteria 5768
488 Ga0501039_0010990 3300049575 Bacteria 6898
489 Ga0501039_0033067 3300049575 Bacteria 3990
490 Ga0501043_0001297 3300049579 Bacteria 21899
491 Ga0501043_0012432 3300049579 Bacteria 6658
492 Ga0501043_0192766 3300049579 Bacteria 1584
493 Ga0501046_0011941 3300049580 Bacteria 7410
494 Ga0501047_0001267 3300049581 Bacteria 24996
495 Ga0501047_0018651 3300049581 Bacteria 6653
496 Ga0501047_0038407 3300049581 Bacteria 4632
497 Ga0501048_0092155 3300049582 Bacteria 2137
498 Ga0501068_0049472 3300049584 Bacteria 2539
499 Ga0501068_0575371 3300049584 Bacteria 733
500 Ga0501070_0001141 3300049586 Bacteria 23846
501 Ga0501070_0054233 3300049586 Bacteria 3324
502 Ga0501070_0081991 3300049586 Bacteria 2669
503 Ga0501070_0164670 3300049586 Bacteria 1827
504 Ga0501070_0225410 3300049586 Bacteria 1536
505 Ga0501073_0027475 3300049589 Bacteria 4068
506 Ga0501073_0063076 3300049589 Bacteria 2585
507 Ga0501073_0119897 3300049589 Bacteria 1823
508 Ga0501073_0183707 3300049589 Bacteria 1447
509 Ga0501074_0008501 3300049590 Bacteria 7439
510 Ga0501259_014108 3300049688 Bacteria 1351
511 Ga0501225_0004448 3300049705 Bacteria 4174
512 Ga0501080_0002402 3300049742 Bacteria 16339
513 Ga0501080_0061964 3300049742 Bacteria 3481
514 Ga0501080_0200301 3300049742 Bacteria 1833
515 Ga0501080_0305795 3300049742 Bacteria 1441
516 Ga0501265_000418 3300049762 Bacteria 4427
517 Ga0501275_001553 3300049772 Bacteria 2231
518 Ga0501035_0005993 3300049822 Bacteria 11447
519 Ga0501035_0197727 3300049822 Bacteria 1726
520 Ga0501044_0003895 3300049823 Bacteria 16723
521 Ga0501044_0030783 3300049823 Bacteria 5653
522 nmdc:mga00v17_308681_c1 3300050491 Bacteria 1028
523 nmdc:mga00v17_39317_c1 3300050491 Bacteria 2833
524 Ga0500559_0084092 3300053136 Bacteria 1450
525 Ga0500634_0000120 3300053161 Bacteria 29519
526 Ga0500565_005688 3300053734 Bacteria 1112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0197727 Ga0501035_0197727_1151_1687 174
2 3300005330 Ga0070690_100049799 Ga0070690_1000497994 178
3 3300005334 Ga0068869_100086340 Ga0068869_1000863403 178
4 3300005355 Ga0070671_100298163 Ga0070671_1002981632 178
5 3300005366 Ga0070659_100028624 Ga0070659_1000286245 178
6 3300005367 Ga0070667_100041584 Ga0070667_1000415842 178
7 3300005564 Ga0070664_100312333 Ga0070664_1003123331 178
8 3300005614 Ga0068856_100170952 Ga0068856_1001709522 178
9 3300005841 Ga0068863_100667292 Ga0068863_1006672922 178
10 3300005842 Ga0068858_100032817 Ga0068858_1000328175 178
11 3300006881 Ga0068865_100412350 Ga0068865_1004123502 178
12 3300009093 Ga0105240_10283230 Ga0105240_102832302 178
13 3300009551 Ga0105238_10102803 Ga0105238_101028034 178
14 3300011119 Ga0105246_10005258 Ga0105246_100052585 178
15 3300013307 Ga0157372_10222205 Ga0157372_102222052 178
16 3300025949 Ga0207667_10010770 Ga0207667_100107709 178
17 3300025981 Ga0207640_10163346 Ga0207640_101633462 178
18 3300026078 Ga0207702_10450038 Ga0207702_104500382 178
19 3300028381 Ga0268264_10100415 Ga0268264_101004154 178
20 3300049572 Ga0501036_0285427 Ga0501036_0285427_810_1367 181
21 3300033179 Ga0307507_10082628 Ga0307507_100826284 183
22 3300037471 Ga0395905_0089715 Ga0395905_0089715_537_1235 184
23 3300009993 Ga0105028_108849 Ga0105028_1088492 185
24 3300041509 Ga0451843_1443994 Ga0451843_1443994_323_976 187
25 iso_pu_bacteria 2842780639 2842781733 187
26 iso_pu_bacteria 8002869464 8002871277 187
27 iso_pu_bacteria 2524614729 2525558090 188
28 iso_pu_bacteria 2627854209 2630649893 188
29 iso_pu_bacteria 2643221579 2643907154 188
30 iso_pu_bacteria 2923516293 2923519392 188
31 iso_pu_bacteria 2571042365 2572254753 189
32 iso_pu_bacteria 2643221559 2643815488 189
33 iso_pu_bacteria 2643221573 2643881831 189
34 iso_pu_bacteria 2643221586 2643941215 189
35 iso_pu_bacteria 2643221593 2643972957 189
36 iso_pu_bacteria 2643221612 2644079712 189
37 iso_pu_bacteria 2643221720 2644663013 189
38 iso_pu_bacteria 2643221727 2644696137 189
39 iso_pu_bacteria 2643221728 2644699831 189
40 iso_pu_bacteria 2894414249 2894417944 189
41 iso_pu_bacteria 2895498888 2895499530 189
42 iso_pu_bacteria 2895511927 2895512553 189
43 iso_pu_bacteria 2895522137 2895522566 189
44 iso_pu_bacteria 2895525241 2895525671 189
45 iso_pu_bacteria 2919513703 2919515505 189
46 iso_pu_bacteria 2919675420 2919675862 189
47 iso_pu_bacteria 2941489479 2941490982 189
48 iso_pu_bacteria 2995948881 2995950016 189
49 iso_pu_bacteria 8003014200 8003015159 189
50 3300032004 Ga0307414_10207486 Ga0307414_102074862 190
51 3300032005 Ga0307411_10757083 Ga0307411_107570832 190
52 3300046461 Ga0495641_0109478 Ga0495641_0109478_366_965 190
53 3300049569 Ga0501032_0352129 Ga0501032_0352129_94_693 190
54 3300049571 Ga0501034_0004187 Ga0501034_0004187_317_901 190
55 3300049571 Ga0501034_0029607 Ga0501034_0029607_1373_1972 190
56 3300049579 Ga0501043_0192766 Ga0501043_0192766_382_981 190
57 3300049581 Ga0501047_0001267 Ga0501047_0001267_5426_6025 190
58 3300049581 Ga0501047_0018651 Ga0501047_0018651_2371_2955 190
59 3300049584 Ga0501068_0575371 Ga0501068_0575371_39_623 190
60 3300049586 Ga0501070_0054233 Ga0501070_0054233_2615_3214 190
61 3300049586 Ga0501070_0164670 Ga0501070_0164670_205_804 190
62 3300049586 Ga0501070_0225410 Ga0501070_0225410_107_706 190
63 3300049589 Ga0501073_0119897 Ga0501073_0119897_1180_1764 190
64 3300049589 Ga0501073_0183707 Ga0501073_0183707_275_874 190
65 3300049590 Ga0501074_0008501 Ga0501074_0008501_50_649 190
66 3300049742 Ga0501080_0002402 Ga0501080_0002402_15455_16054 190
67 3300053136 Ga0500559_0084092 Ga0500559_0084092_655_1254 190
68 iso_pu_bacteria 2576861471 2578457289 190
69 iso_pu_bacteria 2747842501 2748016686 190
70 iso_pu_bacteria 2818991457 2819660882 190
71 iso_pu_bacteria 2842757796 2842759983 190
72 iso_pu_bacteria 2852649853 2852652405 190
73 iso_pu_bacteria 2852684882 2852686758 190
74 iso_pu_bacteria 2857442823 2857446643 190
75 iso_pu_bacteria 2919130084 2919134036 190
76 iso_pu_bacteria 2929195423 2929196686 190
77 iso_pu_bacteria 2939589442 2939589499 190
78 iso_pu_bacteria 2939622612 2939626012 190
79 iso_pu_bacteria 2941475908 2941479024 190
80 iso_pu_bacteria 2977247770 2977248663 190
81 iso_pu_bacteria 2984514374 2984516868 190
82 iso_pu_bacteria 8021622325 8021623629 190
83 iso_pu_bacteria 8021626552 8021627449 190
84 iso_pu_bacteria 8021648035 8021650584 190
85 3300003794 Ga0055531_10029172 Ga0055531_100291722 191
86 3300005339 Ga0070660_100032872 Ga0070660_1000328723 191
87 3300005366 Ga0070659_100158029 Ga0070659_1001580292 191
88 3300005564 Ga0070664_100171320 Ga0070664_1001713202 191
89 3300005578 Ga0068854_100314033 Ga0068854_1003140332 191
90 3300013102 Ga0157371_10045144 Ga0157371_100451443 191
91 3300013105 Ga0157369_10036315 Ga0157369_100363155 191
92 3300014497 Ga0182008_10098395 Ga0182008_100983951 191
93 3300025304 Ga0209257_1000219 Ga0209257_100021963 191
94 3300025909 Ga0207705_10220560 Ga0207705_102205602 191
95 3300025912 Ga0207707_10342249 Ga0207707_103422492 191
96 3300025919 Ga0207657_10058452 Ga0207657_100584523 191
97 3300025919 Ga0207657_10070736 Ga0207657_100707362 191
98 3300025921 Ga0207652_10146368 Ga0207652_101463682 191
99 3300025925 Ga0207650_10179923 Ga0207650_101799232 191
100 3300025931 Ga0207644_10181968 Ga0207644_101819683 191
101 3300030744 Ga0316181_1105556 Ga0316181_11055561 191
102 3300032004 Ga0307414_10059254 Ga0307414_100592543 191
103 3300038443 Ga0395901_0744431 Ga0395901_0744431_224_808 191
104 3300041413 Ga0439465_0000188 Ga0439465_0000188_5387_5971 191
105 3300041509 Ga0451843_0275293 Ga0451843_0275293_332_922 191
106 3300041509 Ga0451843_0680867 Ga0451843_0680867_218_808 191
107 3300042007 Ga0439449_0000372 Ga0439449_0000372_10909_11493 191
108 3300042007 Ga0439449_0014547 Ga0439449_0014547_1120_1704 191
109 3300042007 Ga0439449_0037767 Ga0439449_0037767_1145_1741 191
110 3300046501 Ga0495607_0023460 Ga0495607_0023460_1819_2406 191
111 3300046507 Ga0495606_0021534 Ga0495606_0021534_758_1345 191
112 3300046810 Ga0495660_0149268 Ga0495660_0149268_481_1068 191
113 3300047470 Ga0495681_0049736 Ga0495681_0049736_885_1472 191
114 3300048911 Ga0496108_0288375 Ga0496108_0288375_549_1133 191
115 3300048927 Ga0496124_0000052 Ga0496124_0000052_69086_69673 191
116 3300049705 Ga0501225_0004448 Ga0501225_0004448_2835_3419 191
117 2162886007 SwRhRL2b_contig_2451917 SwRhRL2b_0288.00006300 192
118 3300001979 JGI24740J21852_10001629 JGI24740J21852_100016292 192
119 3300001989 JGI24739J22299_10000146 JGI24739J22299_100001468 192
120 3300001990 JGI24737J22298_10006361 JGI24737J22298_100063612 192
121 3300003578 Ga0006562J51391_1017735 Ga0006562J51391_10177358 192
122 3300003578 Ga0006562J51391_1017736 Ga0006562J51391_10177362 192
123 3300003781 Ga0055536_1017439 Ga0055536_10174392 192
124 3300003794 Ga0055531_10017613 Ga0055531_100176132 192
125 3300005289 Ga0065704_10071669 Ga0065704_100716698 192
126 3300005328 Ga0070676_10229965 Ga0070676_102299652 192
127 3300005331 Ga0070670_100137868 Ga0070670_1001378682 192
128 3300005347 Ga0070668_100002000 Ga0070668_10000200012 192
129 3300005353 Ga0070669_100904813 Ga0070669_1009048131 192
130 3300005355 Ga0070671_100052827 Ga0070671_1000528272 192
131 3300005356 Ga0070674_100493127 Ga0070674_1004931271 192
132 3300005455 Ga0070663_100704043 Ga0070663_1007040432 192
133 3300005459 Ga0068867_100174022 Ga0068867_1001740222 192
134 3300005543 Ga0070672_100058392 Ga0070672_1000583921 192
135 3300005543 Ga0070672_100083740 Ga0070672_1000837402 192
136 3300005543 Ga0070672_100325996 Ga0070672_1003259962 192
137 3300005548 Ga0070665_100180839 Ga0070665_1001808393 192
138 3300005548 Ga0070665_100285374 Ga0070665_1002853742 192
139 3300005563 Ga0068855_100093652 Ga0068855_1000936523 192
140 3300005564 Ga0070664_100324834 Ga0070664_1003248341 192
141 3300005577 Ga0068857_100000296 Ga0068857_1000002965 192
142 3300005578 Ga0068854_100025565 Ga0068854_1000255654 192
143 3300005614 Ga0068856_100000465 Ga0068856_10000046528 192
144 3300005614 Ga0068856_100065466 Ga0068856_1000654662 192
145 3300005616 Ga0068852_100038917 Ga0068852_1000389172 192
146 3300005617 Ga0068859_100338380 Ga0068859_1003383802 192
147 3300005618 Ga0068864_100830360 Ga0068864_1008303601 192
148 3300005718 Ga0068866_10413665 Ga0068866_104136652 192
149 3300005834 Ga0068851_10316089 Ga0068851_103160892 192
150 3300005841 Ga0068863_100021195 Ga0068863_1000211955 192
151 3300005841 Ga0068863_100261627 Ga0068863_1002616272 192
152 3300005842 Ga0068858_100011969 Ga0068858_1000119692 192
153 3300005842 Ga0068858_100240995 Ga0068858_1002409952 192
154 3300005843 Ga0068860_100019791 Ga0068860_1000197914 192
155 3300006237 Ga0097621_100104213 Ga0097621_1001042134 192
156 3300006931 Ga0097620_100338339 Ga0097620_1003383392 192
157 3300009093 Ga0105240_10044369 Ga0105240_100443694 192
158 3300009093 Ga0105240_10050733 Ga0105240_100507332 192
159 3300009098 Ga0105245_10141987 Ga0105245_101419872 192
160 3300009148 Ga0105243_10164867 Ga0105243_101648672 192
161 3300009174 Ga0105241_10574509 Ga0105241_105745092 192
162 3300009177 Ga0105248_10200542 Ga0105248_102005422 192
163 3300009177 Ga0105248_10249393 Ga0105248_102493933 192
164 3300009545 Ga0105237_10000084 Ga0105237_1000008448 192
165 3300010375 Ga0105239_10616646 Ga0105239_106166462 192
166 3300011119 Ga0105246_10074299 Ga0105246_100742992 192
167 3300012500 Ga0157314_1000056 Ga0157314_10000563 192
168 3300012500 Ga0157314_1005470 Ga0157314_10054702 192
169 3300013105 Ga0157369_10004138 Ga0157369_100041387 192
170 3300013296 Ga0157374_10036874 Ga0157374_100368744 192
171 3300013296 Ga0157374_10865635 Ga0157374_108656352 192
172 3300013306 Ga0163162_10315666 Ga0163162_103156663 192
173 3300013308 Ga0157375_10005495 Ga0157375_100054956 192
174 3300013308 Ga0157375_10788002 Ga0157375_107880022 192
175 3300014325 Ga0163163_10000024 Ga0163163_1000002438 192
176 3300014325 Ga0163163_10001536 Ga0163163_100015368 192
177 3300014325 Ga0163163_10117007 Ga0163163_101170072 192
178 3300014968 Ga0157379_10003746 Ga0157379_100037464 192
179 3300025292 Ga0209676_1000129 Ga0209676_1000129107 192
180 3300025304 Ga0209257_1000197 Ga0209257_100019767 192
181 3300025907 Ga0207645_10443976 Ga0207645_104439762 192
182 3300025913 Ga0207695_10096244 Ga0207695_100962442 192
183 3300025913 Ga0207695_10457337 Ga0207695_104573372 192
184 3300025925 Ga0207650_10103124 Ga0207650_101031243 192
185 3300025927 Ga0207687_10214790 Ga0207687_102147902 192
186 3300025931 Ga0207644_10467463 Ga0207644_104674631 192
187 3300025937 Ga0207669_10246726 Ga0207669_102467262 192
188 3300025940 Ga0207691_10005846 Ga0207691_100058466 192
189 3300025940 Ga0207691_10061448 Ga0207691_100614483 192
190 3300025941 Ga0207711_10036838 Ga0207711_100368386 192
191 3300025945 Ga0207679_10690337 Ga0207679_106903372 192
192 3300025960 Ga0207651_10156355 Ga0207651_101563552 192
193 3300025960 Ga0207651_10647152 Ga0207651_106471522 192
194 3300026075 Ga0207708_10942817 Ga0207708_109428171 192
195 3300026078 Ga0207702_10000146 Ga0207702_1000014650 192
196 3300026078 Ga0207702_10002055 Ga0207702_1000205511 192
197 3300026088 Ga0207641_10006719 Ga0207641_100067198 192
198 3300026089 Ga0207648_10039436 Ga0207648_100394365 192
199 3300026095 Ga0207676_10049863 Ga0207676_100498632 192
200 3300028379 Ga0268266_10350583 Ga0268266_103505832 192
201 3300028381 Ga0268264_10019661 Ga0268264_100196613 192
202 3300031456 Ga0307513_10009744 Ga0307513_100097448 192
203 3300031456 Ga0307513_10222824 Ga0307513_102228242 192
204 3300031456 Ga0307513_10407653 Ga0307513_104076532 192
205 3300032002 Ga0307416_100025559 Ga0307416_1000255592 192
206 3300032004 Ga0307414_10001352 Ga0307414_100013525 192
207 3300032004 Ga0307414_10148199 Ga0307414_101481991 192
208 3300032004 Ga0307414_10247902 Ga0307414_102479022 192
209 3300032005 Ga0307411_10714851 Ga0307411_107148511 192
210 3300039145 Ga0237816_00871 Ga0237816_00871_49_636 192
211 3300041404 Ga0439436_0027151 Ga0439436_0027151_859_1443 192
212 3300041411 Ga0439466_0177339 Ga0439466_0177339_25_609 192
213 3300041413 Ga0439465_0037939 Ga0439465_0037939_775_1359 192
214 3300041451 Ga0451791_1144279 Ga0451791_1144279_190_810 192
215 3300041451 Ga0451791_1395984 Ga0451791_1395984_742_1326 192
216 3300041452 Ga0451793_1363583 Ga0451793_1363583_196_783 192
217 3300041456 Ga0451795_0386975 Ga0451795_0386975_982_1566 192
218 3300041458 Ga0451798_0238264 Ga0451798_0238264_399_986 192
219 3300041460 Ga0451802_2059014 Ga0451802_2059014_460_1044 192
220 3300041486 Ga0451807_2311189 Ga0451807_2311189_361_948 192
221 3300041498 Ga0451841_1335413 Ga0451841_1335413_211_795 192
222 3300041509 Ga0451843_0554322 Ga0451843_0554322_57_641 192
223 3300041509 Ga0451843_1634157 Ga0451843_1634157_917_1501 192
224 3300042007 Ga0439449_0007700 Ga0439449_0007700_2213_2797 192
225 3300042007 Ga0439449_0024320 Ga0439449_0024320_864_1451 192
226 3300042015 Ga0439462_0042820 Ga0439462_0042820_399_986 192
227 3300042015 Ga0439462_0054013 Ga0439462_0054013_168_752 192
228 3300042134 Ga0450898_075319 Ga0450898_075319_78_665 192
229 3300046513 Ga0495616_0054766 Ga0495616_0054766_395_979 192
230 3300046525 Ga0495663_0000508 Ga0495663_0000508_12_596 192
231 3300046525 Ga0495663_0083935 Ga0495663_0083935_329_916 192
232 3300046525 Ga0495663_0108860 Ga0495663_0108860_45_632 192
233 3300046537 Ga0495598_0006234 Ga0495598_0006234_1411_1995 192
234 3300046539 Ga0495621_0001450 Ga0495621_0001450_2904_3491 192
235 3300046539 Ga0495621_0106794 Ga0495621_0106794_224_808 192
236 3300046615 Ga0495656_0003648 Ga0495656_0003648_3263_3850 192
237 3300046615 Ga0495656_0412434 Ga0495656_0412434_86_670 192
238 3300047318 Ga0495636_0004393 Ga0495636_0004393_421_1008 192
239 3300047318 Ga0495636_0212482 Ga0495636_0212482_14_601 192
240 3300048904 Ga0496101_0057128 Ga0496101_0057128_604_1191 192
241 3300048910 Ga0496107_0024367 Ga0496107_0024367_541_1128 192
242 3300048913 Ga0496110_0161290 Ga0496110_0161290_842_1429 192
243 3300048917 Ga0496114_0025731 Ga0496114_0025731_1493_2080 192
244 3300048917 Ga0496114_0366094 Ga0496114_0366094_301_888 192
245 3300048925 Ga0496122_0071726 Ga0496122_0071726_709_1293 192
246 3300048927 Ga0496124_0335414 Ga0496124_0335414_99_683 192
247 3300048929 Ga0496126_0109189 Ga0496126_0109189_1084_1671 192
248 3300049513 Ga0501290_040793 Ga0501290_040793_31_618 192
249 3300049571 Ga0501034_0002645 Ga0501034_0002645_7409_7996 192
250 3300049571 Ga0501034_0347057 Ga0501034_0347057_690_1277 192
251 3300049586 Ga0501070_0001141 Ga0501070_0001141_21815_22408 192
252 3300049742 Ga0501080_0305795 Ga0501080_0305795_342_935 192
253 3300003187 JGI25151J46595_10000500 JGI25151J46595_1000050028 193
254 3300003502 JGI26143J51219_1001329 JGI26143J51219_10013292 193
255 3300003771 Ga0055526_1000022 Ga0055526_1000022138 193
256 3300003771 Ga0055526_1024466 Ga0055526_10244661 193
257 3300003773 Ga0055537_1000643 Ga0055537_100064314 193
258 3300003775 Ga0055524_1000036 Ga0055524_1000036138 193
259 3300003781 Ga0055536_1013429 Ga0055536_10134292 193
260 3300003781 Ga0055536_1050781 Ga0055536_10507811 193
261 3300003784 Ga0055534_1000010 Ga0055534_100001013 193
262 3300003790 Ga0055528_1000014 Ga0055528_1000014138 193
263 3300003794 Ga0055531_10015799 Ga0055531_100157996 193
264 3300003794 Ga0055531_10036635 Ga0055531_100366353 193
265 3300003794 Ga0055531_10050745 Ga0055531_100507452 193
266 3300005288 Ga0065714_10012060 Ga0065714_100120601 193
267 3300005293 Ga0065715_10024945 Ga0065715_100249453 193
268 3300005293 Ga0065715_10063878 Ga0065715_100638782 193
269 3300005337 Ga0070682_100120428 Ga0070682_1001204282 193
270 3300005347 Ga0070668_100112448 Ga0070668_1001124482 193
271 3300005355 Ga0070671_100119403 Ga0070671_1001194032 193
272 3300005367 Ga0070667_100729745 Ga0070667_1007297452 193
273 3300005455 Ga0070663_100447729 Ga0070663_1004477292 193
274 3300005539 Ga0068853_100013094 Ga0068853_1000130945 193
275 3300005539 Ga0068853_100042250 Ga0068853_1000422504 193
276 3300005539 Ga0068853_100226008 Ga0068853_1002260081 193
277 3300005563 Ga0068855_100014356 Ga0068855_1000143564 193
278 3300005577 Ga0068857_100336025 Ga0068857_1003360252 193
279 3300005616 Ga0068852_100436096 Ga0068852_1004360962 193
280 3300005617 Ga0068859_100052868 Ga0068859_1000528684 193
281 3300005719 Ga0068861_101163677 Ga0068861_1011636771 193
282 3300005841 Ga0068863_100180127 Ga0068863_1001801272 193
283 3300006048 Ga0075363_100091437 Ga0075363_1000914372 193
284 3300006051 Ga0075364_10051844 Ga0075364_100518443 193
285 3300006051 Ga0075364_10304821 Ga0075364_103048212 193
286 3300006931 Ga0097620_100052867 Ga0097620_1000528674 193
287 3300009098 Ga0105245_10658108 Ga0105245_106581081 193
288 3300009176 Ga0105242_10078915 Ga0105242_100789153 193
289 3300009551 Ga0105238_10050865 Ga0105238_100508653 193
290 3300009993 Ga0105028_102764 Ga0105028_1027642 193
291 3300010375 Ga0105239_10032650 Ga0105239_100326503 193
292 3300011119 Ga0105246_10885768 Ga0105246_108857681 193
293 3300013102 Ga0157371_10017058 Ga0157371_100170584 193
294 3300013297 Ga0157378_10064360 Ga0157378_100643604 193
295 3300013308 Ga0157375_10644855 Ga0157375_106448552 193
296 3300025245 Ga0207425_1006681 Ga0207425_10066813 193
297 3300025263 Ga0209565_1000001 Ga0209565_1000001844 193
298 3300025273 Ga0209673_1000001 Ga0209673_1000001844 193
299 3300025273 Ga0209673_1023716 Ga0209673_10237162 193
300 3300025284 Ga0209130_1002852 Ga0209130_10028528 193
301 3300025291 Ga0209675_1000001 Ga0209675_10000011688 193
302 3300025291 Ga0209675_1019995 Ga0209675_10199952 193
303 3300025292 Ga0209676_1000549 Ga0209676_100054939 193
304 3300025292 Ga0209676_1001552 Ga0209676_10015522 193
305 3300025292 Ga0209676_1003577 Ga0209676_10035775 193
306 3300025292 Ga0209676_1035623 Ga0209676_10356232 193
307 3300025292 Ga0209676_1036911 Ga0209676_10369112 193
308 3300025294 Ga0209025_1000006 Ga0209025_1000006248 193
309 3300025294 Ga0209025_1001865 Ga0209025_100186523 193
310 3300025294 Ga0209025_1039637 Ga0209025_10396372 193
311 3300025294 Ga0209025_1067454 Ga0209025_10674542 193
312 3300025295 Ga0209564_1000001 Ga0209564_10000011850 193
313 3300025295 Ga0209564_1033891 Ga0209564_10338912 193
314 3300025295 Ga0209564_1042153 Ga0209564_10421532 193
315 3300025297 Ga0209758_1018440 Ga0209758_10184402 193
316 3300025297 Ga0209758_1035076 Ga0209758_10350762 193
317 3300025297 Ga0209758_1052442 Ga0209758_10524423 193
318 3300025298 Ga0209050_1001795 Ga0209050_100179510 193
319 3300025298 Ga0209050_1016374 Ga0209050_10163743 193
320 3300025299 Ga0209256_1000006 Ga0209256_1000006286 193
321 3300025299 Ga0209256_1019515 Ga0209256_10195152 193
322 3300025299 Ga0209256_1026701 Ga0209256_10267013 193
323 3300025302 Ga0207426_1037330 Ga0207426_10373302 193
324 3300025304 Ga0209257_1000398 Ga0209257_100039848 193
325 3300025304 Ga0209257_1005158 Ga0209257_100515810 193
326 3300025304 Ga0209257_1052460 Ga0209257_10524602 193
327 3300025903 Ga0207680_10347997 Ga0207680_103479971 193
328 3300025914 Ga0207671_10154226 Ga0207671_101542262 193
329 3300025923 Ga0207681_10007224 Ga0207681_100072246 193
330 3300025924 Ga0207694_10038584 Ga0207694_100385843 193
331 3300025927 Ga0207687_10328628 Ga0207687_103286282 193
332 3300025931 Ga0207644_10226644 Ga0207644_102266443 193
333 3300025949 Ga0207667_10009464 Ga0207667_100094648 193
334 3300025949 Ga0207667_10971268 Ga0207667_109712681 193
335 3300025961 Ga0207712_10113205 Ga0207712_101132052 193
336 3300025972 Ga0207668_10024530 Ga0207668_100245303 193
337 3300025986 Ga0207658_10613574 Ga0207658_106135741 193
338 3300026023 Ga0207677_10135809 Ga0207677_101358092 193
339 3300026041 Ga0207639_10000875 Ga0207639_1000087520 193
340 3300026041 Ga0207639_10029329 Ga0207639_100293292 193
341 3300026067 Ga0207678_10190706 Ga0207678_101907062 193
342 3300026078 Ga0207702_10176413 Ga0207702_101764134 193
343 3300026088 Ga0207641_10145240 Ga0207641_101452402 193
344 3300026089 Ga0207648_10082373 Ga0207648_100823732 193
345 3300026116 Ga0207674_10408010 Ga0207674_104080102 193
346 3300026121 Ga0207683_10438810 Ga0207683_104388102 193
347 3300026142 Ga0207698_10504371 Ga0207698_105043712 193
348 3300027424 Ga0209984_1004938 Ga0209984_10049382 193
349 3300027543 Ga0209999_1002279 Ga0209999_10022792 193
350 3300027552 Ga0209982_1001195 Ga0209982_10011952 193
351 3300027617 Ga0210002_1010976 Ga0210002_10109762 193
352 3300027682 Ga0209971_1000510 Ga0209971_10005105 193
353 3300027876 Ga0209974_10016931 Ga0209974_100169312 193
354 3300030731 Ga0316177_1030551 Ga0316177_10305512 193
355 3300030733 Ga0314311_1091964 Ga0314311_10919641 193
356 3300031548 Ga0307408_100333443 Ga0307408_1003334432 193
357 3300031824 Ga0307413_10001486 Ga0307413_100014865 193
358 3300031901 Ga0307406_10000893 Ga0307406_1000089311 193
359 3300031911 Ga0307412_10133323 Ga0307412_101333232 193
360 3300031911 Ga0307412_10615909 Ga0307412_106159092 193
361 3300031995 Ga0307409_101037371 Ga0307409_1010373711 193
362 3300032002 Ga0307416_100503419 Ga0307416_1005034192 193
363 3300032004 Ga0307414_10014804 Ga0307414_100148043 193
364 3300032004 Ga0307414_10053946 Ga0307414_100539462 193
365 3300032004 Ga0307414_10055842 Ga0307414_100558422 193
366 3300032004 Ga0307414_10089863 Ga0307414_100898632 193
367 3300032004 Ga0307414_10334948 Ga0307414_103349481 193
368 3300032004 Ga0307414_10467162 Ga0307414_104671622 193
369 3300032004 Ga0307414_10569467 Ga0307414_105694672 193
370 3300032004 Ga0307414_10783852 Ga0307414_107838522 193
371 3300032005 Ga0307411_10253182 Ga0307411_102531822 193
372 3300032005 Ga0307411_10561459 Ga0307411_105614592 193
373 3300037418 Ga0395900_0617477 Ga0395900_0617477_291_881 193
374 3300037471 Ga0395905_0024375 Ga0395905_0024375_726_1316 193
375 3300037471 Ga0395905_0652292 Ga0395905_0652292_277_867 193
376 3300037471 Ga0395905_1033137 Ga0395905_1033137_68_658 193
377 3300041404 Ga0439436_0005757 Ga0439436_0005757_2172_2765 193
378 3300041404 Ga0439436_0013082 Ga0439436_0013082_817_1407 193
379 3300041486 Ga0451807_1947013 Ga0451807_1947013_413_1000 193
380 3300042007 Ga0439449_0051399 Ga0439449_0051399_190_780 193
381 3300042015 Ga0439462_0019246 Ga0439462_0019246_626_1216 193
382 3300042015 Ga0439462_0106542 Ga0439462_0106542_23_613 193
383 3300042156 Ga0439446_0116738 Ga0439446_0116738_109_702 193
384 3300042185 Ga0450909_031099 Ga0450909_031099_75_662 193
385 3300042876 Ga0451577_0063323 Ga0451577_0063323_321_917 193
386 3300042876 Ga0451577_0288181 Ga0451577_0288181_708_1304 193
387 3300044712 Ga0453684_0000136 Ga0453684_0000136_200857_201453 193
388 3300045051 Ga0451576_0000025 Ga0451576_0000025_226438_227034 193
389 3300045976 Ga0466967_0413839 Ga0466967_0413839_391_981 193
390 3300046460 Ga0495638_0050207 Ga0495638_0050207_567_1157 193
391 3300046537 Ga0495598_0044892 Ga0495598_0044892_255_845 193
392 3300046539 Ga0495621_0039165 Ga0495621_0039165_951_1541 193
393 3300046615 Ga0495656_0000871 Ga0495656_0000871_4000_4590 193
394 3300046615 Ga0495656_0110559 Ga0495656_0110559_27_617 193
395 3300046691 Ga0495670_0047404 Ga0495670_0047404_1197_1787 193
396 3300047318 Ga0495636_0004926 Ga0495636_0004926_2007_2597 193
397 3300047318 Ga0495636_0010126 Ga0495636_0010126_682_1272 193
398 3300048912 Ga0496109_0032569 Ga0496109_0032569_465_1055 193
399 3300048915 Ga0496112_0036495 Ga0496112_0036495_84_674 193
400 3300048916 Ga0496113_0020472 Ga0496113_0020472_2253_2843 193
401 3300048924 Ga0496121_0001534 Ga0496121_0001534_9324_9914 193
402 3300049513 Ga0501290_001703 Ga0501290_001703_2039_2626 193
403 3300049568 Ga0501031_0010185 Ga0501031_0010185_4566_5153 193
404 3300049568 Ga0501031_0013173 Ga0501031_0013173_3341_3934 193
405 3300049568 Ga0501031_0023652 Ga0501031_0023652_1783_2370 193
406 3300049569 Ga0501032_0000861 Ga0501032_0000861_9318_9911 193
407 3300049569 Ga0501032_0046728 Ga0501032_0046728_716_1303 193
408 3300049570 Ga0501033_0002953 Ga0501033_0002953_4196_4783 193
409 3300049571 Ga0501034_0013841 Ga0501034_0013841_4125_4718 193
410 3300049571 Ga0501034_0014481 Ga0501034_0014481_5498_6085 193
411 3300049571 Ga0501034_0070524 Ga0501034_0070524_2127_2714 193
412 3300049572 Ga0501036_0044821 Ga0501036_0044821_2613_3200 193
413 3300049572 Ga0501036_0249323 Ga0501036_0249323_145_738 193
414 3300049573 Ga0501037_0025191 Ga0501037_0025191_1909_2496 193
415 3300049574 Ga0501038_0021654 Ga0501038_0021654_3567_4154 193
416 3300049575 Ga0501039_0010990 Ga0501039_0010990_2574_3167 193
417 3300049575 Ga0501039_0033067 Ga0501039_0033067_2631_3218 193
418 3300049579 Ga0501043_0001297 Ga0501043_0001297_9247_9840 193
419 3300049579 Ga0501043_0012432 Ga0501043_0012432_2588_3175 193
420 3300049580 Ga0501046_0011941 Ga0501046_0011941_1969_2562 193
421 3300049581 Ga0501047_0038407 Ga0501047_0038407_3370_3963 193
422 3300049582 Ga0501048_0092155 Ga0501048_0092155_1237_1830 193
423 3300049584 Ga0501068_0049472 Ga0501068_0049472_1439_2026 193
424 3300049586 Ga0501070_0081991 Ga0501070_0081991_1072_1659 193
425 3300049589 Ga0501073_0027475 Ga0501073_0027475_350_943 193
426 3300049589 Ga0501073_0063076 Ga0501073_0063076_1912_2499 193
427 3300049688 Ga0501259_014108 Ga0501259_014108_73_663 193
428 3300049742 Ga0501080_0061964 Ga0501080_0061964_1674_2261 193
429 3300049742 Ga0501080_0200301 Ga0501080_0200301_885_1478 193
430 3300049762 Ga0501265_000418 Ga0501265_000418_1808_2395 193
431 3300049772 Ga0501275_001553 Ga0501275_001553_1625_2212 193
432 3300049822 Ga0501035_0005993 Ga0501035_0005993_2988_3581 193
433 3300049823 Ga0501044_0003895 Ga0501044_0003895_13015_13608 193
434 3300049823 Ga0501044_0030783 Ga0501044_0030783_3417_4004 193
435 3300050491 nmdc:mga00v17_308681_c1 nmdc:mga00v17_308681_c1_378_968 193
436 3300050491 nmdc:mga00v17_39317_c1 nmdc:mga00v17_39317_c1_1203_1793 193
437 2162886007 SwRhRL2b_contig_1115076 SwRhRL2b_0638.00002700 194
438 3300002773 JGI25152J39213_1000170 JGI25152J39213_10001708 194
439 3300002774 JGI25150J39212_1000122 JGI25150J39212_100012242 194
440 3300003187 JGI25151J46595_10000411 JGI25151J46595_1000041142 194
441 3300003215 JGI25153J46596_10000252 JGI25153J46596_1000025242 194
442 3300003771 Ga0055526_1001381 Ga0055526_10013818 194
443 3300003773 Ga0055537_1000085 Ga0055537_100008511 194
444 3300003781 Ga0055536_1007237 Ga0055536_10072373 194
445 3300003781 Ga0055536_1011472 Ga0055536_10114723 194
446 3300003781 Ga0055536_1011473 Ga0055536_10114733 194
447 3300003784 Ga0055534_1000476 Ga0055534_100047623 194
448 3300003790 Ga0055528_1000121 Ga0055528_100012141 194
449 3300003791 Ga0055530_10003719 Ga0055530_100037197 194
450 3300003791 Ga0055530_10004345 Ga0055530_100043455 194
451 3300003794 Ga0055531_10014631 Ga0055531_100146313 194
452 3300003856 Ga0058692_1000011 Ga0058692_1000011286 194
453 3300003856 Ga0058692_1000033 Ga0058692_100003386 194
454 3300005262 Ga0065165_1033560 Ga0065165_10335603 194
455 3300005289 Ga0065704_10000377 Ga0065704_100003774 194
456 3300005289 Ga0065704_10327581 Ga0065704_103275811 194
457 3300005347 Ga0070668_100039720 Ga0070668_1000397202 194
458 3300005347 Ga0070668_100519796 Ga0070668_1005197962 194
459 3300005366 Ga0070659_100258018 Ga0070659_1002580182 194
460 3300005456 Ga0070678_100379390 Ga0070678_1003793902 194
461 3300005548 Ga0070665_100161665 Ga0070665_1001616652 194
462 3300005548 Ga0070665_100554211 Ga0070665_1005542112 194
463 3300006051 Ga0075364_10039473 Ga0075364_100394733 194
464 3300006051 Ga0075364_10074220 Ga0075364_100742202 194
465 3300006051 Ga0075364_10388670 Ga0075364_103886701 194
466 3300006178 Ga0075367_10268208 Ga0075367_102682082 194
467 3300009011 Ga0105251_10000076 Ga0105251_1000007640 194
468 3300009036 Ga0105244_10076574 Ga0105244_100765742 194
469 3300013100 Ga0157373_10143867 Ga0157373_101438672 194
470 3300013102 Ga0157371_10004109 Ga0157371_100041099 194
471 3300013104 Ga0157370_10023065 Ga0157370_100230653 194
472 3300013104 Ga0157370_10277301 Ga0157370_102773012 194
473 3300013105 Ga0157369_10792365 Ga0157369_107923652 194
474 3300014497 Ga0182008_10004777 Ga0182008_100047773 194
475 3300014497 Ga0182008_10016904 Ga0182008_100169042 194
476 3300015261 Ga0182006_1113140 Ga0182006_11131401 194
477 3300015262 Ga0182007_10000026 Ga0182007_10000026105 194
478 3300015265 Ga0182005_1000232 Ga0182005_100023213 194
479 3300017792 Ga0163161_10331599 Ga0163161_103315992 194
480 3300025245 Ga0207425_1000066 Ga0207425_10000668 194
481 3300025258 Ga0209129_1000135 Ga0209129_1000135107 194
482 3300025263 Ga0209565_1000023 Ga0209565_1000023190 194
483 3300025273 Ga0209673_1000116 Ga0209673_1000116100 194
484 3300025284 Ga0209130_1022605 Ga0209130_10226052 194
485 3300025291 Ga0209675_1000016 Ga0209675_1000016296 194
486 3300025292 Ga0209676_1000037 Ga0209676_1000037261 194
487 3300025292 Ga0209676_1001804 Ga0209676_10018047 194
488 3300025294 Ga0209025_1000013 Ga0209025_1000013291 194
489 3300025295 Ga0209564_1001691 Ga0209564_100169113 194
490 3300025297 Ga0209758_1000014 Ga0209758_1000014291 194
491 3300025298 Ga0209050_1004211 Ga0209050_10042117 194
492 3300025298 Ga0209050_1004412 Ga0209050_10044125 194
493 3300025298 Ga0209050_1020249 Ga0209050_10202492 194
494 3300025303 Ga0209051_1002501 Ga0209051_100250115 194
495 3300025304 Ga0209257_1002658 Ga0209257_100265814 194
496 3300025304 Ga0209257_1007310 Ga0209257_10073104 194
497 3300025728 Ga0207655_1035491 Ga0207655_10354913 194
498 3300025735 Ga0207713_1000308 Ga0207713_100030814 194
499 3300025925 Ga0207650_10002715 Ga0207650_100027154 194
500 3300025932 Ga0207690_10154812 Ga0207690_101548122 194
501 3300025972 Ga0207668_10045337 Ga0207668_100453374 194
502 3300026121 Ga0207683_10017482 Ga0207683_100174826 194
503 3300027312 Ga0209371_1000007 Ga0209371_1000007679 194
504 3300027312 Ga0209371_1000088 Ga0209371_100008850 194
505 3300028379 Ga0268266_10470814 Ga0268266_104708142 194
506 3300030500 Ga0268256_1000008 Ga0268256_1000008271 194
507 3300030500 Ga0268256_1000079 Ga0268256_100007987 194
508 3300030732 Ga0316176_1219515 Ga0316176_12195154 194
509 3300030742 Ga0316183_1028100 Ga0316183_10281009 194
510 3300030744 Ga0316181_1159105 Ga0316181_11591052 194
511 3300032004 Ga0307414_10070568 Ga0307414_100705682 194
512 3300038705 Ga0237819_00086 Ga0237819_00086_31937_32524 194
513 3300038705 Ga0237819_04279 Ga0237819_04279_1359_1952 194
514 3300041407 Ga0439447_002480 Ga0439447_002480_4486_5079 194
515 3300041459 Ga0451800_0050201 Ga0451800_0050201_47_631 194
516 3300041462 Ga0451806_181564 Ga0451806_181564_2726_3310 194
517 3300041486 Ga0451807_0167261 Ga0451807_0167261_2751_3335 194
518 3300042006 Ga0439432_041679 Ga0439432_041679_101_691 194
519 3300046458 Ga0495591_104611 Ga0495591_104611_53_643 194
520 3300046460 Ga0495638_0009889 Ga0495638_0009889_2900_3490 194
521 3300046460 Ga0495638_0076352 Ga0495638_0076352_326_916 194
522 3300046522 Ga0495643_0003501 Ga0495643_0003501_1109_1699 194
523 3300046525 Ga0495663_0016819 Ga0495663_0016819_209_796 194
524 3300046558 Ga0495633_0009804 Ga0495633_0009804_2272_2859 194
525 3300046558 Ga0495633_0118825 Ga0495633_0118825_97_687 194
526 3300046660 Ga0495625_0157813 Ga0495625_0157813_802_1392 194
527 3300047320 Ga0495672_0000115 Ga0495672_0000115_13685_14275 194
528 3300047472 Ga0495686_0011691 Ga0495686_0011691_1011_1598 194
529 3300047472 Ga0495686_0079153 Ga0495686_0079153_968_1558 194
530 3300048908 Ga0496105_0264641 Ga0496105_0264641_171_761 194
531 3300048919 Ga0496116_0044520 Ga0496116_0044520_129_719 194
532 3300048919 Ga0496116_0114526 Ga0496116_0114526_821_1411 194
533 3300048920 Ga0496117_0003709 Ga0496117_0003709_2734_3324 194
534 3300048920 Ga0496117_0004975 Ga0496117_0004975_9882_10466 194
535 3300048920 Ga0496117_0082946 Ga0496117_0082946_566_1156 194
536 3300048920 Ga0496117_0083237 Ga0496117_0083237_555_1145 194
537 3300048921 Ga0496118_0005082 Ga0496118_0005082_840_1430 194
538 3300048921 Ga0496118_0014552 Ga0496118_0014552_1511_2101 194
539 3300048921 Ga0496118_0027638 Ga0496118_0027638_823_1413 194
540 3300048921 Ga0496118_0032519 Ga0496118_0032519_135_719 194
541 3300048921 Ga0496118_0209250 Ga0496118_0209250_376_960 194
542 3300048921 Ga0496118_0233652 Ga0496118_0233652_437_1027 194
543 3300048921 Ga0496118_0274099 Ga0496118_0274099_135_725 194
544 3300048922 Ga0496119_0000654 Ga0496119_0000654_44916_45506 194
545 3300048922 Ga0496119_0010493 Ga0496119_0010493_2499_3083 194
546 3300048923 Ga0496120_0000220 Ga0496120_0000220_81009_81593 194
547 3300048923 Ga0496120_0002845 Ga0496120_0002845_14984_15574 194
548 3300048924 Ga0496121_0077833 Ga0496121_0077833_655_1245 194
549 3300048925 Ga0496122_0017091 Ga0496122_0017091_3756_4340 194
550 3300048925 Ga0496122_0129124 Ga0496122_0129124_925_1515 194
551 3300048926 Ga0496123_0005623 Ga0496123_0005623_8055_8639 194
552 3300048926 Ga0496123_0137835 Ga0496123_0137835_598_1188 194
553 3300048927 Ga0496124_0016914 Ga0496124_0016914_3771_4355 194
554 3300048927 Ga0496124_0039548 Ga0496124_0039548_1450_2040 194
555 3300048927 Ga0496124_0059437 Ga0496124_0059437_325_915 194
556 3300048927 Ga0496124_0061500 Ga0496124_0061500_1447_2037 194
557 3300048927 Ga0496124_0088736 Ga0496124_0088736_816_1406 194
558 3300048927 Ga0496124_0100562 Ga0496124_0100562_427_1017 194
559 3300048927 Ga0496124_0681734 Ga0496124_0681734_17_607 194
560 3300048928 Ga0496125_0049579 Ga0496125_0049579_1152_1742 194
561 3300048928 Ga0496125_0069686 Ga0496125_0069686_1288_1878 194
562 3300048928 Ga0496125_0095019 Ga0496125_0095019_263_850 194
563 3300048928 Ga0496125_0106929 Ga0496125_0106929_793_1383 194
564 3300048928 Ga0496125_0110962 Ga0496125_0110962_621_1211 194
565 3300048929 Ga0496126_0025761 Ga0496126_0025761_893_1483 194
566 3300049571 Ga0501034_0101270 Ga0501034_0101270_1306_1893 194
567 3300053161 Ga0500634_0000120 Ga0500634_0000120_20514_21101 194
568 3300053734 Ga0500565_005688 Ga0500565_005688_416_1006 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

40

100

0.99

PF14520

HHH_5

Helix-hairpin-helix domain

110

168

0.96

PF07499

RuvA_C

RuvA, C-terminal domain

188

233

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.9517 1 137
2zte-assembly1.cif.gz_A mtruva form iv 0.9516 1 131
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.95 1 131
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9447 1 131
7pbp-assembly1.cif.gz_H ruvab branch migration motor complexed to the holliday junction - ruvb aaa+ state s5 [t2 dataset] 0.9298 148 194
ID Description Score Start End Superfamily
2h5xC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9668 67 132 1.10.150.20
1d8lB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.966 1 63 2.40.50.140
2h5xB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9649 67 131 1.10.150.20
2h5xD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9611 67 130 1.10.150.20
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9608 67 131 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A3D1XZW5-F1-model_v4 deleted 0.987 1 80
AF-A0A660YIC9-F1-model_v4 Holliday junction branch migration protein RuvA 0.9857 1 100 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A7W1KT27-F1-model_v4 Holliday junction branch migration protein RuvA 0.9819 1 86 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A7W0GTI9-F1-model_v4 Holliday junction branch migration protein RuvA 0.9812 1 117 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A455U7G5-F1-model_v4 DNA helicase Holliday junction RuvA type domain-containing protein 0.9806 1 73 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378

Feature Viewer

pLDDT pTM Quality
85.49 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map