F464557

General Info

Members Datasets Scaffolds Average Seq Length
567 243 1134 311

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0041611|Ga0501068_0041611_533_1600
Length 355
Sequence MHVANVGEAFHGPSSIPHLTGPRASRIIAAEVITMRYEVVEGWEQLPKGYEHRDVAGVAVDGEDRVFLICRGDHPIIAYDRKGSFLRSWGEGEFTYRTHGISIAPDGTVWCTDDGNHTVRQFTPQGKLLKTLGTLDQPADTGYDGRDYMTIQRAAGPFNRPTNIAIGPRGDLYVSDGYGNARVHQFSPTGTLKRSWGEPGTGPGQFHIPHGIAVAADGRVFVCDRESDRIQIFSPDGEYLSEWTDTQRPTHLVFDEAGRAYVSELWWHPGQISRRHGPTQTAKHGRVSVFDRDGRLLARWGTPEATKPGSFAAPHGLAVDSKGDIYVGEVTWTFAVSRGLAPADCHTFQKFELKK

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
187 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 1.59
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0041611 3300049584 Bacteria 2762
2 JGI25406J46586_10020847 3300003203 Bacteria 2641
3 Ga0058859_11774149 3300004798 Bacteria 1483
4 Ga0058860_12173721 3300004801 Bacteria 1635
5 Ga0065715_10151283 3300005293 Bacteria 1726
6 Ga0070658_10003229 3300005327 Bacteria 13461
7 Ga0070676_10000929 3300005328 Bacteria 14505
8 Ga0070676_10021555 3300005328 Bacteria 3607
9 Ga0070683_100003732 3300005329 Bacteria 12418
10 Ga0070690_100085259 3300005330 Bacteria 2072
11 Ga0070670_100003182 3300005331 Bacteria 13551
12 Ga0070670_100011620 3300005331 Bacteria 7528
13 Ga0070670_100099341 3300005331 Unclassified 2504
14 Ga0070670_100338730 3300005331 Bacteria 1320
15 Ga0068869_100004980 3300005334 Bacteria 8314
16 Ga0068869_100016723 3300005334 Bacteria 4950
17 Ga0068869_100023455 3300005334 Bacteria 4262
18 Ga0068869_100068328 3300005334 Unclassified 2625
19 Ga0070666_10027496 3300005335 Bacteria 3726
20 Ga0070680_100006165 3300005336 Bacteria 9090
21 Ga0070680_100069255 3300005336 Bacteria 2897
22 Ga0070680_100339269 3300005336 Unclassified 1277
23 Ga0070682_100002633 3300005337 Bacteria 9917
24 Ga0068868_100001521 3300005338 Bacteria 15894
25 Ga0068868_100030849 3300005338 Bacteria 4112
26 Ga0068868_100071943 3300005338 Bacteria 2758
27 Ga0070660_100000970 3300005339 Bacteria 19181
28 Ga0070689_100013485 3300005340 Bacteria 5915
29 Ga0070689_100207533 3300005340 Bacteria 1602
30 Ga0070689_100303453 3300005340 Unclassified 1329
31 Ga0070691_10007130 3300005341 Bacteria 5123
32 Ga0070691_10024112 3300005341 Bacteria 2827
33 Ga0070687_100046358 3300005343 Bacteria 2225
34 Ga0070661_100004321 3300005344 Bacteria 9805
35 Ga0070661_100005782 3300005344 Bacteria 8506
36 Ga0070692_10000628 3300005345 Bacteria 11134
37 Ga0070668_100097531 3300005347 Bacteria 2325
38 Ga0070669_100039739 3300005353 Bacteria 3419
39 Ga0070675_100017049 3300005354 Bacteria 5774
40 Ga0070675_100251670 3300005354 Unclassified 1546
41 Ga0070671_100002184 3300005355 Bacteria 15113
42 Ga0070673_100001228 3300005364 Bacteria 14826
43 Ga0070659_100000818 3300005366 Bacteria 22732
44 Ga0070703_10018145 3300005406 Bacteria 2032
45 Ga0070701_10013004 3300005438 Bacteria 3775
46 Ga0070705_100004975 3300005440 Bacteria 6472
47 Ga0070705_100044492 3300005440 Unclassified 2550
48 Ga0070700_100026939 3300005441 Bacteria 3402
49 Ga0070694_100004473 3300005444 Bacteria 8406
50 Ga0070694_100007779 3300005444 Bacteria 6539
51 Ga0070694_100012082 3300005444 Bacteria 5363
52 Ga0070694_100071695 3300005444 Unclassified 2388
53 Ga0070694_100279122 3300005444 Unclassified 1273
54 Ga0070708_100003201 3300005445 Bacteria 12770
55 Ga0070708_100009123 3300005445 Bacteria 7998
56 Ga0070708_100029369 3300005445 Bacteria 4741
57 Ga0070708_100049703 3300005445 Bacteria 3710
58 Ga0070708_100100262 3300005445 Bacteria 2650
59 Ga0070708_100159097 3300005445 Bacteria 2104
60 Ga0070708_100290752 3300005445 Bacteria 1538
61 Ga0070663_100001424 3300005455 Bacteria 13094
62 Ga0070678_100000216 3300005456 Bacteria 25876
63 Ga0070662_100009000 3300005457 Bacteria 6514
64 Ga0070662_100038586 3300005457 Bacteria 3393
65 Ga0070662_100060149 3300005457 Bacteria 2769
66 Ga0070662_100087057 3300005457 Bacteria 2338
67 Ga0070681_10053024 3300005458 Bacteria 4042
68 Ga0070681_10093307 3300005458 Bacteria 2959
69 Ga0070681_10134970 3300005458 Bacteria 2398
70 Ga0068867_100008186 3300005459 Bacteria 7385
71 Ga0068867_100118127 3300005459 Unclassified 2045
72 Ga0070706_100008793 3300005467 Bacteria 9411
73 Ga0070706_100038526 3300005467 Bacteria 4412
74 Ga0070706_100039672 3300005467 Bacteria 4346
75 Ga0070706_100049533 3300005467 Bacteria 3876
76 Ga0070706_100053556 3300005467 Bacteria 3724
77 Ga0070706_100099257 3300005467 Bacteria 2705
78 Ga0070706_100144166 3300005467 Bacteria 2224
79 Ga0070706_100273134 3300005467 Bacteria 1577
80 Ga0070707_100000653 3300005468 Bacteria 34576
81 Ga0070707_100016838 3300005468 Bacteria 6863
82 Ga0070707_100025074 3300005468 Bacteria 5656
83 Ga0070707_100027329 3300005468 Bacteria 5428
84 Ga0070707_100039664 3300005468 Bacteria 4502
85 Ga0070707_100073454 3300005468 Bacteria 3297
86 Ga0070707_100306332 3300005468 Unclassified 1544
87 Ga0070698_100007256 3300005471 Bacteria 12006
88 Ga0070698_100026647 3300005471 Bacteria 6014
89 Ga0070698_100085072 3300005471 Bacteria 3150
90 Ga0070699_100003947 3300005518 Bacteria 13108
91 Ga0070699_100032597 3300005518 Bacteria 4499
92 Ga0070699_100090594 3300005518 Bacteria 2673
93 Ga0070699_100207719 3300005518 Bacteria 1742
94 Ga0070699_100444189 3300005518 Bacteria 1175
95 Ga0070679_100004125 3300005530 Bacteria 13394
96 Ga0070679_100269521 3300005530 Bacteria 1657
97 Ga0070684_100014548 3300005535 Bacteria 6378
98 Ga0070684_100015711 3300005535 Bacteria 6175
99 Ga0070684_100083998 3300005535 Bacteria 2822
100 Ga0070697_100009164 3300005536 Bacteria 7733
101 Ga0070697_100042166 3300005536 Bacteria 3693
102 Ga0070697_100069840 3300005536 Bacteria 2878
103 Ga0070697_100091496 3300005536 Bacteria 2515
104 Ga0070672_100000155 3300005543 Bacteria 37829
105 Ga0070672_100255857 3300005543 Unclassified 1476
106 Ga0070695_100001263 3300005545 Bacteria 13915
107 Ga0070695_100002831 3300005545 Bacteria 10080
108 Ga0070695_100003683 3300005545 Bacteria 8931
109 Ga0070695_100080380 3300005545 Bacteria 2154
110 Ga0070695_100099162 3300005545 Unclassified 1959
111 Ga0070696_100002860 3300005546 Bacteria 11478
112 Ga0070696_100009816 3300005546 Bacteria 6403
113 Ga0070696_100011871 3300005546 Bacteria 5839
114 Ga0070696_100064113 3300005546 Unclassified 2575
115 Ga0070696_100087513 3300005546 Unclassified 2213
116 Ga0070693_100000604 3300005547 Bacteria 15892
117 Ga0070693_100015098 3300005547 Bacteria 3971
118 Ga0070665_100115077 3300005548 Bacteria 2692
119 Ga0070704_100048581 3300005549 Bacteria 2971
120 Ga0070704_100201582 3300005549 Unclassified 1606
121 Ga0068855_100004425 3300005563 Bacteria 17170
122 Ga0070664_100000147 3300005564 Bacteria 48438
123 Ga0070664_100008031 3300005564 Bacteria 8527
124 Ga0068854_100001692 3300005578 Bacteria 13424
125 Ga0068856_100002103 3300005614 Bacteria 20655
126 Ga0068856_100018853 3300005614 Bacteria 6691
127 Ga0070702_100011821 3300005615 Bacteria 4354
128 Ga0070702_100013551 3300005615 Unclassified 4118
129 Ga0068852_100000390 3300005616 Bacteria 29418
130 Ga0068852_100146522 3300005616 Bacteria 2190
131 Ga0068859_100011476 3300005617 Bacteria 8908
132 Ga0068859_100072056 3300005617 Bacteria 3491
133 Ga0068864_100003238 3300005618 Bacteria 13450
134 Ga0068864_100053813 3300005618 Unclassified 3473
135 Ga0068864_100154408 3300005618 Bacteria 2082
136 Ga0068864_100208495 3300005618 Bacteria 1798
137 Ga0068866_10093519 3300005718 Bacteria 1643
138 Ga0068861_100010574 3300005719 Bacteria 6408
139 Ga0068861_100198980 3300005719 Bacteria 1681
140 Ga0068851_10000782 3300005834 Bacteria 13704
141 Ga0068870_10000542 3300005840 Bacteria 14287
142 Ga0068870_10018227 3300005840 Bacteria 3386
143 Ga0068863_100030217 3300005841 Bacteria 5176
144 Ga0068863_100059410 3300005841 Bacteria 3617
145 Ga0068863_100064342 3300005841 Bacteria 3469
146 Ga0068863_100340452 3300005841 Bacteria 1459
147 Ga0068858_100408042 3300005842 Unclassified 1306
148 Ga0068860_100012365 3300005843 Bacteria 8410
149 Ga0068860_100073112 3300005843 Bacteria 3259
150 Ga0068860_100249333 3300005843 Bacteria 1729
151 Ga0068862_100007668 3300005844 Bacteria 8932
152 Ga0068862_100010181 3300005844 Bacteria 7761
153 Ga0068862_100100526 3300005844 Unclassified 2529
154 Ga0068862_100222000 3300005844 Unclassified 1711
155 Ga0081455_10000060 3300005937 Bacteria 119012
156 Ga0081455_10001693 3300005937 Bacteria 26689
157 Ga0081538_10007763 3300005981 Bacteria 9224
158 Ga0081538_10037599 3300005981 Bacteria 3136
159 Ga0081540_1011846 3300005983 Bacteria 5795
160 Ga0081539_10000020 3300005985 Bacteria 366549
161 Ga0081539_10027719 3300005985 Unclassified 3580
162 Ga0075432_10047618 3300006058 Bacteria 1507
163 Ga0070715_10023500 3300006163 Bacteria 2416
164 Ga0070712_100016069 3300006175 Bacteria 4829
165 Ga0075369_10020049 3300006186 Bacteria 2736
166 Ga0097621_100000249 3300006237 Bacteria 36276
167 Ga0068871_100006292 3300006358 Bacteria 8384
168 Ga0075428_100003943 3300006844 Bacteria 16279
169 Ga0075428_100017697 3300006844 Bacteria 7876
170 Ga0075428_100020526 3300006844 Bacteria 7315
171 Ga0075428_100035759 3300006844 Bacteria 5475
172 Ga0075428_100091470 3300006844 Bacteria 3318
173 Ga0075428_100300367 3300006844 Bacteria 1726
174 Ga0075430_100000088 3300006846 Bacteria 52573
175 Ga0075430_100001010 3300006846 Bacteria 22266
176 Ga0075430_100008467 3300006846 Bacteria 8690
177 Ga0075430_100051694 3300006846 Unclassified 3462
178 Ga0075430_100057462 3300006846 Bacteria 3272
179 Ga0075430_100064913 3300006846 Bacteria 3067
180 Ga0075431_100000115 3300006847 Bacteria 51366
181 Ga0075431_100000248 3300006847 Bacteria 40965
182 Ga0075431_100000637 3300006847 Bacteria 29659
183 Ga0075431_100011100 3300006847 Bacteria 9065
184 Ga0075431_100022468 3300006847 Bacteria 6448
185 Ga0075431_100061901 3300006847 Bacteria 3862
186 Ga0075431_100185317 3300006847 Bacteria 2134
187 Ga0075431_100254425 3300006847 Bacteria 1784
188 Ga0075433_10002923 3300006852 Bacteria 13108
189 Ga0075433_10019890 3300006852 Bacteria 5604
190 Ga0075433_10068340 3300006852 Bacteria 3119
191 Ga0075433_10199396 3300006852 Bacteria 1780
192 Ga0075434_100008316 3300006871 Bacteria 9640
193 Ga0075434_100009991 3300006871 Bacteria 8883
194 Ga0075434_100047770 3300006871 Bacteria 4246
195 Ga0075434_100111951 3300006871 Bacteria 2741
196 Ga0075434_100221934 3300006871 Bacteria 1910
197 Ga0075429_100000555 3300006880 Bacteria 28571
198 Ga0075429_100008618 3300006880 Bacteria 8870
199 Ga0075429_100023320 3300006880 Bacteria 5368
200 Ga0075429_100067483 3300006880 Bacteria 3112
201 Ga0075429_100083496 3300006880 Bacteria 2784
202 Ga0068865_100165184 3300006881 Bacteria 1692
203 Ga0075436_100022117 3300006914 Bacteria 4367
204 Ga0075436_100030550 3300006914 Bacteria 3708
205 Ga0097620_100011474 3300006931 Bacteria 8908
206 Ga0097620_100072056 3300006931 Bacteria 3491
207 Ga0075435_100020425 3300007076 Bacteria 5076
208 Ga0075435_100040720 3300007076 Bacteria 3711
209 Ga0075435_100100055 3300007076 Bacteria 2402
210 Ga0075435_100153916 3300007076 Bacteria 1934
211 Ga0099794_10001577 3300007265 Bacteria 8032
212 Ga0099794_10002485 3300007265 Bacteria 6804
213 Ga0111539_10000662 3300009094 Bacteria 44487
214 Ga0111539_10001406 3300009094 Bacteria 32039
215 Ga0111539_10004112 3300009094 Bacteria 19084
216 Ga0111539_10040140 3300009094 Bacteria 5636
217 Ga0111539_10077272 3300009094 Bacteria 3918
218 Ga0111539_10089244 3300009094 Bacteria 3622
219 Ga0111539_10266388 3300009094 Bacteria 1994
220 Ga0111539_10498705 3300009094 Bacteria 1418
221 Ga0105245_10225631 3300009098 Bacteria 1810
222 Ga0105245_10617500 3300009098 Bacteria 1112
223 Ga0114129_10000541 3300009147 Bacteria 46363
224 Ga0114129_10002784 3300009147 Bacteria 24377
225 Ga0114129_10038570 3300009147 Bacteria 6737
226 Ga0114129_10041689 3300009147 Bacteria 6465
227 Ga0114129_10097670 3300009147 Bacteria 4066
228 Ga0114129_10278456 3300009147 Bacteria 2236
229 Ga0114129_10429774 3300009147 Unclassified 1735
230 Ga0114129_10451959 3300009147 Bacteria 1685
231 Ga0114129_10489810 3300009147 Bacteria 1607
232 Ga0105243_10022055 3300009148 Bacteria 4838
233 Ga0105241_10001791 3300009174 Bacteria 16319
234 Ga0105242_10011625 3300009176 Bacteria 6770
235 Ga0105248_10154614 3300009177 Bacteria 2588
236 Ga0105248_10404623 3300009177 Bacteria 1537
237 Ga0105238_10060452 3300009551 Bacteria 3793
238 Ga0105249_10071661 3300009553 Bacteria 3202
239 Ga0105249_10388248 3300009553 Bacteria 1423
240 Ga0157373_10001444 3300013100 Bacteria 18151
241 Ga0157369_10025458 3300013105 Bacteria 6571
242 Ga0157369_10069783 3300013105 Bacteria 3775
243 Ga0157374_10002963 3300013296 Bacteria 14215
244 Ga0157374_10126136 3300013296 Bacteria 2474
245 Ga0157378_10005914 3300013297 Bacteria 10719
246 Ga0157378_10123553 3300013297 Bacteria 2388
247 Ga0163162_10017539 3300013306 Bacteria 7006
248 Ga0163162_10020684 3300013306 Bacteria 6467
249 Ga0163162_10300336 3300013306 Unclassified 1738
250 Ga0163162_10653134 3300013306 Bacteria 1175
251 Ga0157372_10001335 3300013307 Bacteria 26660
252 Ga0157375_10000482 3300013308 Bacteria 36307
253 Ga0157375_10029088 3300013308 Bacteria 5191
254 Ga0157375_10180584 3300013308 Unclassified 2261
255 Ga0157375_10258940 3300013308 Bacteria 1901
256 Ga0163163_10092765 3300014325 Bacteria 3035
257 Ga0157379_10001482 3300014968 Bacteria 19333
258 Ga0157376_10002601 3300014969 Bacteria 12258
259 Ga0182007_10024019 3300015262 Bacteria 2137
260 Ga0163161_10084399 3300017792 Bacteria 2342
261 Ga0163161_10271212 3300017792 Bacteria 1328
262 Ga0207656_10003802 3300025321 Bacteria 5228
263 Ga0207653_10003184 3300025885 Bacteria 5185
264 Ga0207642_10080299 3300025899 Bacteria 1582
265 Ga0207642_10220916 3300025899 Bacteria 1059
266 Ga0207688_10116586 3300025901 Bacteria 1555
267 Ga0207680_10009407 3300025903 Unclassified 4848
268 Ga0207645_10001090 3300025907 Bacteria 22399
269 Ga0207645_10289234 3300025907 Bacteria 1089
270 Ga0207643_10000057 3300025908 Bacteria 73664
271 Ga0207684_10000245 3300025910 Bacteria 81543
272 Ga0207684_10008665 3300025910 Bacteria 9030
273 Ga0207684_10028725 3300025910 Bacteria 4737
274 Ga0207684_10051523 3300025910 Bacteria 3493
275 Ga0207684_10073514 3300025910 Bacteria 2903
276 Ga0207684_10113548 3300025910 Bacteria 2319
277 Ga0207684_10356671 3300025910 Archaea 1258
278 Ga0207654_10031965 3300025911 Bacteria 2903
279 Ga0207707_10001689 3300025912 Bacteria 20305
280 Ga0207707_10207982 3300025912 Unclassified 1705
281 Ga0207660_10001714 3300025917 Bacteria 14711
282 Ga0207660_10016240 3300025917 Bacteria 4927
283 Ga0207662_10027158 3300025918 Bacteria 3304
284 Ga0207657_10001291 3300025919 Bacteria 26609
285 Ga0207649_10001824 3300025920 Bacteria 12165
286 Ga0207652_10001723 3300025921 Bacteria 19088
287 Ga0207652_10247731 3300025921 Unclassified 1607
288 Ga0207646_10004199 3300025922 Bacteria 15784
289 Ga0207646_10004639 3300025922 Bacteria 14839
290 Ga0207646_10011154 3300025922 Bacteria 8723
291 Ga0207646_10016188 3300025922 Bacteria 7007
292 Ga0207646_10025066 3300025922 Bacteria 5459
293 Ga0207646_10260194 3300025922 Bacteria 1568
294 Ga0207681_10027874 3300025923 Bacteria 3657
295 Ga0207681_10093464 3300025923 Bacteria 2153
296 Ga0207650_10031167 3300025925 Unclassified 3847
297 Ga0207659_10000265 3300025926 Bacteria 31951
298 Ga0207659_10002208 3300025926 Bacteria 11580
299 Ga0207644_10003249 3300025931 Bacteria 10486
300 Ga0207690_10023026 3300025932 Bacteria 3883
301 Ga0207706_10009132 3300025933 Bacteria 9115
302 Ga0207706_10019043 3300025933 Bacteria 6175
303 Ga0207706_10028247 3300025933 Bacteria 5010
304 Ga0207686_10009599 3300025934 Bacteria 5252
305 Ga0207686_10082713 3300025934 Bacteria 2100
306 Ga0207709_10020129 3300025935 Unclassified 3761
307 Ga0207709_10058979 3300025935 Bacteria 2387
308 Ga0207691_10000319 3300025940 Bacteria 47784
309 Ga0207691_10052210 3300025940 Bacteria 3734
310 Ga0207689_10001050 3300025942 Bacteria 26544
311 Ga0207689_10006258 3300025942 Bacteria 10551
312 Ga0207689_10054897 3300025942 Bacteria 3280
313 Ga0207689_10132201 3300025942 Bacteria 2054
314 Ga0207661_10005468 3300025944 Bacteria 8958
315 Ga0207661_10097913 3300025944 Bacteria 2457
316 Ga0207679_10001888 3300025945 Bacteria 13019
317 Ga0207679_10014489 3300025945 Bacteria 5187
318 Ga0207679_10084018 3300025945 Bacteria 2442
319 Ga0207667_10003708 3300025949 Bacteria 18845
320 Ga0207651_10003140 3300025960 Bacteria 8051
321 Ga0207712_10042509 3300025961 Bacteria 3130
322 Ga0207712_10340997 3300025961 Unclassified 1243
323 Ga0207668_10433989 3300025972 Unclassified 1118
324 Ga0207677_10041521 3300026023 Bacteria 3042
325 Ga0207703_10604380 3300026035 Bacteria 1038
326 Ga0207708_10045017 3300026075 Bacteria 3363
327 Ga0207702_10047158 3300026078 Bacteria 3629
328 Ga0207641_10014916 3300026088 Bacteria 6371
329 Ga0207648_10013471 3300026089 Bacteria 7606
330 Ga0207648_10075311 3300026089 Bacteria 2942
331 Ga0207676_10003018 3300026095 Bacteria 12006
332 Ga0207676_10010724 3300026095 Bacteria 6533
333 Ga0207674_10002538 3300026116 Bacteria 23000
334 Ga0207675_100006436 3300026118 Bacteria 11121
335 Ga0207675_100277804 3300026118 Unclassified 1627
336 Ga0207675_100334084 3300026118 Unclassified 1482
337 Ga0207683_10000729 3300026121 Bacteria 29902
338 Ga0207698_10001105 3300026142 Bacteria 15727
339 Ga0209967_1005805 3300027364 Bacteria 1667
340 Ga0209981_1004025 3300027378 Bacteria 1916
341 Ga0209996_1002775 3300027395 Bacteria 2178
342 Ga0209968_1000514 3300027526 Bacteria 6085
343 Ga0209983_1000156 3300027665 Bacteria 12776
344 Ga0209588_1004631 3300027671 Bacteria 3895
345 Ga0209971_1000358 3300027682 Bacteria 12455
346 Ga0209966_1000705 3300027695 Bacteria 7205
347 Ga0209998_10002004 3300027717 Bacteria 4774
348 Ga0209974_10002091 3300027876 Bacteria 7308
349 Ga0207428_10004170 3300027907 Bacteria 13851
350 Ga0207428_10025546 3300027907 Bacteria 4944
351 Ga0207428_10161811 3300027907 Bacteria 1699
352 Ga0268266_10089619 3300028379 Bacteria 2694
353 Ga0268266_10149881 3300028379 Bacteria 2101
354 Ga0268265_10011027 3300028380 Bacteria 6105
355 Ga0268265_10042063 3300028380 Bacteria 3387
356 Ga0268265_10076688 3300028380 Bacteria 2623
357 Ga0268265_10104992 3300028380 Unclassified 2291
358 Ga0268264_10026707 3300028381 Bacteria 4718
359 Ga0268264_10028040 3300028381 Bacteria 4605
360 Ga0268264_10074387 3300028381 Bacteria 2886
361 Ga0268264_10079468 3300028381 Unclassified 2798
362 Ga0307408_100101284 3300031548 Bacteria 2195
363 Ga0307408_100445200 3300031548 Bacteria 1122
364 Ga0307406_10270378 3300031901 Bacteria 1291
365 Ga0307409_100457662 3300031995 Bacteria 1233
366 Ga0307416_100011470 3300032002 Bacteria 5914
367 Ga0307416_100284180 3300032002 Bacteria 1633
368 Ga0373940_0002263 3300035088 Bacteria 3708
369 Ga0373940_0042169 3300035088 Bacteria 1257
370 Ga0373932_0012636 3300035112 Bacteria 2083
371 Ga0373960_0010434 3300035121 Bacteria 2268
372 Ga0373942_0043838 3300035207 Unclassified 1231
373 Ga0373931_0012335 3300035691 Bacteria 4139
374 Ga0373931_0176970 3300035691 Bacteria 1261
375 Ga0373925_0312796 3300037068 Unclassified 1270
376 Ga0395900_0001273 3300037418 Bacteria 30829
377 Ga0395900_0105642 3300037418 Bacteria 2893
378 Ga0395898_0194597 3300037466 Unclassified 1937
379 Ga0395905_0343812 3300037471 Bacteria 1383
380 Ga0395901_0000813 3300038443 Bacteria 34571
381 Ga0395901_0027931 3300038443 Bacteria 5802
382 Ga0242420_010500 3300038996 Bacteria 1540
383 Ga0242420_019967 3300038996 Unclassified 1189
384 Ga0436365_0504872 3300039437 Bacteria 3212
385 Ga0436365_1746390 3300039437 Bacteria 3312
386 Ga0436365_1913115 3300039437 Bacteria 2573
387 Ga0451853_1510886 3300041512 Bacteria 3230
388 Ga0439448_0012324 3300042005 Bacteria 2558
389 Ga0439455_0004116 3300042012 Bacteria 2855
390 Ga0439455_0011671 3300042012 Bacteria 1957
391 Ga0439463_066634 3300042016 Unclassified 921
392 Ga0439458_0006702 3300042157 Bacteria 2567
393 Ga0439435_0021570 3300042436 Bacteria 1674
394 Ga0439459_0001754 3300042438 Bacteria 3244
395 Ga0439460_0008641 3300042461 Bacteria 2573
396 Ga0451577_0020742 3300042876 Bacteria 6024
397 Ga0451577_0021183 3300042876 Bacteria 5952
398 Ga0453683_0008298 3300044673 Bacteria 6982
399 Ga0453683_0021491 3300044673 Bacteria 4120
400 Ga0453683_0081581 3300044673 Bacteria 2026
401 Ga0453684_0004896 3300044712 Bacteria 27411
402 Ga0453684_0201470 3300044712 Bacteria 2320
403 Ga0453684_0295072 3300044712 Bacteria 1844
404 Ga0451576_0006403 3300045051 Bacteria 14449
405 Ga0451576_0008349 3300045051 Bacteria 12170
406 Ga0451576_0043155 3300045051 Bacteria 4758
407 Ga0451576_0069994 3300045051 Bacteria 3651
408 Ga0451576_0478840 3300045051 Bacteria 1307
409 Ga0451576_0613279 3300045051 Bacteria 1143
410 Ga0495603_0067759 3300046455 Bacteria 2100
411 Ga0495594_0034196 3300046499 Bacteria 2765
412 Ga0495656_0036457 3300046615 Bacteria 2026
413 Ga0495669_0022052 3300046684 Bacteria 2766
414 Ga0496102_0008769 3300048905 Bacteria 8673
415 Ga0496102_0022219 3300048905 Bacteria 5619
416 Ga0496103_0139897 3300048906 Bacteria 1547
417 Ga0496104_0120066 3300048907 Bacteria 2524
418 Ga0496106_0160918 3300048909 Bacteria 1775
419 Ga0496106_0402749 3300048909 Bacteria 1100
420 Ga0496108_0005524 3300048911 Bacteria 10227
421 Ga0496110_0003262 3300048913 Bacteria 12369
422 Ga0496112_0087481 3300048915 Bacteria 3083
423 Ga0501031_0031518 3300049568 Bacteria 3458
424 Ga0501031_0253676 3300049568 Unclassified 1143
425 Ga0501036_0080251 3300049572 Bacteria 2758
426 Ga0501036_0106185 3300049572 Bacteria 2375
427 Ga0501037_0180539 3300049573 Bacteria 1497
428 Ga0501039_0015017 3300049575 Bacteria 5925
429 Ga0501039_0025086 3300049575 Bacteria 4580
430 Ga0501039_0313960 3300049575 Bacteria 1232
431 Ga0501040_0005784 3300049576 Bacteria 8003
432 Ga0501040_0090017 3300049576 Bacteria 2132
433 Ga0501040_0120832 3300049576 Bacteria 1838
434 Ga0501041_0002249 3300049577 Bacteria 10915
435 Ga0501041_0206367 3300049577 Bacteria 1232
436 Ga0501042_0007399 3300049578 Bacteria 7189
437 Ga0501042_0130140 3300049578 Bacteria 1814
438 Ga0501042_0197175 3300049578 Bacteria 1452
439 Ga0501042_0298205 3300049578 Unclassified 1164
440 Ga0501043_0224187 3300049579 Bacteria 1453
441 Ga0501043_0272244 3300049579 Bacteria 1300
442 Ga0501046_0001548 3300049580 Bacteria 21972
443 Ga0501046_0104968 3300049580 Bacteria 2165
444 Ga0501046_0163606 3300049580 Bacteria 1672
445 Ga0501048_0015313 3300049582 Bacteria 5663
446 Ga0501048_0146991 3300049582 Bacteria 1667
447 Ga0501048_0172564 3300049582 Bacteria 1532
448 Ga0501048_0181154 3300049582 Unclassified 1493
449 Ga0501069_0031247 3300049585 Bacteria 2927
450 Ga0501070_0179473 3300049586 Bacteria 1743
451 Ga0501070_0309271 3300049586 Bacteria 1287
452 Ga0501071_0018314 3300049587 Bacteria 4847
453 Ga0501071_0221109 3300049587 Bacteria 1425
454 Ga0501071_0272550 3300049587 Bacteria 1280
455 Ga0501072_0009078 3300049588 Bacteria 7550
456 Ga0501072_0021683 3300049588 Bacteria 4982
457 Ga0501074_0007432 3300049590 Bacteria 7928
458 Ga0501074_0081147 3300049590 Bacteria 2326
459 Ga0501075_0002646 3300049591 Bacteria 11969
460 Ga0501075_0019779 3300049591 Bacteria 4887
461 Ga0501075_0026042 3300049591 Bacteria 4301
462 Ga0501075_0028460 3300049591 Bacteria 4125
463 Ga0501075_0098267 3300049591 Bacteria 2222
464 Ga0501075_0122519 3300049591 Bacteria 1979
465 Ga0501076_0009231 3300049592 Bacteria 7275
466 Ga0501076_0028401 3300049592 Bacteria 4344
467 Ga0501076_0046595 3300049592 Bacteria 3426
468 Ga0501076_0078393 3300049592 Unclassified 2651
469 Ga0501076_0140746 3300049592 Bacteria 1960
470 Ga0501076_0361513 3300049592 Unclassified 1192
471 Ga0501077_0010952 3300049593 Bacteria 5653
472 Ga0501077_0049766 3300049593 Bacteria 2663
473 Ga0501077_0066148 3300049593 Bacteria 2293
474 Ga0501077_0103866 3300049593 Bacteria 1801
475 Ga0501079_0000872 3300049741 Bacteria 20703
476 Ga0501079_0002699 3300049741 Bacteria 12922
477 Ga0501079_0011633 3300049741 Bacteria 6719
478 Ga0501079_0047004 3300049741 Bacteria 3330
479 Ga0501079_0128805 3300049741 Bacteria 1969
480 Ga0501079_0149622 3300049741 Unclassified 1820
481 Ga0501079_0150345 3300049741 Bacteria 1815
482 Ga0501079_0199507 3300049741 Unclassified 1563
483 Ga0501080_0049557 3300049742 Bacteria 3909
484 Ga0501080_0086966 3300049742 Bacteria 2904
485 Ga0501080_0313172 3300049742 Bacteria 1422
486 Ga0501080_0344099 3300049742 Bacteria 1347
487 Ga0501081_0000510 3300049743 Bacteria 21819
488 Ga0501081_0009497 3300049743 Bacteria 6343
489 Ga0501081_0016762 3300049743 Bacteria 4843
490 Ga0501081_0047754 3300049743 Bacteria 2945
491 Ga0501081_0278200 3300049743 Bacteria 1225
492 Ga0501083_0014459 3300049744 Bacteria 5519
493 Ga0501083_0274122 3300049744 Unclassified 1098
494 Ga0501035_0248351 3300049822 Bacteria 1512
495 Ga0501045_0013874 3300049824 Bacteria 5699
496 Ga0501045_0046093 3300049824 Bacteria 3175
497 Ga0501045_0146139 3300049824 Bacteria 1759
498 nmdc:mga05p37_129319_c1 3300050507 Bacteria 3099
499 nmdc:mga05p37_19297_c1 3300050507 Bacteria 8246
500 nmdc:mga05p37_25192_c1 3300050507 Bacteria 7234
501 nmdc:mga05p37_259242_c1 3300050507 Bacteria 2082
502 nmdc:mga05p37_3374_c1 3300050507 Bacteria 18642
503 nmdc:mga05p37_34488_c1 3300050507 Bacteria 6200
504 nmdc:mga05p37_39608_c1 3300050507 Bacteria 5787
505 nmdc:mga05p37_4397_c1 3300050507 Bacteria 16468
506 nmdc:mga05p37_57574_c1 3300050507 Bacteria 4787
507 nmdc:mga05p37_650_c1 3300050507 Bacteria 38420
508 nmdc:mga05p37_8789_c1 3300050507 Bacteria 11934
509 nmdc:mga05p37_89243_c1 3300050507 Bacteria 3799
510 nmdc:mga09592_105897_c1 3300050508 Bacteria 2412
511 nmdc:mga09592_11094_c1 3300050508 Bacteria 7332
512 nmdc:mga09592_16704_c1 3300050508 Bacteria 6007
513 nmdc:mga09592_178846_c1 3300050508 Bacteria 1835
514 nmdc:mga0qj67_11188_c1 3300050509 Bacteria 6719
515 nmdc:mga0qj67_4780_c1 3300050509 Bacteria 9846
516 nmdc:mga0qj67_5501_c1 3300050509 Bacteria 9259
517 nmdc:mga06r32_111662_c1 3300050510 Bacteria 2690
518 nmdc:mga06r32_128203_c1 3300050510 Bacteria 2507
519 nmdc:mga06r32_128541_c1 3300050510 Bacteria 2504
520 nmdc:mga06r32_133018_c1 3300050510 Bacteria 2461
521 nmdc:mga06r32_33396_c1 3300050510 Bacteria 4846
522 nmdc:mga06r32_343921_c1 3300050510 Unclassified 1476
523 nmdc:mga06r32_37461_c1 3300050510 Bacteria 4587
524 nmdc:mga06r32_986_c1 3300050510 Bacteria 25492
525 nmdc:mga08y16_26846_c1 3300050511 Bacteria 6069
526 nmdc:mga08y16_6995_c1 3300050511 Bacteria 11831
527 nmdc:mga08y16_8724_c1 3300050511 Bacteria 10633
528 nmdc:mga08y16_97055_c1 3300050511 Bacteria 3069
529 nmdc:mga0n895_150387_c1 3300050512 Bacteria 2358
530 nmdc:mga0n895_309504_c1 3300050512 Bacteria 1601
531 nmdc:mga0n895_32_c1 3300050512 Bacteria 81400
532 nmdc:mga0n895_358107_c1 3300050512 Unclassified 1478
533 nmdc:mga0n895_431692_c1 3300050512 Bacteria 1331
534 nmdc:mga0n895_4984_c1 3300050512 Bacteria 11020
535 nmdc:mga0n895_50762_c1 3300050512 Bacteria 4067
536 nmdc:mga0n895_54027_c1 3300050512 Bacteria 3949
537 nmdc:mga0n895_8409_c1 3300050512 Bacteria 8936
538 nmdc:mga0n895_8505_c1 3300050512 Bacteria 8893
539 nmdc:mga0rr50_136575_c1 3300050513 Bacteria 1969
540 nmdc:mga0rr50_200392_c1 3300050513 Unclassified 1640
541 nmdc:mga0rr50_25796_c1 3300050513 Bacteria 4091
542 nmdc:mga0rr50_304861_c1 3300050513 Bacteria 1333
543 nmdc:mga08x19_100718_c1 3300050514 Bacteria 1917
544 nmdc:mga08x19_5140_c1 3300050514 Bacteria 7739
545 nmdc:mga08x19_9078_c1 3300050514 Bacteria 5937
546 nmdc:mga0a205_11007_c1 3300050515 Bacteria 8326
547 nmdc:mga0a205_11475_c1 3300050515 Bacteria 8158
548 nmdc:mga0a205_129287_c1 3300050515 Unclassified 2426
549 nmdc:mga0a205_16028_c1 3300050515 Bacteria 7015
550 nmdc:mga0a205_16856_c1 3300050515 Bacteria 6838
551 nmdc:mga0a205_291933_c1 3300050515 Unclassified 1505
552 nmdc:mga0sz30_22267_c1 3300050516 Bacteria 2570
553 Ga0500609_013485 3300053731 Bacteria 1106
554 Ga0501084_0017737 3300054114 Bacteria 5924
555 Ga0501084_0026857 3300054114 Bacteria 4809
556 Ga0501084_0031302 3300054114 Bacteria 4449
557 Ga0501084_0081353 3300054114 Bacteria 2717
558 Ga0501082_0002210 3300060353 Bacteria 17015
559 Ga0501082_0011818 3300060353 Bacteria 7506
560 Ga0501082_0092968 3300060353 Unclassified 2605
561 Ga0501082_0144305 3300060353 Bacteria 2066
562 Ga0501082_0160725 3300060353 Bacteria 1952
563 Ga0501082_0232087 3300060353 Bacteria 1606
564 Ga0501082_0313120 3300060353 Unclassified 1367
565 Ga0530510_0006107 3300061734 Bacteria 8363
566 Ga0530510_0027937 3300061734 Bacteria 4044
567 Ga0530510_0092021 3300061734 Unclassified 2213
568 Ga0501068_0041611
569 JGI25406J46586_10020847
570 Ga0058859_11774149
571 Ga0058860_12173721
572 Ga0065715_10151283
573 Ga0070658_10003229
574 Ga0070676_10000929
575 Ga0070676_10021555
576 Ga0070683_100003732
577 Ga0070690_100085259
578 Ga0070670_100003182
579 Ga0070670_100011620
580 Ga0070670_100099341
581 Ga0070670_100338730
582 Ga0068869_100004980
583 Ga0068869_100016723
584 Ga0068869_100023455
585 Ga0068869_100068328
586 Ga0070666_10027496
587 Ga0070680_100006165
588 Ga0070680_100069255
589 Ga0070680_100339269
590 Ga0070682_100002633
591 Ga0068868_100001521
592 Ga0068868_100030849
593 Ga0068868_100071943
594 Ga0070660_100000970
595 Ga0070689_100013485
596 Ga0070689_100207533
597 Ga0070689_100303453
598 Ga0070691_10007130
599 Ga0070691_10024112
600 Ga0070687_100046358
601 Ga0070661_100004321
602 Ga0070661_100005782
603 Ga0070692_10000628
604 Ga0070668_100097531
605 Ga0070669_100039739
606 Ga0070675_100017049
607 Ga0070675_100251670
608 Ga0070671_100002184
609 Ga0070673_100001228
610 Ga0070659_100000818
611 Ga0070703_10018145
612 Ga0070701_10013004
613 Ga0070705_100004975
614 Ga0070705_100044492
615 Ga0070700_100026939
616 Ga0070694_100004473
617 Ga0070694_100007779
618 Ga0070694_100012082
619 Ga0070694_100071695
620 Ga0070694_100279122
621 Ga0070708_100003201
622 Ga0070708_100009123
623 Ga0070708_100029369
624 Ga0070708_100049703
625 Ga0070708_100100262
626 Ga0070708_100159097
627 Ga0070708_100290752
628 Ga0070663_100001424
629 Ga0070678_100000216
630 Ga0070662_100009000
631 Ga0070662_100038586
632 Ga0070662_100060149
633 Ga0070662_100087057
634 Ga0070681_10053024
635 Ga0070681_10093307
636 Ga0070681_10134970
637 Ga0068867_100008186
638 Ga0068867_100118127
639 Ga0070706_100008793
640 Ga0070706_100038526
641 Ga0070706_100039672
642 Ga0070706_100049533
643 Ga0070706_100053556
644 Ga0070706_100099257
645 Ga0070706_100144166
646 Ga0070706_100273134
647 Ga0070707_100000653
648 Ga0070707_100016838
649 Ga0070707_100025074
650 Ga0070707_100027329
651 Ga0070707_100039664
652 Ga0070707_100073454
653 Ga0070707_100306332
654 Ga0070698_100007256
655 Ga0070698_100026647
656 Ga0070698_100085072
657 Ga0070699_100003947
658 Ga0070699_100032597
659 Ga0070699_100090594
660 Ga0070699_100207719
661 Ga0070699_100444189
662 Ga0070679_100004125
663 Ga0070679_100269521
664 Ga0070684_100014548
665 Ga0070684_100015711
666 Ga0070684_100083998
667 Ga0070697_100009164
668 Ga0070697_100042166
669 Ga0070697_100069840
670 Ga0070697_100091496
671 Ga0070672_100000155
672 Ga0070672_100255857
673 Ga0070695_100001263
674 Ga0070695_100002831
675 Ga0070695_100003683
676 Ga0070695_100080380
677 Ga0070695_100099162
678 Ga0070696_100002860
679 Ga0070696_100009816
680 Ga0070696_100011871
681 Ga0070696_100064113
682 Ga0070696_100087513
683 Ga0070693_100000604
684 Ga0070693_100015098
685 Ga0070665_100115077
686 Ga0070704_100048581
687 Ga0070704_100201582
688 Ga0068855_100004425
689 Ga0070664_100000147
690 Ga0070664_100008031
691 Ga0068854_100001692
692 Ga0068856_100002103
693 Ga0068856_100018853
694 Ga0070702_100011821
695 Ga0070702_100013551
696 Ga0068852_100000390
697 Ga0068852_100146522
698 Ga0068859_100011476
699 Ga0068859_100072056
700 Ga0068864_100003238
701 Ga0068864_100053813
702 Ga0068864_100154408
703 Ga0068864_100208495
704 Ga0068866_10093519
705 Ga0068861_100010574
706 Ga0068861_100198980
707 Ga0068851_10000782
708 Ga0068870_10000542
709 Ga0068870_10018227
710 Ga0068863_100030217
711 Ga0068863_100059410
712 Ga0068863_100064342
713 Ga0068863_100340452
714 Ga0068858_100408042
715 Ga0068860_100012365
716 Ga0068860_100073112
717 Ga0068860_100249333
718 Ga0068862_100007668
719 Ga0068862_100010181
720 Ga0068862_100100526
721 Ga0068862_100222000
722 Ga0081455_10000060
723 Ga0081455_10001693
724 Ga0081538_10007763
725 Ga0081538_10037599
726 Ga0081540_1011846
727 Ga0081539_10000020
728 Ga0081539_10027719
729 Ga0075432_10047618
730 Ga0070715_10023500
731 Ga0070712_100016069
732 Ga0075369_10020049
733 Ga0097621_100000249
734 Ga0068871_100006292
735 Ga0075428_100003943
736 Ga0075428_100017697
737 Ga0075428_100020526
738 Ga0075428_100035759
739 Ga0075428_100091470
740 Ga0075428_100300367
741 Ga0075430_100000088
742 Ga0075430_100001010
743 Ga0075430_100008467
744 Ga0075430_100051694
745 Ga0075430_100057462
746 Ga0075430_100064913
747 Ga0075431_100000115
748 Ga0075431_100000248
749 Ga0075431_100000637
750 Ga0075431_100011100
751 Ga0075431_100022468
752 Ga0075431_100061901
753 Ga0075431_100185317
754 Ga0075431_100254425
755 Ga0075433_10002923
756 Ga0075433_10019890
757 Ga0075433_10068340
758 Ga0075433_10199396
759 Ga0075434_100008316
760 Ga0075434_100009991
761 Ga0075434_100047770
762 Ga0075434_100111951
763 Ga0075434_100221934
764 Ga0075429_100000555
765 Ga0075429_100008618
766 Ga0075429_100023320
767 Ga0075429_100067483
768 Ga0075429_100083496
769 Ga0068865_100165184
770 Ga0075436_100022117
771 Ga0075436_100030550
772 Ga0097620_100011474
773 Ga0097620_100072056
774 Ga0075435_100020425
775 Ga0075435_100040720
776 Ga0075435_100100055
777 Ga0075435_100153916
778 Ga0099794_10001577
779 Ga0099794_10002485
780 Ga0111539_10000662
781 Ga0111539_10001406
782 Ga0111539_10004112
783 Ga0111539_10040140
784 Ga0111539_10077272
785 Ga0111539_10089244
786 Ga0111539_10266388
787 Ga0111539_10498705
788 Ga0105245_10225631
789 Ga0105245_10617500
790 Ga0114129_10000541
791 Ga0114129_10002784
792 Ga0114129_10038570
793 Ga0114129_10041689
794 Ga0114129_10097670
795 Ga0114129_10278456
796 Ga0114129_10429774
797 Ga0114129_10451959
798 Ga0114129_10489810
799 Ga0105243_10022055
800 Ga0105241_10001791
801 Ga0105242_10011625
802 Ga0105248_10154614
803 Ga0105248_10404623
804 Ga0105238_10060452
805 Ga0105249_10071661
806 Ga0105249_10388248
807 Ga0157373_10001444
808 Ga0157369_10025458
809 Ga0157369_10069783
810 Ga0157374_10002963
811 Ga0157374_10126136
812 Ga0157378_10005914
813 Ga0157378_10123553
814 Ga0163162_10017539
815 Ga0163162_10020684
816 Ga0163162_10300336
817 Ga0163162_10653134
818 Ga0157372_10001335
819 Ga0157375_10000482
820 Ga0157375_10029088
821 Ga0157375_10180584
822 Ga0157375_10258940
823 Ga0163163_10092765
824 Ga0157379_10001482
825 Ga0157376_10002601
826 Ga0182007_10024019
827 Ga0163161_10084399
828 Ga0163161_10271212
829 Ga0207656_10003802
830 Ga0207653_10003184
831 Ga0207642_10080299
832 Ga0207642_10220916
833 Ga0207688_10116586
834 Ga0207680_10009407
835 Ga0207645_10001090
836 Ga0207645_10289234
837 Ga0207643_10000057
838 Ga0207684_10000245
839 Ga0207684_10008665
840 Ga0207684_10028725
841 Ga0207684_10051523
842 Ga0207684_10073514
843 Ga0207684_10113548
844 Ga0207684_10356671
845 Ga0207654_10031965
846 Ga0207707_10001689
847 Ga0207707_10207982
848 Ga0207660_10001714
849 Ga0207660_10016240
850 Ga0207662_10027158
851 Ga0207657_10001291
852 Ga0207649_10001824
853 Ga0207652_10001723
854 Ga0207652_10247731
855 Ga0207646_10004199
856 Ga0207646_10004639
857 Ga0207646_10011154
858 Ga0207646_10016188
859 Ga0207646_10025066
860 Ga0207646_10260194
861 Ga0207681_10027874
862 Ga0207681_10093464
863 Ga0207650_10031167
864 Ga0207659_10000265
865 Ga0207659_10002208
866 Ga0207644_10003249
867 Ga0207690_10023026
868 Ga0207706_10009132
869 Ga0207706_10019043
870 Ga0207706_10028247
871 Ga0207686_10009599
872 Ga0207686_10082713
873 Ga0207709_10020129
874 Ga0207709_10058979
875 Ga0207691_10000319
876 Ga0207691_10052210
877 Ga0207689_10001050
878 Ga0207689_10006258
879 Ga0207689_10054897
880 Ga0207689_10132201
881 Ga0207661_10005468
882 Ga0207661_10097913
883 Ga0207679_10001888
884 Ga0207679_10014489
885 Ga0207679_10084018
886 Ga0207667_10003708
887 Ga0207651_10003140
888 Ga0207712_10042509
889 Ga0207712_10340997
890 Ga0207668_10433989
891 Ga0207677_10041521
892 Ga0207703_10604380
893 Ga0207708_10045017
894 Ga0207702_10047158
895 Ga0207641_10014916
896 Ga0207648_10013471
897 Ga0207648_10075311
898 Ga0207676_10003018
899 Ga0207676_10010724
900 Ga0207674_10002538
901 Ga0207675_100006436
902 Ga0207675_100277804
903 Ga0207675_100334084
904 Ga0207683_10000729
905 Ga0207698_10001105
906 Ga0209967_1005805
907 Ga0209981_1004025
908 Ga0209996_1002775
909 Ga0209968_1000514
910 Ga0209983_1000156
911 Ga0209588_1004631
912 Ga0209971_1000358
913 Ga0209966_1000705
914 Ga0209998_10002004
915 Ga0209974_10002091
916 Ga0207428_10004170
917 Ga0207428_10025546
918 Ga0207428_10161811
919 Ga0268266_10089619
920 Ga0268266_10149881
921 Ga0268265_10011027
922 Ga0268265_10042063
923 Ga0268265_10076688
924 Ga0268265_10104992
925 Ga0268264_10026707
926 Ga0268264_10028040
927 Ga0268264_10074387
928 Ga0268264_10079468
929 Ga0307408_100101284
930 Ga0307408_100445200
931 Ga0307406_10270378
932 Ga0307409_100457662
933 Ga0307416_100011470
934 Ga0307416_100284180
935 Ga0373940_0002263
936 Ga0373940_0042169
937 Ga0373932_0012636
938 Ga0373960_0010434
939 Ga0373942_0043838
940 Ga0373931_0012335
941 Ga0373931_0176970
942 Ga0373925_0312796
943 Ga0395900_0001273
944 Ga0395900_0105642
945 Ga0395898_0194597
946 Ga0395905_0343812
947 Ga0395901_0000813
948 Ga0395901_0027931
949 Ga0242420_010500
950 Ga0242420_019967
951 Ga0436365_0504872
952 Ga0436365_1746390
953 Ga0436365_1913115
954 Ga0451853_1510886
955 Ga0439448_0012324
956 Ga0439455_0004116
957 Ga0439455_0011671
958 Ga0439463_066634
959 Ga0439458_0006702
960 Ga0439435_0021570
961 Ga0439459_0001754
962 Ga0439460_0008641
963 Ga0451577_0020742
964 Ga0451577_0021183
965 Ga0453683_0008298
966 Ga0453683_0021491
967 Ga0453683_0081581
968 Ga0453684_0004896
969 Ga0453684_0201470
970 Ga0453684_0295072
971 Ga0451576_0006403
972 Ga0451576_0008349
973 Ga0451576_0043155
974 Ga0451576_0069994
975 Ga0451576_0478840
976 Ga0451576_0613279
977 Ga0495603_0067759
978 Ga0495594_0034196
979 Ga0495656_0036457
980 Ga0495669_0022052
981 Ga0496102_0008769
982 Ga0496102_0022219
983 Ga0496103_0139897
984 Ga0496104_0120066
985 Ga0496106_0160918
986 Ga0496106_0402749
987 Ga0496108_0005524
988 Ga0496110_0003262
989 Ga0496112_0087481
990 Ga0501031_0031518
991 Ga0501031_0253676
992 Ga0501036_0080251
993 Ga0501036_0106185
994 Ga0501037_0180539
995 Ga0501039_0015017
996 Ga0501039_0025086
997 Ga0501039_0313960
998 Ga0501040_0005784
999 Ga0501040_0090017
1000 Ga0501040_0120832
1001 Ga0501041_0002249
1002 Ga0501041_0206367
1003 Ga0501042_0007399
1004 Ga0501042_0130140
1005 Ga0501042_0197175
1006 Ga0501042_0298205
1007 Ga0501043_0224187
1008 Ga0501043_0272244
1009 Ga0501046_0001548
1010 Ga0501046_0104968
1011 Ga0501046_0163606
1012 Ga0501048_0015313
1013 Ga0501048_0146991
1014 Ga0501048_0172564
1015 Ga0501048_0181154
1016 Ga0501069_0031247
1017 Ga0501070_0179473
1018 Ga0501070_0309271
1019 Ga0501071_0018314
1020 Ga0501071_0221109
1021 Ga0501071_0272550
1022 Ga0501072_0009078
1023 Ga0501072_0021683
1024 Ga0501074_0007432
1025 Ga0501074_0081147
1026 Ga0501075_0002646
1027 Ga0501075_0019779
1028 Ga0501075_0026042
1029 Ga0501075_0028460
1030 Ga0501075_0098267
1031 Ga0501075_0122519
1032 Ga0501076_0009231
1033 Ga0501076_0028401
1034 Ga0501076_0046595
1035 Ga0501076_0078393
1036 Ga0501076_0140746
1037 Ga0501076_0361513
1038 Ga0501077_0010952
1039 Ga0501077_0049766
1040 Ga0501077_0066148
1041 Ga0501077_0103866
1042 Ga0501079_0000872
1043 Ga0501079_0002699
1044 Ga0501079_0011633
1045 Ga0501079_0047004
1046 Ga0501079_0128805
1047 Ga0501079_0149622
1048 Ga0501079_0150345
1049 Ga0501079_0199507
1050 Ga0501080_0049557
1051 Ga0501080_0086966
1052 Ga0501080_0313172
1053 Ga0501080_0344099
1054 Ga0501081_0000510
1055 Ga0501081_0009497
1056 Ga0501081_0016762
1057 Ga0501081_0047754
1058 Ga0501081_0278200
1059 Ga0501083_0014459
1060 Ga0501083_0274122
1061 Ga0501035_0248351
1062 Ga0501045_0013874
1063 Ga0501045_0046093
1064 Ga0501045_0146139
1065 nmdc:mga05p37_129319_c1
1066 nmdc:mga05p37_19297_c1
1067 nmdc:mga05p37_25192_c1
1068 nmdc:mga05p37_259242_c1
1069 nmdc:mga05p37_3374_c1
1070 nmdc:mga05p37_34488_c1
1071 nmdc:mga05p37_39608_c1
1072 nmdc:mga05p37_4397_c1
1073 nmdc:mga05p37_57574_c1
1074 nmdc:mga05p37_650_c1
1075 nmdc:mga05p37_8789_c1
1076 nmdc:mga05p37_89243_c1
1077 nmdc:mga09592_105897_c1
1078 nmdc:mga09592_11094_c1
1079 nmdc:mga09592_16704_c1
1080 nmdc:mga09592_178846_c1
1081 nmdc:mga0qj67_11188_c1
1082 nmdc:mga0qj67_4780_c1
1083 nmdc:mga0qj67_5501_c1
1084 nmdc:mga06r32_111662_c1
1085 nmdc:mga06r32_128203_c1
1086 nmdc:mga06r32_128541_c1
1087 nmdc:mga06r32_133018_c1
1088 nmdc:mga06r32_33396_c1
1089 nmdc:mga06r32_343921_c1
1090 nmdc:mga06r32_37461_c1
1091 nmdc:mga06r32_986_c1
1092 nmdc:mga08y16_26846_c1
1093 nmdc:mga08y16_6995_c1
1094 nmdc:mga08y16_8724_c1
1095 nmdc:mga08y16_97055_c1
1096 nmdc:mga0n895_150387_c1
1097 nmdc:mga0n895_309504_c1
1098 nmdc:mga0n895_32_c1
1099 nmdc:mga0n895_358107_c1
1100 nmdc:mga0n895_431692_c1
1101 nmdc:mga0n895_4984_c1
1102 nmdc:mga0n895_50762_c1
1103 nmdc:mga0n895_54027_c1
1104 nmdc:mga0n895_8409_c1
1105 nmdc:mga0n895_8505_c1
1106 nmdc:mga0rr50_136575_c1
1107 nmdc:mga0rr50_200392_c1
1108 nmdc:mga0rr50_25796_c1
1109 nmdc:mga0rr50_304861_c1
1110 nmdc:mga08x19_100718_c1
1111 nmdc:mga08x19_5140_c1
1112 nmdc:mga08x19_9078_c1
1113 nmdc:mga0a205_11007_c1
1114 nmdc:mga0a205_11475_c1
1115 nmdc:mga0a205_129287_c1
1116 nmdc:mga0a205_16028_c1
1117 nmdc:mga0a205_16856_c1
1118 nmdc:mga0a205_291933_c1
1119 nmdc:mga0sz30_22267_c1
1120 Ga0500609_013485
1121 Ga0501084_0017737
1122 Ga0501084_0026857
1123 Ga0501084_0031302
1124 Ga0501084_0081353
1125 Ga0501082_0002210
1126 Ga0501082_0011818
1127 Ga0501082_0092968
1128 Ga0501082_0144305
1129 Ga0501082_0160725
1130 Ga0501082_0232087
1131 Ga0501082_0313120
1132 Ga0530510_0006107
1133 Ga0530510_0027937
1134 Ga0530510_0092021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01436

NHL

NHL repeat

158

186

0.98

PF01436

NHL

NHL repeat

206

233

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wwf-assembly1.cif.gz_C crystal structure of the computationally designed pizza2-sr protein 0.8612 21 89
4zlr-assembly1.cif.gz_A structure of the brat-nhl domain bound to consensus rna motif 0.8578 20 321
5chb-assembly1.cif.gz_C crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal 0.8553 124 207
7qrw-assembly1.cif.gz_A crystal structure of nhl domain of trim3 0.8446 17 321
6xg7-assembly1.cif.gz_A 1.3 a resolution structure of the of the nhl repeat region of d. melanogaster thin 0.8432 1 316
ID Description Score Start End Superfamily
af_B7YZK8_1340_1431_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9759 123 207 2.40.10.500
af_Q03601_890_974_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9649 123 199 2.40.10.500
af_D3ZQG6_660_743_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.919 164 230 2.40.10.500
af_D3ZVM4_770_855_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9053 118 199 2.40.10.500
af_B7YZK8_1340_1431_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8834 123 207 2.40.10.500
ID Description Score Start End GO Terms
AF-A0A2V6W5L8-F1-model_v4 6-bladed beta-propeller 1 1 321
AF-A0A2V6W5L8-F1-model_v4 6-bladed beta-propeller 0.9973 1 321
AF-A0A2V6U2U2-F1-model_v4 6-bladed beta-propeller 0.9965 1 283
AF-A0A1J5I6K4-F1-model_v4 6-bladed beta-propeller 0.9916 2 321
AF-A0A2V6U2U2-F1-model_v4 6-bladed beta-propeller 0.9896 1 283

Map