F464423

General Info

Members Datasets Scaffolds Average Seq Length
566 300 565 163

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0188943|Ga0436364_0188943_538_1062
Length 174
Sequence MAFDTYLLIDNAQLVKGESTATGLTPTTGWIEIFSFSWGASNPTTVGTTAAGLSAGKVSISSFNIMKKTENSSPTLFQACAQGQHFKSAKVVMRKAAGSSGKQQSFLEYDFTDLMVESIQWSGSSGGDDTPTESVSFAFAAVTVNYWPQDTATGGQGTLNTASWDLTKAAVVAA

Samples

Sample ID Description Type Environment
1 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
120 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
234 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
246 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
247 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
252 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
264 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.97
Metatranscriptomes 23.85
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 0.71
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1017266 3300002070 Bacteria 985
2 JGI24035J26624_1036463 3300002126 Unclassified 544
3 Ga0006759J45824_1030530 3300003163 Bacteria 759
4 rootH1_10223371 3300003323 Bacteria 1993
5 Ga0058859_10002689 3300004798 Bacteria 1299
6 Ga0058863_10043916 3300004799 Unclassified 757
7 Ga0058863_10160248 3300004799 Unclassified 677
8 Ga0058863_11250156 3300004799 Unclassified 541
9 Ga0058863_11600567 3300004799 Bacteria 664
10 Ga0058863_11692573 3300004799 Unclassified 1023
11 Ga0058863_11768152 3300004799 Bacteria 1396
12 Ga0058863_11879184 3300004799 Bacteria 1312
13 Ga0058861_10021285 3300004800 Unclassified 876
14 Ga0058861_10055520 3300004800 Unclassified 789
15 Ga0058861_10060554 3300004800 Bacteria 1135
16 Ga0058861_10880106 3300004800 Bacteria 916
17 Ga0058861_11678193 3300004800 Bacteria 685
18 Ga0058861_11851212 3300004800 Bacteria 2794
19 Ga0058861_12005798 3300004800 Bacteria 866
20 Ga0058861_12030534 3300004800 Unclassified 648
21 Ga0058860_11384070 3300004801 Bacteria 772
22 Ga0058860_11827503 3300004801 Bacteria 957
23 Ga0058860_11935308 3300004801 Bacteria 920
24 Ga0058862_10019101 3300004803 Bacteria 902
25 Ga0058862_12462831 3300004803 Bacteria 898
26 Ga0058862_12602324 3300004803 Unclassified 775
27 Ga0058862_12675497 3300004803 Bacteria 3137
28 Ga0058862_12789120 3300004803 Bacteria 3606
29 Ga0058862_12811295 3300004803 Unclassified 764
30 Ga0058862_12826774 3300004803 Bacteria 1598
31 Ga0058862_12863375 3300004803 Bacteria 1724
32 Ga0065715_10213561 3300005293 Bacteria 1303
33 Ga0065707_10408345 3300005295 Bacteria 844
34 Ga0065707_10411715 3300005295 Bacteria 841
35 Ga0070658_10476286 3300005327 Unclassified 1077
36 Ga0070658_10532394 3300005327 Unclassified 1016
37 Ga0070658_10823848 3300005327 Viruses 806
38 Ga0070658_11430995 3300005327 Bacteria 600
39 Ga0070676_10006828 3300005328 Bacteria 6115
40 Ga0070683_100032368 3300005329 Bacteria 4762
41 Ga0070683_100074274 3300005329 Bacteria 3175
42 Ga0070683_100451780 3300005329 Unclassified 1226
43 Ga0070690_100112985 3300005330 Bacteria 1815
44 Ga0070670_100097790 3300005331 Bacteria 2525
45 Ga0070670_100673358 3300005331 Bacteria 929
46 Ga0068869_100044414 3300005334 Bacteria 3195
47 Ga0070680_100005343 3300005336 Bacteria 9716
48 Ga0070680_100044849 3300005336 Bacteria 3593
49 Ga0070680_100084812 3300005336 Bacteria 2617
50 Ga0070680_100093191 3300005336 Bacteria 2495
51 Ga0070682_100173940 3300005337 Bacteria 1498
52 Ga0070682_100259043 3300005337 Bacteria 1258
53 Ga0068868_100032896 3300005338 Bacteria 3992
54 Ga0068868_100332572 3300005338 Bacteria 1297
55 Ga0070660_100009773 3300005339 Bacteria 6759
56 Ga0070660_100119309 3300005339 Bacteria 2104
57 Ga0070660_100343778 3300005339 Bacteria 1228
58 Ga0070660_100804223 3300005339 Unclassified 791
59 Ga0070689_100005824 3300005340 Bacteria 8459
60 Ga0070687_100000855 3300005343 Bacteria 10203
61 Ga0070661_100002293 3300005344 Bacteria 13137
62 Ga0070661_100372414 3300005344 Unclassified 1124
63 Ga0070692_10063304 3300005345 Unclassified 1954
64 Ga0070692_10294959 3300005345 Unclassified 988
65 Ga0070668_100016538 3300005347 Bacteria 5514
66 Ga0070668_100050950 3300005347 Bacteria 3189
67 Ga0070669_100011724 3300005353 Bacteria 6217
68 Ga0070669_100022607 3300005353 Bacteria 4496
69 Ga0070669_100373946 3300005353 Bacteria 1161
70 Ga0070675_100015280 3300005354 Bacteria 6065
71 Ga0070675_100544511 3300005354 Bacteria 1049
72 Ga0070671_100313880 3300005355 Unclassified 1335
73 Ga0070671_100786648 3300005355 Bacteria 828
74 Ga0070674_100030942 3300005356 Bacteria 3541
75 Ga0070674_100184007 3300005356 Bacteria 1602
76 Ga0070673_100002971 3300005364 Bacteria 10462
77 Ga0070688_100217115 3300005365 Bacteria 1346
78 Ga0070659_100012262 3300005366 Bacteria 6355
79 Ga0070667_100011965 3300005367 Bacteria 7179
80 Ga0070667_101178817 3300005367 Unclassified 717
81 Ga0070709_10217762 3300005434 Bacteria 1360
82 Ga0070714_100005654 3300005435 Bacteria 9564
83 Ga0070714_100854849 3300005435 Unclassified 882
84 Ga0070701_10013570 3300005438 Bacteria 3711
85 Ga0070711_100225703 3300005439 Bacteria 1458
86 Ga0070700_100176697 3300005441 Bacteria 1483
87 Ga0070694_100050722 3300005444 Bacteria 2798
88 Ga0070663_100011509 3300005455 Bacteria 5558
89 Ga0070662_100177923 3300005457 Bacteria 1675
90 Ga0070662_100701124 3300005457 Bacteria 856
91 Ga0070681_10000138 3300005458 Bacteria 55327
92 Ga0070681_10013569 3300005458 Bacteria 8104
93 Ga0070681_11095034 3300005458 Unclassified 717
94 Ga0070681_11584414 3300005458 Bacteria 580
95 Ga0068867_100013811 3300005459 Bacteria 5717
96 Ga0068867_100447335 3300005459 Bacteria 1100
97 Ga0070685_10010771 3300005466 Bacteria 4762
98 Ga0070699_100308751 3300005518 Bacteria 1420
99 Ga0070679_100017382 3300005530 Bacteria 6960
100 Ga0070679_100048201 3300005530 Bacteria 4246
101 Ga0070679_100084500 3300005530 Bacteria 3162
102 Ga0070679_100095790 3300005530 Bacteria 2956
103 Ga0070679_100136163 3300005530 Bacteria 2437
104 Ga0070679_100679220 3300005530 Bacteria 972
105 Ga0070684_100023416 3300005535 Bacteria 5165
106 Ga0070684_100071222 3300005535 Bacteria 3060
107 Ga0070684_100207260 3300005535 Bacteria 1787
108 Ga0068853_100012448 3300005539 Bacteria 6921
109 Ga0068853_101193960 3300005539 Unclassified 734
110 Ga0070672_100011732 3300005543 Bacteria 6121
111 Ga0070672_101070864 3300005543 Bacteria 716
112 Ga0070695_100124582 3300005545 Bacteria 1768
113 Ga0070693_100268818 3300005547 Unclassified 1137
114 Ga0070665_100069054 3300005548 Bacteria 3542
115 Ga0070704_100328776 3300005549 Bacteria 1283
116 Ga0070704_100367846 3300005549 Bacteria 1218
117 Ga0068855_100009784 3300005563 Bacteria 11565
118 Ga0068855_100023427 3300005563 Bacteria 7395
119 Ga0068855_100161798 3300005563 Bacteria 2540
120 Ga0068855_100169573 3300005563 Bacteria 2472
121 Ga0068855_100433172 3300005563 Bacteria 1437
122 Ga0068855_100450395 3300005563 Bacteria 1405
123 Ga0070664_100018191 3300005564 Bacteria 5768
124 Ga0070664_100077612 3300005564 Bacteria 2856
125 Ga0070664_102045798 3300005564 Unclassified 543
126 Ga0068857_100006328 3300005577 Bacteria 10139
127 Ga0068857_100025870 3300005577 Bacteria 5168
128 Ga0068857_100047331 3300005577 Bacteria 3818
129 Ga0068857_100650282 3300005577 Unclassified 999
130 Ga0068854_100005214 3300005578 Bacteria 8196
131 Ga0068854_100030696 3300005578 Bacteria 3729
132 Ga0068856_100123323 3300005614 Bacteria 2593
133 Ga0070702_100061349 3300005615 Bacteria 2189
134 Ga0068852_100009334 3300005616 Bacteria 7281
135 Ga0068852_100084681 3300005616 Bacteria 2822
136 Ga0068852_100099841 3300005616 Bacteria 2617
137 Ga0068852_100224043 3300005616 Bacteria 1790
138 Ga0068852_100502219 3300005616 Bacteria 1208
139 Ga0068859_100016780 3300005617 Bacteria 7353
140 Ga0068859_100854677 3300005617 Bacteria 996
141 Ga0068864_100047063 3300005618 Bacteria 3703
142 Ga0068864_100479288 3300005618 Bacteria 1194
143 Ga0068866_10147712 3300005718 Bacteria 1357
144 Ga0068861_100003562 3300005719 Bacteria 10356
145 Ga0068861_100022754 3300005719 Bacteria 4519
146 Ga0068861_100262581 3300005719 Bacteria 1479
147 Ga0068851_10051220 3300005834 Bacteria 2098
148 Ga0068851_10246283 3300005834 Bacteria 1012
149 Ga0068870_10013131 3300005840 Bacteria 3885
150 Ga0068863_100007854 3300005841 Bacteria 10432
151 Ga0068858_100030490 3300005842 Bacteria 5007
152 Ga0068860_100064974 3300005843 Bacteria 3465
153 Ga0068862_100000615 3300005844 Bacteria 37063
154 Ga0068862_100063715 3300005844 Bacteria 3172
155 Ga0068862_100086752 3300005844 Bacteria 2722
156 Ga0070717_10262815 3300006028 Bacteria 1527
157 Ga0070712_100020282 3300006175 Bacteria 4348
158 Ga0075369_10013690 3300006186 Bacteria 3227
159 Ga0075366_10366758 3300006195 Bacteria 885
160 Ga0097621_100673004 3300006237 Bacteria 951
161 Ga0068871_100577132 3300006358 Bacteria 1021
162 Ga0075428_100022293 3300006844 Bacteria 7012
163 Ga0075428_100077788 3300006844 Bacteria 3621
164 Ga0075430_100002899 3300006846 Bacteria 14354
165 Ga0075430_100140167 3300006846 Unclassified 2014
166 Ga0075431_100204134 3300006847 Bacteria 2021
167 Ga0075433_10147469 3300006852 Bacteria 2092
168 Ga0075433_10257013 3300006852 Bacteria 1549
169 Ga0075434_100009939 3300006871 Bacteria 8902
170 Ga0075434_100362520 3300006871 Bacteria 1470
171 Ga0068865_100003660 3300006881 Bacteria 9232
172 Ga0075436_100029167 3300006914 Bacteria 3794
173 Ga0097620_100016780 3300006931 Bacteria 7353
174 Ga0097620_100854763 3300006931 Bacteria 996
175 Ga0075435_100305827 3300007076 Bacteria 1360
176 Ga0105240_10065804 3300009093 Bacteria 4498
177 Ga0105240_10699435 3300009093 Bacteria 1107
178 Ga0105240_10969627 3300009093 Bacteria 911
179 Ga0111539_10050328 3300009094 Bacteria 4963
180 Ga0111539_10827655 3300009094 Bacteria 1077
181 Ga0105245_10143363 3300009098 Bacteria 2252
182 Ga0105247_10358408 3300009101 Bacteria 1028
183 Ga0114129_10084955 3300009147 Bacteria 4392
184 Ga0114129_10162678 3300009147 Bacteria 3047
185 Ga0114129_10458990 3300009147 Bacteria 1670
186 Ga0105243_10093455 3300009148 Bacteria 2482
187 Ga0105241_10070795 3300009174 Bacteria 2707
188 Ga0105242_10013791 3300009176 Bacteria 6255
189 Ga0105242_10470888 3300009176 Unclassified 1188
190 Ga0105248_10240729 3300009177 Bacteria 2037
191 Ga0105248_12138956 3300009177 Bacteria 636
192 Ga0105237_10307862 3300009545 Bacteria 1587
193 Ga0105237_10476559 3300009545 Bacteria 1254
194 Ga0105238_10231130 3300009551 Bacteria 1826
195 Ga0105249_10001343 3300009553 Bacteria 21505
196 Ga0105249_10007447 3300009553 Bacteria 9549
197 Ga0105249_10188470 3300009553 Bacteria 2011
198 Ga0105249_11031242 3300009553 Unclassified 892
199 Ga0105239_10051269 3300010375 Bacteria 4524
200 Ga0105239_10722447 3300010375 Unclassified 1139
201 Ga0105246_10205190 3300011119 Bacteria 1535
202 Ga0157373_10049317 3300013100 Bacteria 3000
203 Ga0157373_10105699 3300013100 Bacteria 1979
204 Ga0157373_10521256 3300013100 Bacteria 860
205 Ga0157373_10715023 3300013100 Unclassified 735
206 Ga0157371_10017291 3300013102 Bacteria 5362
207 Ga0157370_10002945 3300013104 Bacteria 20266
208 Ga0157370_10016201 3300013104 Bacteria 7554
209 Ga0157370_10196751 3300013104 Bacteria 1871
210 Ga0157370_10480988 3300013104 Bacteria 1141
211 Ga0157370_10610952 3300013104 Bacteria 998
212 Ga0157370_10949370 3300013104 Unclassified 779
213 Ga0157369_10037789 3300013105 Bacteria 5284
214 Ga0157369_10080666 3300013105 Bacteria 3484
215 Ga0157369_10244768 3300013105 Bacteria 1872
216 Ga0157369_10945693 3300013105 Bacteria 883
217 Ga0157374_10182715 3300013296 Bacteria 2049
218 Ga0157378_10041350 3300013297 Bacteria 4088
219 Ga0157378_10101881 3300013297 Plasmid 2623
220 Ga0163162_10018823 3300013306 Bacteria 6770
221 Ga0163162_10024346 3300013306 Bacteria 5973
222 Ga0163162_10513363 3300013306 Bacteria 1328
223 Ga0157372_10017435 3300013307 Bacteria 7708
224 Ga0157372_10154293 3300013307 Bacteria 2652
225 Ga0157372_10178593 3300013307 Bacteria 2457
226 Ga0157372_10343204 3300013307 Bacteria 1740
227 Ga0157375_10010504 3300013308 Bacteria 8152
228 Ga0157375_10355447 3300013308 Bacteria 1631
229 Ga0157375_10517079 3300013308 Bacteria 1357
230 Ga0163163_10267348 3300014325 Bacteria 1761
231 Ga0157380_10068112 3300014326 Unclassified 2868
232 Ga0157380_10123830 3300014326 Bacteria 2194
233 Ga0157380_10150703 3300014326 Bacteria 2010
234 Ga0157380_12168625 3300014326 Unclassified 619
235 Ga0157377_10063072 3300014745 Bacteria 2122
236 Ga0157379_10003198 3300014968 Bacteria 13874
237 Ga0163161_10186493 3300017792 Bacteria 1593
238 Ga0197907_10706547 3300020069 Bacteria 2377
239 Ga0197907_11348615 3300020069 Bacteria 4439
240 Ga0206356_11816379 3300020070 Bacteria 1699
241 Ga0206356_11847643 3300020070 Unclassified 873
242 Ga0206349_1352915 3300020075 Unclassified 874
243 Ga0206355_1576845 3300020076 Unclassified 1431
244 Ga0206355_1577345 3300020076 Bacteria 1304
245 Ga0206351_10048966 3300020077 Unclassified 883
246 Ga0206352_10174033 3300020078 Unclassified 1042
247 Ga0206352_10622456 3300020078 Unclassified 745
248 Ga0206352_11166897 3300020078 Unclassified 974
249 Ga0206350_10156355 3300020080 Unclassified 957
250 Ga0206350_10230214 3300020080 Unclassified 742
251 Ga0206354_10852653 3300020081 Unclassified 982
252 Ga0206354_11317698 3300020081 Bacteria 3929
253 Ga0206353_10877890 3300020082 Unclassified 990
254 Ga0206353_11792761 3300020082 Bacteria 2942
255 Ga0213872_10000128 3300021361 Bacteria 69106
256 Ga0213874_10037005 3300021377 Unclassified 1442
257 Ga0213876_10007122 3300021384 Bacteria 6096
258 Ga0213876_10021352 3300021384 Bacteria 3425
259 Ga0213875_10016864 3300021388 Archaea 3538
260 Ga0224712_10057958 3300022467 Bacteria 1532
261 Ga0224712_10154541 3300022467 Bacteria 1019
262 Ga0224712_10341565 3300022467 Unclassified 706
263 Ga0207697_10005846 3300025315 Bacteria 5656
264 Ga0207656_10011296 3300025321 Bacteria 3372
265 Ga0207642_10043919 3300025899 Bacteria 1975
266 Ga0207710_10482636 3300025900 Bacteria 642
267 Ga0207688_10035092 3300025901 Bacteria 2778
268 Ga0207647_10048946 3300025904 Bacteria 2623
269 Ga0207699_10474400 3300025906 Bacteria 900
270 Ga0207699_10498285 3300025906 Bacteria 879
271 Ga0207645_10000786 3300025907 Bacteria 26518
272 Ga0207643_10004073 3300025908 Bacteria 7861
273 Ga0207705_10354427 3300025909 Unclassified 1131
274 Ga0207705_10466669 3300025909 Unclassified 979
275 Ga0207654_10461931 3300025911 Unclassified 892
276 Ga0207707_10003061 3300025912 Bacteria 14858
277 Ga0207707_10032019 3300025912 Bacteria 4603
278 Ga0207707_10039094 3300025912 Bacteria 4147
279 Ga0207707_10637388 3300025912 Bacteria 899
280 Ga0207695_10002651 3300025913 Bacteria 26154
281 Ga0207695_10032703 3300025913 Bacteria 5688
282 Ga0207695_10846718 3300025913 Bacteria 794
283 Ga0207671_10418040 3300025914 Bacteria 1067
284 Ga0207663_10150106 3300025916 Bacteria 1634
285 Ga0207660_10039206 3300025917 Bacteria 3310
286 Ga0207660_10230448 3300025917 Bacteria 1456
287 Ga0207660_10279080 3300025917 Bacteria 1325
288 Ga0207662_10001813 3300025918 Bacteria 10490
289 Ga0207657_10049205 3300025919 Bacteria 3675
290 Ga0207657_10062691 3300025919 Bacteria 3182
291 Ga0207657_10535229 3300025919 Unclassified 916
292 Ga0207657_10747855 3300025919 Unclassified 758
293 Ga0207649_10008483 3300025920 Bacteria 5604
294 Ga0207649_10014851 3300025920 Bacteria 4368
295 Ga0207649_10124688 3300025920 Bacteria 1741
296 Ga0207652_10003734 3300025921 Bacteria 12493
297 Ga0207652_10067380 3300025921 Bacteria 3104
298 Ga0207652_10113015 3300025921 Bacteria 2410
299 Ga0207652_10147492 3300025921 Bacteria 2106
300 Ga0207652_10211811 3300025921 Bacteria 1745
301 Ga0207681_10013302 3300025923 Bacteria 5089
302 Ga0207681_10016554 3300025923 Bacteria 4614
303 Ga0207694_10717788 3300025924 Unclassified 843
304 Ga0207650_10015220 3300025925 Bacteria 5354
305 Ga0207659_10046573 3300025926 Bacteria 3063
306 Ga0207687_11009218 3300025927 Bacteria 714
307 Ga0207664_10016765 3300025929 Bacteria 5352
308 Ga0207664_10743126 3300025929 Unclassified 882
309 Ga0207644_10536114 3300025931 Bacteria 968
310 Ga0207690_10027238 3300025932 Bacteria 3611
311 Ga0207690_10114423 3300025932 Bacteria 1948
312 Ga0207706_10000699 3300025933 Bacteria 35071
313 Ga0207706_10246043 3300025933 Bacteria 1563
314 Ga0207686_10069220 3300025934 Bacteria 2264
315 Ga0207709_10106838 3300025935 Bacteria 1863
316 Ga0207670_10089422 3300025936 Bacteria 2173
317 Ga0207669_10118050 3300025937 Bacteria 1794
318 Ga0207669_11037025 3300025937 Bacteria 690
319 Ga0207704_10074271 3300025938 Bacteria 2169
320 Ga0207691_10000620 3300025940 Bacteria 35183
321 Ga0207691_10019226 3300025940 Bacteria 6466
322 Ga0207691_10834149 3300025940 Bacteria 774
323 Ga0207711_10067035 3300025941 Bacteria 3106
324 Ga0207689_10004256 3300025942 Bacteria 13014
325 Ga0207661_10039298 3300025944 Bacteria 3713
326 Ga0207661_10072452 3300025944 Bacteria 2818
327 Ga0207661_10314158 3300025944 Bacteria 1407
328 Ga0207679_10005170 3300025945 Bacteria 8173
329 Ga0207679_10007499 3300025945 Bacteria 6924
330 Ga0207679_10087897 3300025945 Bacteria 2394
331 Ga0207667_10002390 3300025949 Bacteria 23495
332 Ga0207667_10022089 3300025949 Bacteria 7038
333 Ga0207667_10353564 3300025949 Bacteria 1498
334 Ga0207667_10643536 3300025949 Bacteria 1066
335 Ga0207651_10022256 3300025960 Bacteria 3871
336 Ga0207712_10000556 3300025961 Bacteria 30175
337 Ga0207712_10013819 3300025961 Bacteria 5179
338 Ga0207712_10349153 3300025961 Bacteria 1229
339 Ga0207712_11021289 3300025961 Unclassified 734
340 Ga0207668_10013281 3300025972 Bacteria 5066
341 Ga0207668_10023108 3300025972 Bacteria 3991
342 Ga0207640_10055318 3300025981 Bacteria 2599
343 Ga0207658_10036477 3300025986 Bacteria 3525
344 Ga0207677_10025641 3300026023 Bacteria 3681
345 Ga0207703_10060471 3300026035 Bacteria 3098
346 Ga0207639_10088322 3300026041 Bacteria 2473
347 Ga0207639_10765249 3300026041 Unclassified 898
348 Ga0207678_10019269 3300026067 Bacteria 5992
349 Ga0207708_10010733 3300026075 Bacteria 6809
350 Ga0207702_10216141 3300026078 Bacteria 1784
351 Ga0207641_10010432 3300026088 Bacteria 7634
352 Ga0207648_10041362 3300026089 Bacteria 4047
353 Ga0207648_10153056 3300026089 Bacteria 2035
354 Ga0207648_10481573 3300026089 Bacteria 1133
355 Ga0207674_10000562 3300026116 Bacteria 48566
356 Ga0207674_10001289 3300026116 Bacteria 32724
357 Ga0207674_10335219 3300026116 Bacteria 1462
358 Ga0207675_100000109 3300026118 Bacteria 66734
359 Ga0207675_100036407 3300026118 Bacteria 4591
360 Ga0207675_100366281 3300026118 Bacteria 1415
361 Ga0207698_10015930 3300026142 Bacteria 5054
362 Ga0207698_10114329 3300026142 Bacteria 2270
363 Ga0207698_10526437 3300026142 Bacteria 1154
364 Ga0207428_10350777 3300027907 Bacteria 1086
365 Ga0268266_10454885 3300028379 Bacteria 1217
366 Ga0268266_10889769 3300028379 Unclassified 861
367 Ga0268265_10001840 3300028380 Bacteria 16909
368 Ga0268265_10028860 3300028380 Bacteria 3976
369 Ga0268265_10365737 3300028380 Bacteria 1322
370 Ga0268264_10048178 3300028381 Bacteria 3544
371 Ga0265323_10004555 3300028653 Bacteria 5967
372 Ga0265338_10009700 3300028800 Bacteria 11418
373 Ga0307511_10000295 3300030521 Bacteria 52686
374 Ga0307511_10000379 3300030521 Bacteria 47487
375 Ga0265327_10133739 3300031251 Bacteria 1164
376 Ga0307408_100019238 3300031548 Bacteria 4595
377 Ga0307405_10007099 3300031731 Bacteria 5569
378 Ga0307405_10076143 3300031731 Bacteria 2176
379 Ga0307405_10086383 3300031731 Bacteria 2065
380 Ga0307405_11758886 3300031731 Bacteria 550
381 Ga0247548_100357 3300031814 Bacteria 1556
382 Ga0307413_10007449 3300031824 Bacteria 5084
383 Ga0307413_10071926 3300031824 Bacteria 2181
384 Ga0307413_10095838 3300031824 Bacteria 1946
385 Ga0307413_10295718 3300031824 Bacteria 1225
386 Ga0307413_11741431 3300031824 Bacteria 556
387 Ga0307410_10000129 3300031852 Bacteria 27078
388 Ga0307410_10042651 3300031852 Bacteria 3001
389 Ga0307410_10091101 3300031852 Bacteria 2164
390 Ga0307410_10211860 3300031852 Bacteria 1485
391 Ga0307410_10235126 3300031852 Bacteria 1417
392 Ga0307406_10000417 3300031901 Bacteria 24748
393 Ga0307406_10002422 3300031901 Bacteria 10141
394 Ga0307406_10072572 3300031901 Bacteria 2260
395 Ga0307406_11156243 3300031901 Unclassified 670
396 Ga0307407_10392506 3300031903 Bacteria 994
397 Ga0307409_100000079 3300031995 Bacteria 34726
398 Ga0307409_100080733 3300031995 Bacteria 2626
399 Ga0307409_100186168 3300031995 Bacteria 1843
400 Ga0307409_100518130 3300031995 Bacteria 1164
401 Ga0307409_100579820 3300031995 Bacteria 1105
402 Ga0307416_100004690 3300032002 Bacteria 8279
403 Ga0307416_100142351 3300032002 Bacteria 2182
404 Ga0307416_100157367 3300032002 Bacteria 2094
405 Ga0307416_100286094 3300032002 Bacteria 1629
406 Ga0307416_100842966 3300032002 Bacteria 1014
407 Ga0307414_10004632 3300032004 Bacteria 7486
408 Ga0307414_10139212 3300032004 Bacteria 1897
409 Ga0307414_10186463 3300032004 Bacteria 1674
410 Ga0307414_10746585 3300032004 Bacteria 889
411 Ga0307411_10162226 3300032005 Unclassified 1676
412 Ga0307415_100024831 3300032126 Bacteria 3751
413 Ga0307415_100029467 3300032126 Bacteria 3508
414 Ga0307415_100045485 3300032126 Bacteria 2943
415 Ga0307415_100061777 3300032126 Bacteria 2595
416 Ga0307415_100071208 3300032126 Bacteria 2444
417 Ga0307415_100395540 3300032126 Bacteria 1178
418 Ga0395899_0614480 3300037312 Unclassified 691
419 Ga0395905_0440733 3300037471 Bacteria 1200
420 Ga0436364_0188943 3300037853 Bacteria 6858
421 Ga0436364_0459198 3300037853 Archaea 6074
422 Ga0436364_1280777 3300037853 Unclassified 962
423 Ga0436365_0152204 3300039437 Bacteria 32272
424 Ga0436365_0289034 3300039437 Unclassified 749
425 Ga0436365_0924513 3300039437 Bacteria 3002
426 Ga0436365_1852273 3300039437 Bacteria 1029
427 Ga0436361_0282335 3300039447 Archaea 1058
428 Ga0436361_0482954 3300039447 Bacteria 2820
429 Ga0436361_0610116 3300039447 Bacteria 176709
430 Ga0436363_0488288 3300039450 Bacteria 693
431 Ga0436363_1617116 3300039450 Bacteria 3133
432 Ga0466972_0385360 3300044658 Unclassified 657
433 Ga0466963_0242654 3300044694 Bacteria 1264
434 Ga0466957_0231401 3300044842 Bacteria 1224
435 Ga0466957_1043298 3300044842 Bacteria 588
436 Ga0451576_0039203 3300045051 Bacteria 5014
437 Ga0451576_0823019 3300045051 Bacteria 975
438 Ga0466967_0081391 3300045976 Bacteria 2925
439 Ga0466967_0276881 3300045976 Bacteria 1609
440 Ga0495629_0088645 3300046459 Bacteria 2158
441 Ga0495582_0125473 3300046473 Bacteria 1448
442 Ga0495639_0473394 3300046475 Bacteria 638
443 Ga0495621_0308776 3300046539 Unclassified 657
444 Ga0495658_0048593 3300046683 Bacteria 2393
445 Ga0495670_0245840 3300046691 Unclassified 953
446 Ga0496106_0382309 3300048909 Bacteria 1131
447 Ga0496109_0072961 3300048912 Bacteria 3154
448 Ga0496110_1399891 3300048913 Bacteria 609
449 Ga0496113_0833965 3300048916 Unclassified 731
450 Ga0501306_033230 3300049127 Bacteria 775
451 Ga0501308_026253 3300049128 Bacteria 759
452 Ga0501309_024531 3300049129 Bacteria 862
453 Ga0501304_021701 3300049160 Bacteria 640
454 Ga0501304_038154 3300049160 Unclassified 530
455 Ga0501305_050458 3300049161 Bacteria 697
456 Ga0501305_107806 3300049161 Bacteria 524
457 Ga0501305_107892 3300049161 Bacteria 524
458 Ga0501307_038029 3300049162 Bacteria 690
459 Ga0501307_068643 3300049162 Bacteria 562
460 Ga0501298_071718 3300049521 Bacteria 749
461 Ga0501311_034545 3300049527 Unclassified 745
462 Ga0501311_035920 3300049527 Unclassified 735
463 Ga0501312_051317 3300049528 Bacteria 696
464 Ga0501314_023775 3300049530 Bacteria 651
465 Ga0501317_024418 3300049533 Bacteria 841
466 Ga0501318_029747 3300049534 Bacteria 738
467 Ga0501320_017243 3300049536 Bacteria 806
468 Ga0501321_039265 3300049537 Bacteria 660
469 Ga0501321_062981 3300049537 Bacteria 564
470 Ga0501322_007465 3300049538 Bacteria 797
471 Ga0501323_018212 3300049539 Bacteria 907
472 Ga0501323_073047 3300049539 Unclassified 551
473 Ga0501324_023484 3300049540 Bacteria 642
474 Ga0501333_011320 3300049549 Bacteria 643
475 Ga0501227_174642 3300049665 Bacteria 602
476 Ga0501235_133151 3300049669 Unclassified 631
477 Ga0501242_039431 3300049674 Bacteria 664
478 Ga0501249_121170 3300049679 Bacteria 639
479 Ga0501261_037334 3300049690 Bacteria 755
480 Ga0501225_0167629 3300049705 Bacteria 679
481 Ga0501229_064231 3300049706 Unclassified 565
482 Ga0501283_081996 3300049779 Bacteria 608
483 nmdc:mga05p37_252491_c1 3300050507 Bacteria 2114
484 nmdc:mga05p37_277217_c1 3300050507 Bacteria 2001
485 nmdc:mga05p37_554551_c1 3300050507 Bacteria 1307
486 nmdc:mga09592_64978_c1 3300050508 Bacteria 3089
487 nmdc:mga0qj67_35220_c1 3300050509 Bacteria 3913
488 nmdc:mga0qj67_4675_c1 3300050509 Bacteria 9938
489 nmdc:mga06r32_257246_c1 3300050510 Bacteria 1734
490 nmdc:mga08y16_58011_c1 3300050511 Bacteria 4045
491 nmdc:mga08y16_59257_c1 3300050511 Plasmid 4000
492 nmdc:mga0n895_408074_c1 3300050512 Bacteria 1374
493 nmdc:mga0rr50_132519_c1 3300050513 Bacteria 1997
494 nmdc:mga08x19_19436_c1 3300050514 Bacteria 4168
495 nmdc:mga08x19_215250_c1 3300050514 Bacteria 1319
496 nmdc:mga0a205_1059936_c1 3300050515 Bacteria 658
497 nmdc:mga0a205_185077_c1 3300050515 Bacteria 1976
498 nmdc:mga0sz30_14723_c1 3300050516 Bacteria 3083
499 Ga0500646_0002211 3300053090 Bacteria 5075
500 Ga0500655_015196 3300053133 Bacteria 1411
501 Ga0500568_0038706 3300053139 Bacteria 1929
502 Ga0500604_0006628 3300053151 Bacteria 3062
503 Ga0500616_0031076 3300053153 Bacteria 2928
504 Ga0587084_013505 3300059477 Bacteria 1124
505 Ga0587066_008238 3300059490 Bacteria 1441
506 Ga0587066_014044 3300059490 Bacteria 1224
507 Ga0587066_052377 3300059490 Bacteria 808
508 Ga0587066_067802 3300059490 Bacteria 744
509 Ga0587070_011739 3300059491 Bacteria 1317
510 Ga0587070_047361 3300059491 Bacteria 846
511 Ga0587070_076424 3300059491 Unclassified 726
512 Ga0587070_124662 3300059491 Bacteria 620
513 Ga0587077_019083 3300059493 Bacteria 1189
514 Ga0587077_049869 3300059493 Unclassified 872
515 Ga0587077_062594 3300059493 Bacteria 810
516 Ga0587080_017725 3300059503 Bacteria 1137
517 Ga0587080_031076 3300059503 Unclassified 931
518 Ga0587082_009145 3300059504 Bacteria 1399
519 Ga0587082_013629 3300059504 Bacteria 1228
520 Ga0587083_0004065 3300059505 Bacteria 1999
521 Ga0587083_0008362 3300059505 Bacteria 1616
522 Ga0587083_0028972 3300059505 Bacteria 1087
523 Ga0587083_0099509 3300059505 Unclassified 722
524 Ga0587085_005279 3300059506 Bacteria 1514
525 Ga0587085_008289 3300059506 Bacteria 1322
526 Ga0587085_047530 3300059506 Unclassified 771
527 Ga0587086_030788 3300059507 Unclassified 788
528 Ga0587088_010172 3300059508 Bacteria 1372
529 Ga0587089_026175 3300059509 Unclassified 836
530 Ga0587090_014984 3300059510 Bacteria 1140
531 Ga0587091_016977 3300059511 Bacteria 1220
532 Ga0587091_020249 3300059511 Bacteria 1153
533 Ga0587092_015765 3300059512 Bacteria 1111
534 Ga0587092_016062 3300059512 Bacteria 1104
535 Ga0587094_010459 3300059513 Bacteria 1204
536 Ga0587094_034167 3300059513 Unclassified 802
537 Ga0587106_015741 3300059605 Unclassified 1061
538 Ga0587106_022988 3300059605 Unclassified 942
539 Ga0587106_047487 3300059605 Unclassified 750
540 Ga0587125_011741 3300059607 Bacteria 924
541 Ga0587101_025031 3300059623 Unclassified 891
542 Ga0587109_013958 3300059624 Bacteria 1341
543 Ga0587109_056521 3300059624 Unclassified 817
544 Ga0587115_024954 3300059626 Unclassified 856
545 Ga0587117_018263 3300059627 Bacteria 952
546 Ga0587117_025262 3300059627 Unclassified 859
547 Ga0587128_086704 3300059630 Unclassified 636
548 Ga0587062_021049 3300059639 Bacteria 925
549 Ga0587067_183804 3300059640 Bacteria 546
550 Ga0587068_053639 3300059641 Unclassified 760
551 Ga0587075_012539 3300059644 Bacteria 1153
552 Ga0587076_021116 3300059645 Bacteria 1075
553 Ga0587076_058408 3300059645 Unclassified 771
554 Ga0587076_104102 3300059645 Unclassified 638
555 Ga0587078_007923 3300059646 Unclassified 1181
556 Ga0587078_044305 3300059646 Unclassified 637
557 Ga0587078_050147 3300059646 Unclassified 610
558 Ga0587079_000838 3300059647 Bacteria 3094
559 Ga0587102_022410 3300059649 Unclassified 722
560 Ga0587107_006324 3300059652 Bacteria 1293
561 Ga0587071_001679 3300060344 Bacteria 2839
562 Ga0587071_015825 3300060344 Bacteria 1328
563 Ga0587071_062560 3300060344 Unclassified 794
564 Ga0587111_0017988 3300060346 Bacteria 1324
565 Ga0587111_0078762 3300060346 Bacteria 784

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100009784 Ga0068855_10000978413 126
2 3300020078 Ga0206352_10622456 Ga0206352_106224561 126
3 3300025949 Ga0207667_10002390 Ga0207667_100023906 126
4 3300025906 Ga0207699_10474400 Ga0207699_104744002 143
5 3300004801 Ga0058860_11935308 Ga0058860_119353081 145
6 3300031731 Ga0307405_10086383 Ga0307405_100863832 145
7 3300031852 Ga0307410_10211860 Ga0307410_102118602 145
8 3300032126 Ga0307415_100045485 Ga0307415_1000454852 145
9 3300031731 Ga0307405_11758886 Ga0307405_117588861 148
10 3300031824 Ga0307413_10095838 Ga0307413_100958381 148
11 3300031852 Ga0307410_10235126 Ga0307410_102351262 148
12 3300031901 Ga0307406_10072572 Ga0307406_100725722 148
13 3300031901 Ga0307406_11156243 Ga0307406_111562432 148
14 3300031995 Ga0307409_100579820 Ga0307409_1005798202 148
15 3300032002 Ga0307416_100142351 Ga0307416_1001423512 148
16 3300032004 Ga0307414_10139212 Ga0307414_101392122 148
17 3300032004 Ga0307414_10746585 Ga0307414_107465852 148
18 3300032005 Ga0307411_10162226 Ga0307411_101622263 148
19 3300032126 Ga0307415_100029467 Ga0307415_1000294674 148
20 3300049521 Ga0501298_071718 Ga0501298_071718_18_509 148
21 3300049669 Ga0501235_133151 Ga0501235_133151_60_551 148
22 3300049679 Ga0501249_121170 Ga0501249_121170_137_628 148
23 3300049706 Ga0501229_064231 Ga0501229_064231_39_530 148
24 3300032126 Ga0307415_100395540 Ga0307415_1003955402 150
25 3300005563 Ga0068855_100433172 Ga0068855_1004331722 151
26 3300032002 Ga0307416_100286094 Ga0307416_1002860941 151
27 3300031852 Ga0307410_10042651 Ga0307410_100426512 152
28 3300031903 Ga0307407_10392506 Ga0307407_103925062 152
29 3300031995 Ga0307409_100080733 Ga0307409_1000807333 152
30 3300032126 Ga0307415_100024831 Ga0307415_1000248312 152
31 3300039447 Ga0436361_0482954 Ga0436361_0482954_261_749 152
32 3300049527 Ga0501311_034545 Ga0501311_034545_55_546 152
33 3300028653 Ga0265323_10004555 Ga0265323_100045554 154
34 3300044658 Ga0466972_0385360 Ga0466972_0385360_40_540 155
35 3300059490 Ga0587066_067802 Ga0587066_067802_244_729 155
36 iso_pu_bacteria 2920107658 2920114291 155
37 3300025909 Ga0207705_10466669 Ga0207705_104666691 156
38 3300006846 Ga0075430_100140167 Ga0075430_1001401672 158
39 3300006847 Ga0075431_100204134 Ga0075431_1002041342 158
40 3300009147 Ga0114129_10084955 Ga0114129_100849556 158
41 3300021361 Ga0213872_10000128 Ga0213872_1000012839 158
42 3300021377 Ga0213874_10037005 Ga0213874_100370051 158
43 3300021388 Ga0213875_10016864 Ga0213875_100168643 158
44 3300037853 Ga0436364_0459198 Ga0436364_0459198_5325_5831 158
45 3300039447 Ga0436361_0282335 Ga0436361_0282335_200_706 158
46 3300039447 Ga0436361_0610116 Ga0436361_0610116_42209_42715 158
47 3300039450 Ga0436363_1617116 Ga0436363_1617116_1405_1911 158
48 3300045051 Ga0451576_0823019 Ga0451576_0823019_356_856 158
49 3300050510 nmdc:mga06r32_257246_c1 nmdc:mga06r32_257246_c1_646_1152 158
50 3300005295 Ga0065707_10408345 Ga0065707_104083451 159
51 3300005347 Ga0070668_100050950 Ga0070668_1000509503 159
52 3300005353 Ga0070669_100022607 Ga0070669_1000226075 159
53 3300005457 Ga0070662_100177923 Ga0070662_1001779233 159
54 3300005549 Ga0070704_100367846 Ga0070704_1003678461 159
55 3300005577 Ga0068857_100025870 Ga0068857_1000258703 159
56 3300005719 Ga0068861_100003562 Ga0068861_1000035623 159
57 3300005840 Ga0068870_10013131 Ga0068870_100131314 159
58 3300005844 Ga0068862_100000615 Ga0068862_10000061519 159
59 3300006844 Ga0075428_100077788 Ga0075428_1000777882 159
60 3300009094 Ga0111539_10050328 Ga0111539_100503285 159
61 3300009148 Ga0105243_10093455 Ga0105243_100934552 159
62 3300009553 Ga0105249_10001343 Ga0105249_1000134312 159
63 3300011119 Ga0105246_10205190 Ga0105246_102051902 159
64 3300013306 Ga0163162_10513363 Ga0163162_105133632 159
65 3300013308 Ga0157375_10517079 Ga0157375_105170792 159
66 3300014326 Ga0157380_10123830 Ga0157380_101238303 159
67 3300025908 Ga0207643_10004073 Ga0207643_100040737 159
68 3300025923 Ga0207681_10016554 Ga0207681_100165545 159
69 3300025933 Ga0207706_10246043 Ga0207706_102460432 159
70 3300025935 Ga0207709_10106838 Ga0207709_101068382 159
71 3300025940 Ga0207691_10019226 Ga0207691_100192265 159
72 3300025961 Ga0207712_10000556 Ga0207712_1000055615 159
73 3300025972 Ga0207668_10013281 Ga0207668_100132814 159
74 3300026116 Ga0207674_10001289 Ga0207674_1000128920 159
75 3300026118 Ga0207675_100036407 Ga0207675_1000364074 159
76 3300028380 Ga0268265_10001840 Ga0268265_1000184010 159
77 3300050511 nmdc:mga08y16_58011_c1 nmdc:mga08y16_58011_c1_3482_3976 159
78 3300004799 Ga0058863_10160248 Ga0058863_101602482 161
79 3300004800 Ga0058861_10060554 Ga0058861_100605542 161
80 3300004800 Ga0058861_12005798 Ga0058861_120057982 161
81 3300004801 Ga0058860_11384070 Ga0058860_113840701 161
82 3300004803 Ga0058862_10019101 Ga0058862_100191012 161
83 3300005327 Ga0070658_10532394 Ga0070658_105323942 161
84 3300005329 Ga0070683_100451780 Ga0070683_1004517801 161
85 3300005336 Ga0070680_100044849 Ga0070680_1000448492 161
86 3300005336 Ga0070680_100093191 Ga0070680_1000931912 161
87 3300005337 Ga0070682_100173940 Ga0070682_1001739402 161
88 3300005339 Ga0070660_100119309 Ga0070660_1001193092 161
89 3300005353 Ga0070669_100373946 Ga0070669_1003739462 161
90 3300005435 Ga0070714_100005654 Ga0070714_1000056548 161
91 3300005435 Ga0070714_100854849 Ga0070714_1008548492 161
92 3300005458 Ga0070681_10013569 Ga0070681_100135692 161
93 3300005458 Ga0070681_11095034 Ga0070681_110950341 161
94 3300005518 Ga0070699_100308751 Ga0070699_1003087512 161
95 3300005530 Ga0070679_100084500 Ga0070679_1000845002 161
96 3300005530 Ga0070679_100679220 Ga0070679_1006792202 161
97 3300005535 Ga0070684_100207260 Ga0070684_1002072602 161
98 3300005539 Ga0068853_101193960 Ga0068853_1011939602 161
99 3300005563 Ga0068855_100161798 Ga0068855_1001617983 161
100 3300005563 Ga0068855_100169573 Ga0068855_1001695732 161
101 3300005564 Ga0070664_100077612 Ga0070664_1000776122 161
102 3300005577 Ga0068857_100650282 Ga0068857_1006502822 161
103 3300005578 Ga0068854_100030696 Ga0068854_1000306963 161
104 3300005614 Ga0068856_100123323 Ga0068856_1001233232 161
105 3300005616 Ga0068852_100099841 Ga0068852_1000998413 161
106 3300005617 Ga0068859_100854677 Ga0068859_1008546772 161
107 3300005719 Ga0068861_100262581 Ga0068861_1002625811 161
108 3300005844 Ga0068862_100086752 Ga0068862_1000867522 161
109 3300006028 Ga0070717_10262815 Ga0070717_102628152 161
110 3300006195 Ga0075366_10366758 Ga0075366_103667582 161
111 3300006844 Ga0075428_100022293 Ga0075428_1000222933 161
112 3300006852 Ga0075433_10147469 Ga0075433_101474692 161
113 3300006871 Ga0075434_100362520 Ga0075434_1003625202 161
114 3300006914 Ga0075436_100029167 Ga0075436_1000291673 161
115 3300006931 Ga0097620_100854763 Ga0097620_1008547631 161
116 3300009093 Ga0105240_10065804 Ga0105240_100658044 161
117 3300009093 Ga0105240_10699435 Ga0105240_106994352 161
118 3300009094 Ga0111539_10827655 Ga0111539_108276552 161
119 3300009147 Ga0114129_10458990 Ga0114129_104589902 161
120 3300009174 Ga0105241_10070795 Ga0105241_100707953 161
121 3300009545 Ga0105237_10307862 Ga0105237_103078622 161
122 3300009551 Ga0105238_10231130 Ga0105238_102311302 161
123 3300009553 Ga0105249_10188470 Ga0105249_101884701 161
124 3300009553 Ga0105249_11031242 Ga0105249_110312422 161
125 3300010375 Ga0105239_10722447 Ga0105239_107224472 161
126 3300013100 Ga0157373_10049317 Ga0157373_100493172 161
127 3300013100 Ga0157373_10105699 Ga0157373_101056992 161
128 3300013104 Ga0157370_10016201 Ga0157370_100162015 161
129 3300013104 Ga0157370_10196751 Ga0157370_101967512 161
130 3300013104 Ga0157370_10480988 Ga0157370_104809882 161
131 3300013104 Ga0157370_10610952 Ga0157370_106109522 161
132 3300013104 Ga0157370_10949370 Ga0157370_109493702 161
133 3300013105 Ga0157369_10080666 Ga0157369_100806662 161
134 3300013105 Ga0157369_10945693 Ga0157369_109456932 161
135 3300013297 Ga0157378_10101881 Ga0157378_101018813 161
136 3300013306 Ga0163162_10024346 Ga0163162_100243468 161
137 3300013307 Ga0157372_10017435 Ga0157372_100174353 161
138 3300013307 Ga0157372_10343204 Ga0157372_103432042 161
139 3300013308 Ga0157375_10355447 Ga0157375_103554471 161
140 3300014326 Ga0157380_10068112 Ga0157380_100681123 161
141 3300014326 Ga0157380_12168625 Ga0157380_121686251 161
142 3300020069 Ga0197907_10706547 Ga0197907_107065472 161
143 3300020070 Ga0206356_11847643 Ga0206356_118476432 161
144 3300020076 Ga0206355_1577345 Ga0206355_15773452 161
145 3300020078 Ga0206352_11166897 Ga0206352_111668972 161
146 3300020080 Ga0206350_10230214 Ga0206350_102302142 161
147 3300020081 Ga0206354_11317698 Ga0206354_113176983 161
148 3300020082 Ga0206353_11792761 Ga0206353_117927613 161
149 3300022467 Ga0224712_10154541 Ga0224712_101545412 161
150 3300022467 Ga0224712_10341565 Ga0224712_103415651 161
151 3300025912 Ga0207707_10003061 Ga0207707_100030614 161
152 3300025912 Ga0207707_10032019 Ga0207707_100320193 161
153 3300025912 Ga0207707_10637388 Ga0207707_106373882 161
154 3300025913 Ga0207695_10002651 Ga0207695_100026514 161
155 3300025913 Ga0207695_10032703 Ga0207695_100327034 161
156 3300025914 Ga0207671_10418040 Ga0207671_104180402 161
157 3300025917 Ga0207660_10230448 Ga0207660_102304482 161
158 3300025919 Ga0207657_10062691 Ga0207657_100626914 161
159 3300025920 Ga0207649_10124688 Ga0207649_101246882 161
160 3300025921 Ga0207652_10003734 Ga0207652_100037343 161
161 3300025921 Ga0207652_10113015 Ga0207652_101130153 161
162 3300025924 Ga0207694_10717788 Ga0207694_107177882 161
163 3300025929 Ga0207664_10016765 Ga0207664_100167654 161
164 3300025929 Ga0207664_10743126 Ga0207664_107431262 161
165 3300025944 Ga0207661_10314158 Ga0207661_103141582 161
166 3300025945 Ga0207679_10087897 Ga0207679_100878971 161
167 3300025949 Ga0207667_10353564 Ga0207667_103535642 161
168 3300025961 Ga0207712_10349153 Ga0207712_103491531 161
169 3300025961 Ga0207712_11021289 Ga0207712_110212891 161
170 3300026078 Ga0207702_10216141 Ga0207702_102161412 161
171 3300026116 Ga0207674_10335219 Ga0207674_103352192 161
172 3300026118 Ga0207675_100366281 Ga0207675_1003662811 161
173 3300027907 Ga0207428_10350777 Ga0207428_103507772 161
174 3300028380 Ga0268265_10365737 Ga0268265_103657371 161
175 3300031731 Ga0307405_10007099 Ga0307405_100070993 161
176 3300031824 Ga0307413_10295718 Ga0307413_102957182 161
177 3300031852 Ga0307410_10000129 Ga0307410_100001298 161
178 3300031901 Ga0307406_10002422 Ga0307406_100024224 161
179 3300031995 Ga0307409_100000079 Ga0307409_10000007915 161
180 3300032002 Ga0307416_100004690 Ga0307416_1000046902 161
181 3300032004 Ga0307414_10004632 Ga0307414_100046326 161
182 3300032126 Ga0307415_100061777 Ga0307415_1000617772 161
183 3300044842 Ga0466957_1043298 Ga0466957_1043298_43_543 161
184 3300048913 Ga0496110_1399891 Ga0496110_1399891_89_592 161
185 3300049160 Ga0501304_038154 Ga0501304_038154_18_509 161
186 3300050507 nmdc:mga05p37_554551_c1 nmdc:mga05p37_554551_c1_170_658 161
187 3300050511 nmdc:mga08y16_59257_c1 nmdc:mga08y16_59257_c1_2022_2510 161
188 3300050514 nmdc:mga08x19_19436_c1 nmdc:mga08x19_19436_c1_371_862 161
189 3300050514 nmdc:mga08x19_215250_c1 nmdc:mga08x19_215250_c1_530_1021 161
190 3300050515 nmdc:mga0a205_185077_c1 nmdc:mga0a205_185077_c1_1148_1636 161
191 3300059477 Ga0587084_013505 Ga0587084_013505_487_978 161
192 3300059490 Ga0587066_014044 Ga0587066_014044_149_640 161
193 3300059491 Ga0587070_047361 Ga0587070_047361_331_834 161
194 3300059491 Ga0587070_076424 Ga0587070_076424_72_563 161
195 3300059493 Ga0587077_019083 Ga0587077_019083_146_637 161
196 3300059503 Ga0587080_017725 Ga0587080_017725_520_1011 161
197 3300059504 Ga0587082_013629 Ga0587082_013629_677_1168 161
198 3300059505 Ga0587083_0008362 Ga0587083_0008362_198_689 161
199 3300059508 Ga0587088_010172 Ga0587088_010172_197_688 161
200 3300059509 Ga0587089_026175 Ga0587089_026175_131_622 161
201 3300059510 Ga0587090_014984 Ga0587090_014984_147_638 161
202 3300059511 Ga0587091_020249 Ga0587091_020249_518_1009 161
203 3300059512 Ga0587092_015765 Ga0587092_015765_492_983 161
204 3300059513 Ga0587094_010459 Ga0587094_010459_196_687 161
205 3300059605 Ga0587106_047487 Ga0587106_047487_89_580 161
206 3300059630 Ga0587128_086704 Ga0587128_086704_57_548 161
207 3300059644 Ga0587075_012539 Ga0587075_012539_531_1022 161
208 3300059645 Ga0587076_104102 Ga0587076_104102_61_552 161
209 3300059647 Ga0587079_000838 Ga0587079_000838_2415_2906 161
210 3300059652 Ga0587107_006324 Ga0587107_006324_201_692 161
211 3300060344 Ga0587071_015825 Ga0587071_015825_147_638 161
212 3300060346 Ga0587111_0017988 Ga0587111_0017988_687_1178 161
213 3300003323 rootH1_10223371 rootH1_102233712 162
214 3300004799 Ga0058863_10043916 Ga0058863_100439161 162
215 3300004799 Ga0058863_11250156 Ga0058863_112501561 162
216 3300004800 Ga0058861_10880106 Ga0058861_108801062 162
217 3300004800 Ga0058861_12030534 Ga0058861_120305341 162
218 3300004803 Ga0058862_12675497 Ga0058862_126754972 162
219 3300004803 Ga0058862_12811295 Ga0058862_128112951 162
220 3300005336 Ga0070680_100005343 Ga0070680_1000053436 162
221 3300005339 Ga0070660_100804223 Ga0070660_1008042231 162
222 3300005530 Ga0070679_100017382 Ga0070679_1000173822 162
223 3300005530 Ga0070679_100095790 Ga0070679_1000957903 162
224 3300005563 Ga0068855_100023427 Ga0068855_1000234276 162
225 3300005616 Ga0068852_100084681 Ga0068852_1000846812 162
226 3300006186 Ga0075369_10013690 Ga0075369_100136902 162
227 3300013104 Ga0157370_10002945 Ga0157370_1000294514 162
228 3300013105 Ga0157369_10037789 Ga0157369_100377892 162
229 3300013307 Ga0157372_10154293 Ga0157372_101542932 162
230 3300020069 Ga0197907_11348615 Ga0197907_113486155 162
231 3300020075 Ga0206349_1352915 Ga0206349_13529152 162
232 3300020076 Ga0206355_1576845 Ga0206355_15768452 162
233 3300020077 Ga0206351_10048966 Ga0206351_100489662 162
234 3300020078 Ga0206352_10174033 Ga0206352_101740332 162
235 3300020080 Ga0206350_10156355 Ga0206350_101563551 162
236 3300020081 Ga0206354_10852653 Ga0206354_108526531 162
237 3300020082 Ga0206353_10877890 Ga0206353_108778901 162
238 3300022467 Ga0224712_10057958 Ga0224712_100579582 162
239 3300025917 Ga0207660_10039206 Ga0207660_100392062 162
240 3300025919 Ga0207657_10535229 Ga0207657_105352292 162
241 3300025921 Ga0207652_10147492 Ga0207652_101474923 162
242 3300025949 Ga0207667_10022089 Ga0207667_100220896 162
243 3300026142 Ga0207698_10015930 Ga0207698_100159307 162
244 3300030521 Ga0307511_10000295 Ga0307511_1000029510 162
245 3300030521 Ga0307511_10000379 Ga0307511_1000037950 162
246 3300031251 Ga0265327_10133739 Ga0265327_101337392 162
247 3300037312 Ga0395899_0614480 Ga0395899_0614480_78_587 162
248 3300044694 Ga0466963_0242654 Ga0466963_0242654_46_555 162
249 3300045976 Ga0466967_0081391 Ga0466967_0081391_64_573 162
250 3300049527 Ga0501311_035920 Ga0501311_035920_24_521 162
251 3300050516 nmdc:mga0sz30_14723_c1 nmdc:mga0sz30_14723_c1_1490_1981 162
252 3300053090 Ga0500646_0002211 Ga0500646_0002211_1993_2484 162
253 3300053133 Ga0500655_015196 Ga0500655_015196_327_818 162
254 3300053139 Ga0500568_0038706 Ga0500568_0038706_422_913 162
255 3300053151 Ga0500604_0006628 Ga0500604_0006628_1163_1654 162
256 3300053153 Ga0500616_0031076 Ga0500616_0031076_2306_2797 162
257 3300059503 Ga0587080_031076 Ga0587080_031076_266_775 162
258 3300059504 Ga0587082_009145 Ga0587082_009145_157_666 162
259 3300059505 Ga0587083_0004065 Ga0587083_0004065_938_1432 162
260 3300059506 Ga0587085_005279 Ga0587085_005279_215_709 162
261 3300059605 Ga0587106_015741 Ga0587106_015741_396_905 162
262 3300059645 Ga0587076_021116 Ga0587076_021116_141_635 162
263 3300059646 Ga0587078_007923 Ga0587078_007923_431_940 162
264 3300059646 Ga0587078_044305 Ga0587078_044305_37_531 162
265 3300059646 Ga0587078_050147 Ga0587078_050147_58_558 162
266 3300060344 Ga0587071_001679 Ga0587071_001679_1176_1685 162
267 3300004799 Ga0058863_11768152 Ga0058863_117681522 163
268 3300004799 Ga0058863_11879184 Ga0058863_118791842 163
269 3300004800 Ga0058861_10055520 Ga0058861_100555201 163
270 3300004800 Ga0058861_11851212 Ga0058861_118512123 163
271 3300004803 Ga0058862_12462831 Ga0058862_124628312 163
272 3300004803 Ga0058862_12789120 Ga0058862_127891202 163
273 3300004803 Ga0058862_12863375 Ga0058862_128633751 163
274 3300005458 Ga0070681_11584414 Ga0070681_115844141 163
275 3300005530 Ga0070679_100136163 Ga0070679_1001361632 163
276 3300020070 Ga0206356_11816379 Ga0206356_118163792 163
277 3300021384 Ga0213876_10007122 Ga0213876_100071225 163
278 3300025921 Ga0207652_10211811 Ga0207652_102118112 163
279 3300031824 Ga0307413_11741431 Ga0307413_117414311 163
280 3300031995 Ga0307409_100518130 Ga0307409_1005181302 163
281 3300032002 Ga0307416_100842966 Ga0307416_1008429661 163
282 3300039437 Ga0436365_0152204 Ga0436365_0152204_17146_17640 163
283 3300039437 Ga0436365_0289034 Ga0436365_0289034_123_620 163
284 3300039450 Ga0436363_0488288 Ga0436363_0488288_155_655 163
285 3300059490 Ga0587066_008238 Ga0587066_008238_130_630 163
286 3300059490 Ga0587066_052377 Ga0587066_052377_16_516 163
287 3300059491 Ga0587070_011739 Ga0587070_011739_36_536 163
288 3300059491 Ga0587070_124662 Ga0587070_124662_92_607 163
289 3300059493 Ga0587077_049869 Ga0587077_049869_34_534 163
290 3300059493 Ga0587077_062594 Ga0587077_062594_51_551 163
291 3300059505 Ga0587083_0099509 Ga0587083_0099509_34_534 163
292 3300059506 Ga0587085_008289 Ga0587085_008289_556_1056 163
293 3300059506 Ga0587085_047530 Ga0587085_047530_119_619 163
294 3300059507 Ga0587086_030788 Ga0587086_030788_48_548 163
295 3300059511 Ga0587091_016977 Ga0587091_016977_549_1049 163
296 3300059512 Ga0587092_016062 Ga0587092_016062_56_556 163
297 3300059513 Ga0587094_034167 Ga0587094_034167_232_732 163
298 3300059605 Ga0587106_022988 Ga0587106_022988_231_731 163
299 3300059607 Ga0587125_011741 Ga0587125_011741_160_660 163
300 3300059623 Ga0587101_025031 Ga0587101_025031_35_535 163
301 3300059624 Ga0587109_013958 Ga0587109_013958_270_770 163
302 3300059624 Ga0587109_056521 Ga0587109_056521_189_689 163
303 3300059626 Ga0587115_024954 Ga0587115_024954_136_636 163
304 3300059627 Ga0587117_018263 Ga0587117_018263_244_744 163
305 3300059627 Ga0587117_025262 Ga0587117_025262_153_653 163
306 3300059639 Ga0587062_021049 Ga0587062_021049_405_905 163
307 3300059640 Ga0587067_183804 Ga0587067_183804_17_511 163
308 3300059641 Ga0587068_053639 Ga0587068_053639_40_540 163
309 3300059645 Ga0587076_058408 Ga0587076_058408_203_703 163
310 3300059649 Ga0587102_022410 Ga0587102_022410_34_534 163
311 3300060346 Ga0587111_0078762 Ga0587111_0078762_159_662 163
312 3300002070 JGI24750J21931_1017266 JGI24750J21931_10172662 164
313 3300002126 JGI24035J26624_1036463 JGI24035J26624_10364631 164
314 3300003163 Ga0006759J45824_1030530 Ga0006759J45824_10305301 164
315 3300004798 Ga0058859_10002689 Ga0058859_100026892 164
316 3300004799 Ga0058863_11600567 Ga0058863_116005671 164
317 3300004799 Ga0058863_11692573 Ga0058863_116925731 164
318 3300004800 Ga0058861_10021285 Ga0058861_100212852 164
319 3300004800 Ga0058861_11678193 Ga0058861_116781931 164
320 3300004801 Ga0058860_11827503 Ga0058860_118275031 164
321 3300004803 Ga0058862_12602324 Ga0058862_126023242 164
322 3300004803 Ga0058862_12826774 Ga0058862_128267742 164
323 3300005293 Ga0065715_10213561 Ga0065715_102135612 164
324 3300005295 Ga0065707_10411715 Ga0065707_104117152 164
325 3300005327 Ga0070658_10476286 Ga0070658_104762862 164
326 3300005327 Ga0070658_10823848 Ga0070658_108238481 164
327 3300005327 Ga0070658_11430995 Ga0070658_114309951 164
328 3300005328 Ga0070676_10006828 Ga0070676_100068283 164
329 3300005329 Ga0070683_100032368 Ga0070683_1000323682 164
330 3300005329 Ga0070683_100074274 Ga0070683_1000742742 164
331 3300005330 Ga0070690_100112985 Ga0070690_1001129852 164
332 3300005331 Ga0070670_100097790 Ga0070670_1000977903 164
333 3300005331 Ga0070670_100673358 Ga0070670_1006733582 164
334 3300005334 Ga0068869_100044414 Ga0068869_1000444142 164
335 3300005336 Ga0070680_100084812 Ga0070680_1000848123 164
336 3300005337 Ga0070682_100259043 Ga0070682_1002590432 164
337 3300005338 Ga0068868_100032896 Ga0068868_1000328964 164
338 3300005338 Ga0068868_100332572 Ga0068868_1003325722 164
339 3300005339 Ga0070660_100009773 Ga0070660_1000097735 164
340 3300005339 Ga0070660_100343778 Ga0070660_1003437782 164
341 3300005340 Ga0070689_100005824 Ga0070689_1000058243 164
342 3300005343 Ga0070687_100000855 Ga0070687_1000008557 164
343 3300005344 Ga0070661_100002293 Ga0070661_1000022933 164
344 3300005344 Ga0070661_100372414 Ga0070661_1003724142 164
345 3300005345 Ga0070692_10063304 Ga0070692_100633043 164
346 3300005345 Ga0070692_10294959 Ga0070692_102949591 164
347 3300005347 Ga0070668_100016538 Ga0070668_1000165383 164
348 3300005353 Ga0070669_100011724 Ga0070669_1000117245 164
349 3300005354 Ga0070675_100015280 Ga0070675_1000152803 164
350 3300005354 Ga0070675_100544511 Ga0070675_1005445111 164
351 3300005355 Ga0070671_100313880 Ga0070671_1003138802 164
352 3300005355 Ga0070671_100786648 Ga0070671_1007866482 164
353 3300005356 Ga0070674_100030942 Ga0070674_1000309423 164
354 3300005356 Ga0070674_100184007 Ga0070674_1001840072 164
355 3300005364 Ga0070673_100002971 Ga0070673_1000029712 164
356 3300005365 Ga0070688_100217115 Ga0070688_1002171152 164
357 3300005366 Ga0070659_100012262 Ga0070659_1000122623 164
358 3300005367 Ga0070667_100011965 Ga0070667_1000119655 164
359 3300005367 Ga0070667_101178817 Ga0070667_1011788171 164
360 3300005434 Ga0070709_10217762 Ga0070709_102177622 164
361 3300005438 Ga0070701_10013570 Ga0070701_100135703 164
362 3300005439 Ga0070711_100225703 Ga0070711_1002257033 164
363 3300005441 Ga0070700_100176697 Ga0070700_1001766972 164
364 3300005444 Ga0070694_100050722 Ga0070694_1000507223 164
365 3300005455 Ga0070663_100011509 Ga0070663_1000115094 164
366 3300005457 Ga0070662_100701124 Ga0070662_1007011241 164
367 3300005458 Ga0070681_10000138 Ga0070681_1000013835 164
368 3300005459 Ga0068867_100013811 Ga0068867_1000138113 164
369 3300005459 Ga0068867_100447335 Ga0068867_1004473351 164
370 3300005466 Ga0070685_10010771 Ga0070685_100107712 164
371 3300005530 Ga0070679_100048201 Ga0070679_1000482013 164
372 3300005535 Ga0070684_100023416 Ga0070684_1000234163 164
373 3300005535 Ga0070684_100071222 Ga0070684_1000712222 164
374 3300005539 Ga0068853_100012448 Ga0068853_1000124482 164
375 3300005543 Ga0070672_100011732 Ga0070672_1000117325 164
376 3300005543 Ga0070672_101070864 Ga0070672_1010708641 164
377 3300005545 Ga0070695_100124582 Ga0070695_1001245822 164
378 3300005547 Ga0070693_100268818 Ga0070693_1002688182 164
379 3300005548 Ga0070665_100069054 Ga0070665_1000690542 164
380 3300005549 Ga0070704_100328776 Ga0070704_1003287762 164
381 3300005563 Ga0068855_100450395 Ga0068855_1004503952 164
382 3300005564 Ga0070664_100018191 Ga0070664_1000181913 164
383 3300005564 Ga0070664_102045798 Ga0070664_1020457981 164
384 3300005577 Ga0068857_100006328 Ga0068857_1000063289 164
385 3300005577 Ga0068857_100047331 Ga0068857_1000473312 164
386 3300005578 Ga0068854_100005214 Ga0068854_1000052147 164
387 3300005615 Ga0070702_100061349 Ga0070702_1000613492 164
388 3300005616 Ga0068852_100009334 Ga0068852_1000093345 164
389 3300005616 Ga0068852_100224043 Ga0068852_1002240431 164
390 3300005616 Ga0068852_100502219 Ga0068852_1005022192 164
391 3300005617 Ga0068859_100016780 Ga0068859_1000167802 164
392 3300005618 Ga0068864_100047063 Ga0068864_1000470633 164
393 3300005618 Ga0068864_100479288 Ga0068864_1004792881 164
394 3300005718 Ga0068866_10147712 Ga0068866_101477122 164
395 3300005719 Ga0068861_100022754 Ga0068861_1000227543 164
396 3300005834 Ga0068851_10051220 Ga0068851_100512202 164
397 3300005834 Ga0068851_10246283 Ga0068851_102462832 164
398 3300005841 Ga0068863_100007854 Ga0068863_1000078547 164
399 3300005842 Ga0068858_100030490 Ga0068858_1000304903 164
400 3300005843 Ga0068860_100064974 Ga0068860_1000649742 164
401 3300005844 Ga0068862_100063715 Ga0068862_1000637153 164
402 3300006175 Ga0070712_100020282 Ga0070712_1000202823 164
403 3300006237 Ga0097621_100673004 Ga0097621_1006730042 164
404 3300006358 Ga0068871_100577132 Ga0068871_1005771321 164
405 3300006846 Ga0075430_100002899 Ga0075430_1000028998 164
406 3300006852 Ga0075433_10257013 Ga0075433_102570131 164
407 3300006871 Ga0075434_100009939 Ga0075434_1000099392 164
408 3300006881 Ga0068865_100003660 Ga0068865_1000036603 164
409 3300006931 Ga0097620_100016780 Ga0097620_1000167802 164
410 3300007076 Ga0075435_100305827 Ga0075435_1003058272 164
411 3300009093 Ga0105240_10969627 Ga0105240_109696272 164
412 3300009098 Ga0105245_10143363 Ga0105245_101433633 164
413 3300009101 Ga0105247_10358408 Ga0105247_103584082 164
414 3300009147 Ga0114129_10162678 Ga0114129_101626783 164
415 3300009176 Ga0105242_10013791 Ga0105242_100137914 164
416 3300009176 Ga0105242_10470888 Ga0105242_104708882 164
417 3300009177 Ga0105248_10240729 Ga0105248_102407292 164
418 3300009177 Ga0105248_12138956 Ga0105248_121389561 164
419 3300009545 Ga0105237_10476559 Ga0105237_104765592 164
420 3300009553 Ga0105249_10007447 Ga0105249_100074472 164
421 3300010375 Ga0105239_10051269 Ga0105239_100512693 164
422 3300013100 Ga0157373_10521256 Ga0157373_105212562 164
423 3300013100 Ga0157373_10715023 Ga0157373_107150231 164
424 3300013102 Ga0157371_10017291 Ga0157371_100172912 164
425 3300013105 Ga0157369_10244768 Ga0157369_102447682 164
426 3300013296 Ga0157374_10182715 Ga0157374_101827152 164
427 3300013297 Ga0157378_10041350 Ga0157378_100413502 164
428 3300013306 Ga0163162_10018823 Ga0163162_100188233 164
429 3300013307 Ga0157372_10178593 Ga0157372_101785933 164
430 3300013308 Ga0157375_10010504 Ga0157375_100105046 164
431 3300014325 Ga0163163_10267348 Ga0163163_102673482 164
432 3300014326 Ga0157380_10150703 Ga0157380_101507032 164
433 3300014745 Ga0157377_10063072 Ga0157377_100630722 164
434 3300014968 Ga0157379_10003198 Ga0157379_100031983 164
435 3300017792 Ga0163161_10186493 Ga0163161_101864932 164
436 3300021384 Ga0213876_10021352 Ga0213876_100213522 164
437 3300025315 Ga0207697_10005846 Ga0207697_100058464 164
438 3300025321 Ga0207656_10011296 Ga0207656_100112963 164
439 3300025899 Ga0207642_10043919 Ga0207642_100439192 164
440 3300025900 Ga0207710_10482636 Ga0207710_104826361 164
441 3300025901 Ga0207688_10035092 Ga0207688_100350922 164
442 3300025904 Ga0207647_10048946 Ga0207647_100489463 164
443 3300025906 Ga0207699_10498285 Ga0207699_104982851 164
444 3300025907 Ga0207645_10000786 Ga0207645_1000078617 164
445 3300025909 Ga0207705_10354427 Ga0207705_103544272 164
446 3300025911 Ga0207654_10461931 Ga0207654_104619312 164
447 3300025912 Ga0207707_10039094 Ga0207707_100390944 164
448 3300025913 Ga0207695_10846718 Ga0207695_108467182 164
449 3300025916 Ga0207663_10150106 Ga0207663_101501062 164
450 3300025917 Ga0207660_10279080 Ga0207660_102790802 164
451 3300025918 Ga0207662_10001813 Ga0207662_100018137 164
452 3300025919 Ga0207657_10049205 Ga0207657_100492053 164
453 3300025919 Ga0207657_10747855 Ga0207657_107478552 164
454 3300025920 Ga0207649_10008483 Ga0207649_100084833 164
455 3300025920 Ga0207649_10014851 Ga0207649_100148514 164
456 3300025921 Ga0207652_10067380 Ga0207652_100673803 164
457 3300025923 Ga0207681_10013302 Ga0207681_100133025 164
458 3300025925 Ga0207650_10015220 Ga0207650_100152202 164
459 3300025926 Ga0207659_10046573 Ga0207659_100465732 164
460 3300025927 Ga0207687_11009218 Ga0207687_110092182 164
461 3300025931 Ga0207644_10536114 Ga0207644_105361142 164
462 3300025932 Ga0207690_10027238 Ga0207690_100272381 164
463 3300025932 Ga0207690_10114423 Ga0207690_101144232 164
464 3300025933 Ga0207706_10000699 Ga0207706_100006998 164
465 3300025934 Ga0207686_10069220 Ga0207686_100692203 164
466 3300025936 Ga0207670_10089422 Ga0207670_100894223 164
467 3300025937 Ga0207669_10118050 Ga0207669_101180503 164
468 3300025937 Ga0207669_11037025 Ga0207669_110370252 164
469 3300025938 Ga0207704_10074271 Ga0207704_100742712 164
470 3300025940 Ga0207691_10000620 Ga0207691_1000062025 164
471 3300025940 Ga0207691_10834149 Ga0207691_108341491 164
472 3300025941 Ga0207711_10067035 Ga0207711_100670353 164
473 3300025942 Ga0207689_10004256 Ga0207689_100042563 164
474 3300025944 Ga0207661_10039298 Ga0207661_100392982 164
475 3300025944 Ga0207661_10072452 Ga0207661_100724522 164
476 3300025945 Ga0207679_10005170 Ga0207679_100051701 164
477 3300025945 Ga0207679_10007499 Ga0207679_100074993 164
478 3300025949 Ga0207667_10643536 Ga0207667_106435362 164
479 3300025960 Ga0207651_10022256 Ga0207651_100222563 164
480 3300025961 Ga0207712_10013819 Ga0207712_100138195 164
481 3300025972 Ga0207668_10023108 Ga0207668_100231083 164
482 3300025981 Ga0207640_10055318 Ga0207640_100553182 164
483 3300025986 Ga0207658_10036477 Ga0207658_100364773 164
484 3300026023 Ga0207677_10025641 Ga0207677_100256412 164
485 3300026035 Ga0207703_10060471 Ga0207703_100604712 164
486 3300026041 Ga0207639_10088322 Ga0207639_100883222 164
487 3300026041 Ga0207639_10765249 Ga0207639_107652491 164
488 3300026067 Ga0207678_10019269 Ga0207678_100192693 164
489 3300026075 Ga0207708_10010733 Ga0207708_100107336 164
490 3300026088 Ga0207641_10010432 Ga0207641_100104323 164
491 3300026089 Ga0207648_10041362 Ga0207648_100413623 164
492 3300026089 Ga0207648_10153056 Ga0207648_101530563 164
493 3300026089 Ga0207648_10481573 Ga0207648_104815732 164
494 3300026116 Ga0207674_10000562 Ga0207674_1000056216 164
495 3300026118 Ga0207675_100000109 Ga0207675_10000010923 164
496 3300026142 Ga0207698_10114329 Ga0207698_101143292 164
497 3300026142 Ga0207698_10526437 Ga0207698_105264372 164
498 3300028379 Ga0268266_10454885 Ga0268266_104548851 164
499 3300028379 Ga0268266_10889769 Ga0268266_108897692 164
500 3300028380 Ga0268265_10028860 Ga0268265_100288602 164
501 3300028381 Ga0268264_10048178 Ga0268264_100481783 164
502 3300028800 Ga0265338_10009700 Ga0265338_100097006 164
503 3300031548 Ga0307408_100019238 Ga0307408_1000192384 164
504 3300031731 Ga0307405_10076143 Ga0307405_100761432 164
505 3300031814 Ga0247548_100357 Ga0247548_1003571 164
506 3300031824 Ga0307413_10007449 Ga0307413_100074493 164
507 3300031824 Ga0307413_10071926 Ga0307413_100719262 164
508 3300031852 Ga0307410_10091101 Ga0307410_100911013 164
509 3300031901 Ga0307406_10000417 Ga0307406_1000041710 164
510 3300031995 Ga0307409_100186168 Ga0307409_1001861683 164
511 3300032002 Ga0307416_100157367 Ga0307416_1001573672 164
512 3300032004 Ga0307414_10186463 Ga0307414_101864632 164
513 3300032126 Ga0307415_100071208 Ga0307415_1000712083 164
514 3300037471 Ga0395905_0440733 Ga0395905_0440733_677_1171 164
515 3300037853 Ga0436364_0188943 Ga0436364_0188943_538_1062 164
516 3300037853 Ga0436364_1280777 Ga0436364_1280777_271_768 164
517 3300039437 Ga0436365_0924513 Ga0436365_0924513_1645_2142 164
518 3300039437 Ga0436365_1852273 Ga0436365_1852273_381_905 164
519 3300044842 Ga0466957_0231401 Ga0466957_0231401_573_1091 164
520 3300045051 Ga0451576_0039203 Ga0451576_0039203_2244_2738 164
521 3300045976 Ga0466967_0276881 Ga0466967_0276881_502_1020 164
522 3300046459 Ga0495629_0088645 Ga0495629_0088645_826_1320 164
523 3300046473 Ga0495582_0125473 Ga0495582_0125473_592_1086 164
524 3300046475 Ga0495639_0473394 Ga0495639_0473394_27_521 164
525 3300046539 Ga0495621_0308776 Ga0495621_0308776_62_556 164
526 3300046683 Ga0495658_0048593 Ga0495658_0048593_1189_1683 164
527 3300046691 Ga0495670_0245840 Ga0495670_0245840_77_571 164
528 3300048909 Ga0496106_0382309 Ga0496106_0382309_75_569 164
529 3300048912 Ga0496109_0072961 Ga0496109_0072961_2470_2964 164
530 3300048916 Ga0496113_0833965 Ga0496113_0833965_217_711 164
531 3300049127 Ga0501306_033230 Ga0501306_033230_253_747 164
532 3300049128 Ga0501308_026253 Ga0501308_026253_237_731 164
533 3300049129 Ga0501309_024531 Ga0501309_024531_36_530 164
534 3300049160 Ga0501304_021701 Ga0501304_021701_16_510 164
535 3300049161 Ga0501305_050458 Ga0501305_050458_16_510 164
536 3300049161 Ga0501305_107806 Ga0501305_107806_16_510 164
537 3300049161 Ga0501305_107892 Ga0501305_107892_16_510 164
538 3300049162 Ga0501307_038029 Ga0501307_038029_179_673 164
539 3300049162 Ga0501307_068643 Ga0501307_068643_34_528 164
540 3300049528 Ga0501312_051317 Ga0501312_051317_15_509 164
541 3300049530 Ga0501314_023775 Ga0501314_023775_134_628 164
542 3300049533 Ga0501317_024418 Ga0501317_024418_147_641 164
543 3300049534 Ga0501318_029747 Ga0501318_029747_230_724 164
544 3300049536 Ga0501320_017243 Ga0501320_017243_267_761 164
545 3300049537 Ga0501321_039265 Ga0501321_039265_152_646 164
546 3300049537 Ga0501321_062981 Ga0501321_062981_13_507 164
547 3300049538 Ga0501322_007465 Ga0501322_007465_286_780 164
548 3300049539 Ga0501323_018212 Ga0501323_018212_160_654 164
549 3300049539 Ga0501323_073047 Ga0501323_073047_40_534 164
550 3300049540 Ga0501324_023484 Ga0501324_023484_121_615 164
551 3300049549 Ga0501333_011320 Ga0501333_011320_22_516 164
552 3300049665 Ga0501227_174642 Ga0501227_174642_16_513 164
553 3300049674 Ga0501242_039431 Ga0501242_039431_17_514 164
554 3300049690 Ga0501261_037334 Ga0501261_037334_59_556 164
555 3300049705 Ga0501225_0167629 Ga0501225_0167629_44_541 164
556 3300049779 Ga0501283_081996 Ga0501283_081996_54_551 164
557 3300050507 nmdc:mga05p37_252491_c1 nmdc:mga05p37_252491_c1_593_1090 164
558 3300050507 nmdc:mga05p37_277217_c1 nmdc:mga05p37_277217_c1_988_1482 164
559 3300050508 nmdc:mga09592_64978_c1 nmdc:mga09592_64978_c1_1940_2437 164
560 3300050509 nmdc:mga0qj67_35220_c1 nmdc:mga0qj67_35220_c1_2516_3013 164
561 3300050509 nmdc:mga0qj67_4675_c1 nmdc:mga0qj67_4675_c1_1992_2489 164
562 3300050512 nmdc:mga0n895_408074_c1 nmdc:mga0n895_408074_c1_475_969 164
563 3300050513 nmdc:mga0rr50_132519_c1 nmdc:mga0rr50_132519_c1_691_1185 164
564 3300050515 nmdc:mga0a205_1059936_c1 nmdc:mga0a205_1059936_c1_61_555 164
565 3300059505 Ga0587083_0028972 Ga0587083_0028972_437_949 164
566 3300060344 Ga0587071_062560 Ga0587071_062560_149_670 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05638

T6SS_HCP

Type VI secretion system effector, Hcp

6

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eaa-assembly1.cif.gz_A structure of a type six secretion system protein 0.9414 2 164
3eaa-assembly1.cif.gz_A structure of a type six secretion system protein 0.9358 2 164
4tv4-assembly1.cif.gz_B-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9336 2 164
4tv4-assembly1.cif.gz_B-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9273 2 164
4tv4-assembly1.cif.gz_A-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9266 2 164
ID Description Score Start End Superfamily
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9403 2 164 2.30.110.20
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9346 2 164 2.30.110.20
5xeuF00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9146 4 160 2.30.110.20
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8946 2 164 2.30.110.20
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8889 2 164 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A034T0E6-F1-model_v4 deleted 0.9563 1 164
AF-A0A2U0A666-F1-model_v4 Type VI secretion system tube protein Hcp 0.9529 1 164
AF-A0A0U2T6X9-F1-model_v4 PEP-CTERM protein-sorting domain-containing protein 0.9521 2 164
AF-A0A5C4RLA0-F1-model_v4 Type VI secretion system tube protein Hcp 0.9513 1 164
AF-A0A1W1XFU6-F1-model_v4 Type VI secretion system secreted protein Hcp 0.9511 1 159

Feature Viewer

pLDDT pTM Quality
91.47 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map