F464423
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 300 | 565 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0188943|Ga0436364_0188943_538_1062 |
| Length | 174 |
| Sequence | MAFDTYLLIDNAQLVKGESTATGLTPTTGWIEIFSFSWGASNPTTVGTTAAGLSAGKVSISSFNIMKKTENSSPTLFQACAQGQHFKSAKVVMRKAAGSSGKQQSFLEYDFTDLMVESIQWSGSSGGDDTPTESVSFAFAAVTVNYWPQDTATGGQGTLNTASWDLTKAAVVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 120 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 211 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 234 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 252 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 264 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 265 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 267 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 268 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.97 |
| Metatranscriptomes | 23.85 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.41 |
| Nodule | 0 |
| Rhizoplane | 0.71 |
| Rhizosphere | 94.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1017266 | 3300002070 | Bacteria | 985 |
| 2 | JGI24035J26624_1036463 | 3300002126 | Unclassified | 544 |
| 3 | Ga0006759J45824_1030530 | 3300003163 | Bacteria | 759 |
| 4 | rootH1_10223371 | 3300003323 | Bacteria | 1993 |
| 5 | Ga0058859_10002689 | 3300004798 | Bacteria | 1299 |
| 6 | Ga0058863_10043916 | 3300004799 | Unclassified | 757 |
| 7 | Ga0058863_10160248 | 3300004799 | Unclassified | 677 |
| 8 | Ga0058863_11250156 | 3300004799 | Unclassified | 541 |
| 9 | Ga0058863_11600567 | 3300004799 | Bacteria | 664 |
| 10 | Ga0058863_11692573 | 3300004799 | Unclassified | 1023 |
| 11 | Ga0058863_11768152 | 3300004799 | Bacteria | 1396 |
| 12 | Ga0058863_11879184 | 3300004799 | Bacteria | 1312 |
| 13 | Ga0058861_10021285 | 3300004800 | Unclassified | 876 |
| 14 | Ga0058861_10055520 | 3300004800 | Unclassified | 789 |
| 15 | Ga0058861_10060554 | 3300004800 | Bacteria | 1135 |
| 16 | Ga0058861_10880106 | 3300004800 | Bacteria | 916 |
| 17 | Ga0058861_11678193 | 3300004800 | Bacteria | 685 |
| 18 | Ga0058861_11851212 | 3300004800 | Bacteria | 2794 |
| 19 | Ga0058861_12005798 | 3300004800 | Bacteria | 866 |
| 20 | Ga0058861_12030534 | 3300004800 | Unclassified | 648 |
| 21 | Ga0058860_11384070 | 3300004801 | Bacteria | 772 |
| 22 | Ga0058860_11827503 | 3300004801 | Bacteria | 957 |
| 23 | Ga0058860_11935308 | 3300004801 | Bacteria | 920 |
| 24 | Ga0058862_10019101 | 3300004803 | Bacteria | 902 |
| 25 | Ga0058862_12462831 | 3300004803 | Bacteria | 898 |
| 26 | Ga0058862_12602324 | 3300004803 | Unclassified | 775 |
| 27 | Ga0058862_12675497 | 3300004803 | Bacteria | 3137 |
| 28 | Ga0058862_12789120 | 3300004803 | Bacteria | 3606 |
| 29 | Ga0058862_12811295 | 3300004803 | Unclassified | 764 |
| 30 | Ga0058862_12826774 | 3300004803 | Bacteria | 1598 |
| 31 | Ga0058862_12863375 | 3300004803 | Bacteria | 1724 |
| 32 | Ga0065715_10213561 | 3300005293 | Bacteria | 1303 |
| 33 | Ga0065707_10408345 | 3300005295 | Bacteria | 844 |
| 34 | Ga0065707_10411715 | 3300005295 | Bacteria | 841 |
| 35 | Ga0070658_10476286 | 3300005327 | Unclassified | 1077 |
| 36 | Ga0070658_10532394 | 3300005327 | Unclassified | 1016 |
| 37 | Ga0070658_10823848 | 3300005327 | Viruses | 806 |
| 38 | Ga0070658_11430995 | 3300005327 | Bacteria | 600 |
| 39 | Ga0070676_10006828 | 3300005328 | Bacteria | 6115 |
| 40 | Ga0070683_100032368 | 3300005329 | Bacteria | 4762 |
| 41 | Ga0070683_100074274 | 3300005329 | Bacteria | 3175 |
| 42 | Ga0070683_100451780 | 3300005329 | Unclassified | 1226 |
| 43 | Ga0070690_100112985 | 3300005330 | Bacteria | 1815 |
| 44 | Ga0070670_100097790 | 3300005331 | Bacteria | 2525 |
| 45 | Ga0070670_100673358 | 3300005331 | Bacteria | 929 |
| 46 | Ga0068869_100044414 | 3300005334 | Bacteria | 3195 |
| 47 | Ga0070680_100005343 | 3300005336 | Bacteria | 9716 |
| 48 | Ga0070680_100044849 | 3300005336 | Bacteria | 3593 |
| 49 | Ga0070680_100084812 | 3300005336 | Bacteria | 2617 |
| 50 | Ga0070680_100093191 | 3300005336 | Bacteria | 2495 |
| 51 | Ga0070682_100173940 | 3300005337 | Bacteria | 1498 |
| 52 | Ga0070682_100259043 | 3300005337 | Bacteria | 1258 |
| 53 | Ga0068868_100032896 | 3300005338 | Bacteria | 3992 |
| 54 | Ga0068868_100332572 | 3300005338 | Bacteria | 1297 |
| 55 | Ga0070660_100009773 | 3300005339 | Bacteria | 6759 |
| 56 | Ga0070660_100119309 | 3300005339 | Bacteria | 2104 |
| 57 | Ga0070660_100343778 | 3300005339 | Bacteria | 1228 |
| 58 | Ga0070660_100804223 | 3300005339 | Unclassified | 791 |
| 59 | Ga0070689_100005824 | 3300005340 | Bacteria | 8459 |
| 60 | Ga0070687_100000855 | 3300005343 | Bacteria | 10203 |
| 61 | Ga0070661_100002293 | 3300005344 | Bacteria | 13137 |
| 62 | Ga0070661_100372414 | 3300005344 | Unclassified | 1124 |
| 63 | Ga0070692_10063304 | 3300005345 | Unclassified | 1954 |
| 64 | Ga0070692_10294959 | 3300005345 | Unclassified | 988 |
| 65 | Ga0070668_100016538 | 3300005347 | Bacteria | 5514 |
| 66 | Ga0070668_100050950 | 3300005347 | Bacteria | 3189 |
| 67 | Ga0070669_100011724 | 3300005353 | Bacteria | 6217 |
| 68 | Ga0070669_100022607 | 3300005353 | Bacteria | 4496 |
| 69 | Ga0070669_100373946 | 3300005353 | Bacteria | 1161 |
| 70 | Ga0070675_100015280 | 3300005354 | Bacteria | 6065 |
| 71 | Ga0070675_100544511 | 3300005354 | Bacteria | 1049 |
| 72 | Ga0070671_100313880 | 3300005355 | Unclassified | 1335 |
| 73 | Ga0070671_100786648 | 3300005355 | Bacteria | 828 |
| 74 | Ga0070674_100030942 | 3300005356 | Bacteria | 3541 |
| 75 | Ga0070674_100184007 | 3300005356 | Bacteria | 1602 |
| 76 | Ga0070673_100002971 | 3300005364 | Bacteria | 10462 |
| 77 | Ga0070688_100217115 | 3300005365 | Bacteria | 1346 |
| 78 | Ga0070659_100012262 | 3300005366 | Bacteria | 6355 |
| 79 | Ga0070667_100011965 | 3300005367 | Bacteria | 7179 |
| 80 | Ga0070667_101178817 | 3300005367 | Unclassified | 717 |
| 81 | Ga0070709_10217762 | 3300005434 | Bacteria | 1360 |
| 82 | Ga0070714_100005654 | 3300005435 | Bacteria | 9564 |
| 83 | Ga0070714_100854849 | 3300005435 | Unclassified | 882 |
| 84 | Ga0070701_10013570 | 3300005438 | Bacteria | 3711 |
| 85 | Ga0070711_100225703 | 3300005439 | Bacteria | 1458 |
| 86 | Ga0070700_100176697 | 3300005441 | Bacteria | 1483 |
| 87 | Ga0070694_100050722 | 3300005444 | Bacteria | 2798 |
| 88 | Ga0070663_100011509 | 3300005455 | Bacteria | 5558 |
| 89 | Ga0070662_100177923 | 3300005457 | Bacteria | 1675 |
| 90 | Ga0070662_100701124 | 3300005457 | Bacteria | 856 |
| 91 | Ga0070681_10000138 | 3300005458 | Bacteria | 55327 |
| 92 | Ga0070681_10013569 | 3300005458 | Bacteria | 8104 |
| 93 | Ga0070681_11095034 | 3300005458 | Unclassified | 717 |
| 94 | Ga0070681_11584414 | 3300005458 | Bacteria | 580 |
| 95 | Ga0068867_100013811 | 3300005459 | Bacteria | 5717 |
| 96 | Ga0068867_100447335 | 3300005459 | Bacteria | 1100 |
| 97 | Ga0070685_10010771 | 3300005466 | Bacteria | 4762 |
| 98 | Ga0070699_100308751 | 3300005518 | Bacteria | 1420 |
| 99 | Ga0070679_100017382 | 3300005530 | Bacteria | 6960 |
| 100 | Ga0070679_100048201 | 3300005530 | Bacteria | 4246 |
| 101 | Ga0070679_100084500 | 3300005530 | Bacteria | 3162 |
| 102 | Ga0070679_100095790 | 3300005530 | Bacteria | 2956 |
| 103 | Ga0070679_100136163 | 3300005530 | Bacteria | 2437 |
| 104 | Ga0070679_100679220 | 3300005530 | Bacteria | 972 |
| 105 | Ga0070684_100023416 | 3300005535 | Bacteria | 5165 |
| 106 | Ga0070684_100071222 | 3300005535 | Bacteria | 3060 |
| 107 | Ga0070684_100207260 | 3300005535 | Bacteria | 1787 |
| 108 | Ga0068853_100012448 | 3300005539 | Bacteria | 6921 |
| 109 | Ga0068853_101193960 | 3300005539 | Unclassified | 734 |
| 110 | Ga0070672_100011732 | 3300005543 | Bacteria | 6121 |
| 111 | Ga0070672_101070864 | 3300005543 | Bacteria | 716 |
| 112 | Ga0070695_100124582 | 3300005545 | Bacteria | 1768 |
| 113 | Ga0070693_100268818 | 3300005547 | Unclassified | 1137 |
| 114 | Ga0070665_100069054 | 3300005548 | Bacteria | 3542 |
| 115 | Ga0070704_100328776 | 3300005549 | Bacteria | 1283 |
| 116 | Ga0070704_100367846 | 3300005549 | Bacteria | 1218 |
| 117 | Ga0068855_100009784 | 3300005563 | Bacteria | 11565 |
| 118 | Ga0068855_100023427 | 3300005563 | Bacteria | 7395 |
| 119 | Ga0068855_100161798 | 3300005563 | Bacteria | 2540 |
| 120 | Ga0068855_100169573 | 3300005563 | Bacteria | 2472 |
| 121 | Ga0068855_100433172 | 3300005563 | Bacteria | 1437 |
| 122 | Ga0068855_100450395 | 3300005563 | Bacteria | 1405 |
| 123 | Ga0070664_100018191 | 3300005564 | Bacteria | 5768 |
| 124 | Ga0070664_100077612 | 3300005564 | Bacteria | 2856 |
| 125 | Ga0070664_102045798 | 3300005564 | Unclassified | 543 |
| 126 | Ga0068857_100006328 | 3300005577 | Bacteria | 10139 |
| 127 | Ga0068857_100025870 | 3300005577 | Bacteria | 5168 |
| 128 | Ga0068857_100047331 | 3300005577 | Bacteria | 3818 |
| 129 | Ga0068857_100650282 | 3300005577 | Unclassified | 999 |
| 130 | Ga0068854_100005214 | 3300005578 | Bacteria | 8196 |
| 131 | Ga0068854_100030696 | 3300005578 | Bacteria | 3729 |
| 132 | Ga0068856_100123323 | 3300005614 | Bacteria | 2593 |
| 133 | Ga0070702_100061349 | 3300005615 | Bacteria | 2189 |
| 134 | Ga0068852_100009334 | 3300005616 | Bacteria | 7281 |
| 135 | Ga0068852_100084681 | 3300005616 | Bacteria | 2822 |
| 136 | Ga0068852_100099841 | 3300005616 | Bacteria | 2617 |
| 137 | Ga0068852_100224043 | 3300005616 | Bacteria | 1790 |
| 138 | Ga0068852_100502219 | 3300005616 | Bacteria | 1208 |
| 139 | Ga0068859_100016780 | 3300005617 | Bacteria | 7353 |
| 140 | Ga0068859_100854677 | 3300005617 | Bacteria | 996 |
| 141 | Ga0068864_100047063 | 3300005618 | Bacteria | 3703 |
| 142 | Ga0068864_100479288 | 3300005618 | Bacteria | 1194 |
| 143 | Ga0068866_10147712 | 3300005718 | Bacteria | 1357 |
| 144 | Ga0068861_100003562 | 3300005719 | Bacteria | 10356 |
| 145 | Ga0068861_100022754 | 3300005719 | Bacteria | 4519 |
| 146 | Ga0068861_100262581 | 3300005719 | Bacteria | 1479 |
| 147 | Ga0068851_10051220 | 3300005834 | Bacteria | 2098 |
| 148 | Ga0068851_10246283 | 3300005834 | Bacteria | 1012 |
| 149 | Ga0068870_10013131 | 3300005840 | Bacteria | 3885 |
| 150 | Ga0068863_100007854 | 3300005841 | Bacteria | 10432 |
| 151 | Ga0068858_100030490 | 3300005842 | Bacteria | 5007 |
| 152 | Ga0068860_100064974 | 3300005843 | Bacteria | 3465 |
| 153 | Ga0068862_100000615 | 3300005844 | Bacteria | 37063 |
| 154 | Ga0068862_100063715 | 3300005844 | Bacteria | 3172 |
| 155 | Ga0068862_100086752 | 3300005844 | Bacteria | 2722 |
| 156 | Ga0070717_10262815 | 3300006028 | Bacteria | 1527 |
| 157 | Ga0070712_100020282 | 3300006175 | Bacteria | 4348 |
| 158 | Ga0075369_10013690 | 3300006186 | Bacteria | 3227 |
| 159 | Ga0075366_10366758 | 3300006195 | Bacteria | 885 |
| 160 | Ga0097621_100673004 | 3300006237 | Bacteria | 951 |
| 161 | Ga0068871_100577132 | 3300006358 | Bacteria | 1021 |
| 162 | Ga0075428_100022293 | 3300006844 | Bacteria | 7012 |
| 163 | Ga0075428_100077788 | 3300006844 | Bacteria | 3621 |
| 164 | Ga0075430_100002899 | 3300006846 | Bacteria | 14354 |
| 165 | Ga0075430_100140167 | 3300006846 | Unclassified | 2014 |
| 166 | Ga0075431_100204134 | 3300006847 | Bacteria | 2021 |
| 167 | Ga0075433_10147469 | 3300006852 | Bacteria | 2092 |
| 168 | Ga0075433_10257013 | 3300006852 | Bacteria | 1549 |
| 169 | Ga0075434_100009939 | 3300006871 | Bacteria | 8902 |
| 170 | Ga0075434_100362520 | 3300006871 | Bacteria | 1470 |
| 171 | Ga0068865_100003660 | 3300006881 | Bacteria | 9232 |
| 172 | Ga0075436_100029167 | 3300006914 | Bacteria | 3794 |
| 173 | Ga0097620_100016780 | 3300006931 | Bacteria | 7353 |
| 174 | Ga0097620_100854763 | 3300006931 | Bacteria | 996 |
| 175 | Ga0075435_100305827 | 3300007076 | Bacteria | 1360 |
| 176 | Ga0105240_10065804 | 3300009093 | Bacteria | 4498 |
| 177 | Ga0105240_10699435 | 3300009093 | Bacteria | 1107 |
| 178 | Ga0105240_10969627 | 3300009093 | Bacteria | 911 |
| 179 | Ga0111539_10050328 | 3300009094 | Bacteria | 4963 |
| 180 | Ga0111539_10827655 | 3300009094 | Bacteria | 1077 |
| 181 | Ga0105245_10143363 | 3300009098 | Bacteria | 2252 |
| 182 | Ga0105247_10358408 | 3300009101 | Bacteria | 1028 |
| 183 | Ga0114129_10084955 | 3300009147 | Bacteria | 4392 |
| 184 | Ga0114129_10162678 | 3300009147 | Bacteria | 3047 |
| 185 | Ga0114129_10458990 | 3300009147 | Bacteria | 1670 |
| 186 | Ga0105243_10093455 | 3300009148 | Bacteria | 2482 |
| 187 | Ga0105241_10070795 | 3300009174 | Bacteria | 2707 |
| 188 | Ga0105242_10013791 | 3300009176 | Bacteria | 6255 |
| 189 | Ga0105242_10470888 | 3300009176 | Unclassified | 1188 |
| 190 | Ga0105248_10240729 | 3300009177 | Bacteria | 2037 |
| 191 | Ga0105248_12138956 | 3300009177 | Bacteria | 636 |
| 192 | Ga0105237_10307862 | 3300009545 | Bacteria | 1587 |
| 193 | Ga0105237_10476559 | 3300009545 | Bacteria | 1254 |
| 194 | Ga0105238_10231130 | 3300009551 | Bacteria | 1826 |
| 195 | Ga0105249_10001343 | 3300009553 | Bacteria | 21505 |
| 196 | Ga0105249_10007447 | 3300009553 | Bacteria | 9549 |
| 197 | Ga0105249_10188470 | 3300009553 | Bacteria | 2011 |
| 198 | Ga0105249_11031242 | 3300009553 | Unclassified | 892 |
| 199 | Ga0105239_10051269 | 3300010375 | Bacteria | 4524 |
| 200 | Ga0105239_10722447 | 3300010375 | Unclassified | 1139 |
| 201 | Ga0105246_10205190 | 3300011119 | Bacteria | 1535 |
| 202 | Ga0157373_10049317 | 3300013100 | Bacteria | 3000 |
| 203 | Ga0157373_10105699 | 3300013100 | Bacteria | 1979 |
| 204 | Ga0157373_10521256 | 3300013100 | Bacteria | 860 |
| 205 | Ga0157373_10715023 | 3300013100 | Unclassified | 735 |
| 206 | Ga0157371_10017291 | 3300013102 | Bacteria | 5362 |
| 207 | Ga0157370_10002945 | 3300013104 | Bacteria | 20266 |
| 208 | Ga0157370_10016201 | 3300013104 | Bacteria | 7554 |
| 209 | Ga0157370_10196751 | 3300013104 | Bacteria | 1871 |
| 210 | Ga0157370_10480988 | 3300013104 | Bacteria | 1141 |
| 211 | Ga0157370_10610952 | 3300013104 | Bacteria | 998 |
| 212 | Ga0157370_10949370 | 3300013104 | Unclassified | 779 |
| 213 | Ga0157369_10037789 | 3300013105 | Bacteria | 5284 |
| 214 | Ga0157369_10080666 | 3300013105 | Bacteria | 3484 |
| 215 | Ga0157369_10244768 | 3300013105 | Bacteria | 1872 |
| 216 | Ga0157369_10945693 | 3300013105 | Bacteria | 883 |
| 217 | Ga0157374_10182715 | 3300013296 | Bacteria | 2049 |
| 218 | Ga0157378_10041350 | 3300013297 | Bacteria | 4088 |
| 219 | Ga0157378_10101881 | 3300013297 | Plasmid | 2623 |
| 220 | Ga0163162_10018823 | 3300013306 | Bacteria | 6770 |
| 221 | Ga0163162_10024346 | 3300013306 | Bacteria | 5973 |
| 222 | Ga0163162_10513363 | 3300013306 | Bacteria | 1328 |
| 223 | Ga0157372_10017435 | 3300013307 | Bacteria | 7708 |
| 224 | Ga0157372_10154293 | 3300013307 | Bacteria | 2652 |
| 225 | Ga0157372_10178593 | 3300013307 | Bacteria | 2457 |
| 226 | Ga0157372_10343204 | 3300013307 | Bacteria | 1740 |
| 227 | Ga0157375_10010504 | 3300013308 | Bacteria | 8152 |
| 228 | Ga0157375_10355447 | 3300013308 | Bacteria | 1631 |
| 229 | Ga0157375_10517079 | 3300013308 | Bacteria | 1357 |
| 230 | Ga0163163_10267348 | 3300014325 | Bacteria | 1761 |
| 231 | Ga0157380_10068112 | 3300014326 | Unclassified | 2868 |
| 232 | Ga0157380_10123830 | 3300014326 | Bacteria | 2194 |
| 233 | Ga0157380_10150703 | 3300014326 | Bacteria | 2010 |
| 234 | Ga0157380_12168625 | 3300014326 | Unclassified | 619 |
| 235 | Ga0157377_10063072 | 3300014745 | Bacteria | 2122 |
| 236 | Ga0157379_10003198 | 3300014968 | Bacteria | 13874 |
| 237 | Ga0163161_10186493 | 3300017792 | Bacteria | 1593 |
| 238 | Ga0197907_10706547 | 3300020069 | Bacteria | 2377 |
| 239 | Ga0197907_11348615 | 3300020069 | Bacteria | 4439 |
| 240 | Ga0206356_11816379 | 3300020070 | Bacteria | 1699 |
| 241 | Ga0206356_11847643 | 3300020070 | Unclassified | 873 |
| 242 | Ga0206349_1352915 | 3300020075 | Unclassified | 874 |
| 243 | Ga0206355_1576845 | 3300020076 | Unclassified | 1431 |
| 244 | Ga0206355_1577345 | 3300020076 | Bacteria | 1304 |
| 245 | Ga0206351_10048966 | 3300020077 | Unclassified | 883 |
| 246 | Ga0206352_10174033 | 3300020078 | Unclassified | 1042 |
| 247 | Ga0206352_10622456 | 3300020078 | Unclassified | 745 |
| 248 | Ga0206352_11166897 | 3300020078 | Unclassified | 974 |
| 249 | Ga0206350_10156355 | 3300020080 | Unclassified | 957 |
| 250 | Ga0206350_10230214 | 3300020080 | Unclassified | 742 |
| 251 | Ga0206354_10852653 | 3300020081 | Unclassified | 982 |
| 252 | Ga0206354_11317698 | 3300020081 | Bacteria | 3929 |
| 253 | Ga0206353_10877890 | 3300020082 | Unclassified | 990 |
| 254 | Ga0206353_11792761 | 3300020082 | Bacteria | 2942 |
| 255 | Ga0213872_10000128 | 3300021361 | Bacteria | 69106 |
| 256 | Ga0213874_10037005 | 3300021377 | Unclassified | 1442 |
| 257 | Ga0213876_10007122 | 3300021384 | Bacteria | 6096 |
| 258 | Ga0213876_10021352 | 3300021384 | Bacteria | 3425 |
| 259 | Ga0213875_10016864 | 3300021388 | Archaea | 3538 |
| 260 | Ga0224712_10057958 | 3300022467 | Bacteria | 1532 |
| 261 | Ga0224712_10154541 | 3300022467 | Bacteria | 1019 |
| 262 | Ga0224712_10341565 | 3300022467 | Unclassified | 706 |
| 263 | Ga0207697_10005846 | 3300025315 | Bacteria | 5656 |
| 264 | Ga0207656_10011296 | 3300025321 | Bacteria | 3372 |
| 265 | Ga0207642_10043919 | 3300025899 | Bacteria | 1975 |
| 266 | Ga0207710_10482636 | 3300025900 | Bacteria | 642 |
| 267 | Ga0207688_10035092 | 3300025901 | Bacteria | 2778 |
| 268 | Ga0207647_10048946 | 3300025904 | Bacteria | 2623 |
| 269 | Ga0207699_10474400 | 3300025906 | Bacteria | 900 |
| 270 | Ga0207699_10498285 | 3300025906 | Bacteria | 879 |
| 271 | Ga0207645_10000786 | 3300025907 | Bacteria | 26518 |
| 272 | Ga0207643_10004073 | 3300025908 | Bacteria | 7861 |
| 273 | Ga0207705_10354427 | 3300025909 | Unclassified | 1131 |
| 274 | Ga0207705_10466669 | 3300025909 | Unclassified | 979 |
| 275 | Ga0207654_10461931 | 3300025911 | Unclassified | 892 |
| 276 | Ga0207707_10003061 | 3300025912 | Bacteria | 14858 |
| 277 | Ga0207707_10032019 | 3300025912 | Bacteria | 4603 |
| 278 | Ga0207707_10039094 | 3300025912 | Bacteria | 4147 |
| 279 | Ga0207707_10637388 | 3300025912 | Bacteria | 899 |
| 280 | Ga0207695_10002651 | 3300025913 | Bacteria | 26154 |
| 281 | Ga0207695_10032703 | 3300025913 | Bacteria | 5688 |
| 282 | Ga0207695_10846718 | 3300025913 | Bacteria | 794 |
| 283 | Ga0207671_10418040 | 3300025914 | Bacteria | 1067 |
| 284 | Ga0207663_10150106 | 3300025916 | Bacteria | 1634 |
| 285 | Ga0207660_10039206 | 3300025917 | Bacteria | 3310 |
| 286 | Ga0207660_10230448 | 3300025917 | Bacteria | 1456 |
| 287 | Ga0207660_10279080 | 3300025917 | Bacteria | 1325 |
| 288 | Ga0207662_10001813 | 3300025918 | Bacteria | 10490 |
| 289 | Ga0207657_10049205 | 3300025919 | Bacteria | 3675 |
| 290 | Ga0207657_10062691 | 3300025919 | Bacteria | 3182 |
| 291 | Ga0207657_10535229 | 3300025919 | Unclassified | 916 |
| 292 | Ga0207657_10747855 | 3300025919 | Unclassified | 758 |
| 293 | Ga0207649_10008483 | 3300025920 | Bacteria | 5604 |
| 294 | Ga0207649_10014851 | 3300025920 | Bacteria | 4368 |
| 295 | Ga0207649_10124688 | 3300025920 | Bacteria | 1741 |
| 296 | Ga0207652_10003734 | 3300025921 | Bacteria | 12493 |
| 297 | Ga0207652_10067380 | 3300025921 | Bacteria | 3104 |
| 298 | Ga0207652_10113015 | 3300025921 | Bacteria | 2410 |
| 299 | Ga0207652_10147492 | 3300025921 | Bacteria | 2106 |
| 300 | Ga0207652_10211811 | 3300025921 | Bacteria | 1745 |
| 301 | Ga0207681_10013302 | 3300025923 | Bacteria | 5089 |
| 302 | Ga0207681_10016554 | 3300025923 | Bacteria | 4614 |
| 303 | Ga0207694_10717788 | 3300025924 | Unclassified | 843 |
| 304 | Ga0207650_10015220 | 3300025925 | Bacteria | 5354 |
| 305 | Ga0207659_10046573 | 3300025926 | Bacteria | 3063 |
| 306 | Ga0207687_11009218 | 3300025927 | Bacteria | 714 |
| 307 | Ga0207664_10016765 | 3300025929 | Bacteria | 5352 |
| 308 | Ga0207664_10743126 | 3300025929 | Unclassified | 882 |
| 309 | Ga0207644_10536114 | 3300025931 | Bacteria | 968 |
| 310 | Ga0207690_10027238 | 3300025932 | Bacteria | 3611 |
| 311 | Ga0207690_10114423 | 3300025932 | Bacteria | 1948 |
| 312 | Ga0207706_10000699 | 3300025933 | Bacteria | 35071 |
| 313 | Ga0207706_10246043 | 3300025933 | Bacteria | 1563 |
| 314 | Ga0207686_10069220 | 3300025934 | Bacteria | 2264 |
| 315 | Ga0207709_10106838 | 3300025935 | Bacteria | 1863 |
| 316 | Ga0207670_10089422 | 3300025936 | Bacteria | 2173 |
| 317 | Ga0207669_10118050 | 3300025937 | Bacteria | 1794 |
| 318 | Ga0207669_11037025 | 3300025937 | Bacteria | 690 |
| 319 | Ga0207704_10074271 | 3300025938 | Bacteria | 2169 |
| 320 | Ga0207691_10000620 | 3300025940 | Bacteria | 35183 |
| 321 | Ga0207691_10019226 | 3300025940 | Bacteria | 6466 |
| 322 | Ga0207691_10834149 | 3300025940 | Bacteria | 774 |
| 323 | Ga0207711_10067035 | 3300025941 | Bacteria | 3106 |
| 324 | Ga0207689_10004256 | 3300025942 | Bacteria | 13014 |
| 325 | Ga0207661_10039298 | 3300025944 | Bacteria | 3713 |
| 326 | Ga0207661_10072452 | 3300025944 | Bacteria | 2818 |
| 327 | Ga0207661_10314158 | 3300025944 | Bacteria | 1407 |
| 328 | Ga0207679_10005170 | 3300025945 | Bacteria | 8173 |
| 329 | Ga0207679_10007499 | 3300025945 | Bacteria | 6924 |
| 330 | Ga0207679_10087897 | 3300025945 | Bacteria | 2394 |
| 331 | Ga0207667_10002390 | 3300025949 | Bacteria | 23495 |
| 332 | Ga0207667_10022089 | 3300025949 | Bacteria | 7038 |
| 333 | Ga0207667_10353564 | 3300025949 | Bacteria | 1498 |
| 334 | Ga0207667_10643536 | 3300025949 | Bacteria | 1066 |
| 335 | Ga0207651_10022256 | 3300025960 | Bacteria | 3871 |
| 336 | Ga0207712_10000556 | 3300025961 | Bacteria | 30175 |
| 337 | Ga0207712_10013819 | 3300025961 | Bacteria | 5179 |
| 338 | Ga0207712_10349153 | 3300025961 | Bacteria | 1229 |
| 339 | Ga0207712_11021289 | 3300025961 | Unclassified | 734 |
| 340 | Ga0207668_10013281 | 3300025972 | Bacteria | 5066 |
| 341 | Ga0207668_10023108 | 3300025972 | Bacteria | 3991 |
| 342 | Ga0207640_10055318 | 3300025981 | Bacteria | 2599 |
| 343 | Ga0207658_10036477 | 3300025986 | Bacteria | 3525 |
| 344 | Ga0207677_10025641 | 3300026023 | Bacteria | 3681 |
| 345 | Ga0207703_10060471 | 3300026035 | Bacteria | 3098 |
| 346 | Ga0207639_10088322 | 3300026041 | Bacteria | 2473 |
| 347 | Ga0207639_10765249 | 3300026041 | Unclassified | 898 |
| 348 | Ga0207678_10019269 | 3300026067 | Bacteria | 5992 |
| 349 | Ga0207708_10010733 | 3300026075 | Bacteria | 6809 |
| 350 | Ga0207702_10216141 | 3300026078 | Bacteria | 1784 |
| 351 | Ga0207641_10010432 | 3300026088 | Bacteria | 7634 |
| 352 | Ga0207648_10041362 | 3300026089 | Bacteria | 4047 |
| 353 | Ga0207648_10153056 | 3300026089 | Bacteria | 2035 |
| 354 | Ga0207648_10481573 | 3300026089 | Bacteria | 1133 |
| 355 | Ga0207674_10000562 | 3300026116 | Bacteria | 48566 |
| 356 | Ga0207674_10001289 | 3300026116 | Bacteria | 32724 |
| 357 | Ga0207674_10335219 | 3300026116 | Bacteria | 1462 |
| 358 | Ga0207675_100000109 | 3300026118 | Bacteria | 66734 |
| 359 | Ga0207675_100036407 | 3300026118 | Bacteria | 4591 |
| 360 | Ga0207675_100366281 | 3300026118 | Bacteria | 1415 |
| 361 | Ga0207698_10015930 | 3300026142 | Bacteria | 5054 |
| 362 | Ga0207698_10114329 | 3300026142 | Bacteria | 2270 |
| 363 | Ga0207698_10526437 | 3300026142 | Bacteria | 1154 |
| 364 | Ga0207428_10350777 | 3300027907 | Bacteria | 1086 |
| 365 | Ga0268266_10454885 | 3300028379 | Bacteria | 1217 |
| 366 | Ga0268266_10889769 | 3300028379 | Unclassified | 861 |
| 367 | Ga0268265_10001840 | 3300028380 | Bacteria | 16909 |
| 368 | Ga0268265_10028860 | 3300028380 | Bacteria | 3976 |
| 369 | Ga0268265_10365737 | 3300028380 | Bacteria | 1322 |
| 370 | Ga0268264_10048178 | 3300028381 | Bacteria | 3544 |
| 371 | Ga0265323_10004555 | 3300028653 | Bacteria | 5967 |
| 372 | Ga0265338_10009700 | 3300028800 | Bacteria | 11418 |
| 373 | Ga0307511_10000295 | 3300030521 | Bacteria | 52686 |
| 374 | Ga0307511_10000379 | 3300030521 | Bacteria | 47487 |
| 375 | Ga0265327_10133739 | 3300031251 | Bacteria | 1164 |
| 376 | Ga0307408_100019238 | 3300031548 | Bacteria | 4595 |
| 377 | Ga0307405_10007099 | 3300031731 | Bacteria | 5569 |
| 378 | Ga0307405_10076143 | 3300031731 | Bacteria | 2176 |
| 379 | Ga0307405_10086383 | 3300031731 | Bacteria | 2065 |
| 380 | Ga0307405_11758886 | 3300031731 | Bacteria | 550 |
| 381 | Ga0247548_100357 | 3300031814 | Bacteria | 1556 |
| 382 | Ga0307413_10007449 | 3300031824 | Bacteria | 5084 |
| 383 | Ga0307413_10071926 | 3300031824 | Bacteria | 2181 |
| 384 | Ga0307413_10095838 | 3300031824 | Bacteria | 1946 |
| 385 | Ga0307413_10295718 | 3300031824 | Bacteria | 1225 |
| 386 | Ga0307413_11741431 | 3300031824 | Bacteria | 556 |
| 387 | Ga0307410_10000129 | 3300031852 | Bacteria | 27078 |
| 388 | Ga0307410_10042651 | 3300031852 | Bacteria | 3001 |
| 389 | Ga0307410_10091101 | 3300031852 | Bacteria | 2164 |
| 390 | Ga0307410_10211860 | 3300031852 | Bacteria | 1485 |
| 391 | Ga0307410_10235126 | 3300031852 | Bacteria | 1417 |
| 392 | Ga0307406_10000417 | 3300031901 | Bacteria | 24748 |
| 393 | Ga0307406_10002422 | 3300031901 | Bacteria | 10141 |
| 394 | Ga0307406_10072572 | 3300031901 | Bacteria | 2260 |
| 395 | Ga0307406_11156243 | 3300031901 | Unclassified | 670 |
| 396 | Ga0307407_10392506 | 3300031903 | Bacteria | 994 |
| 397 | Ga0307409_100000079 | 3300031995 | Bacteria | 34726 |
| 398 | Ga0307409_100080733 | 3300031995 | Bacteria | 2626 |
| 399 | Ga0307409_100186168 | 3300031995 | Bacteria | 1843 |
| 400 | Ga0307409_100518130 | 3300031995 | Bacteria | 1164 |
| 401 | Ga0307409_100579820 | 3300031995 | Bacteria | 1105 |
| 402 | Ga0307416_100004690 | 3300032002 | Bacteria | 8279 |
| 403 | Ga0307416_100142351 | 3300032002 | Bacteria | 2182 |
| 404 | Ga0307416_100157367 | 3300032002 | Bacteria | 2094 |
| 405 | Ga0307416_100286094 | 3300032002 | Bacteria | 1629 |
| 406 | Ga0307416_100842966 | 3300032002 | Bacteria | 1014 |
| 407 | Ga0307414_10004632 | 3300032004 | Bacteria | 7486 |
| 408 | Ga0307414_10139212 | 3300032004 | Bacteria | 1897 |
| 409 | Ga0307414_10186463 | 3300032004 | Bacteria | 1674 |
| 410 | Ga0307414_10746585 | 3300032004 | Bacteria | 889 |
| 411 | Ga0307411_10162226 | 3300032005 | Unclassified | 1676 |
| 412 | Ga0307415_100024831 | 3300032126 | Bacteria | 3751 |
| 413 | Ga0307415_100029467 | 3300032126 | Bacteria | 3508 |
| 414 | Ga0307415_100045485 | 3300032126 | Bacteria | 2943 |
| 415 | Ga0307415_100061777 | 3300032126 | Bacteria | 2595 |
| 416 | Ga0307415_100071208 | 3300032126 | Bacteria | 2444 |
| 417 | Ga0307415_100395540 | 3300032126 | Bacteria | 1178 |
| 418 | Ga0395899_0614480 | 3300037312 | Unclassified | 691 |
| 419 | Ga0395905_0440733 | 3300037471 | Bacteria | 1200 |
| 420 | Ga0436364_0188943 | 3300037853 | Bacteria | 6858 |
| 421 | Ga0436364_0459198 | 3300037853 | Archaea | 6074 |
| 422 | Ga0436364_1280777 | 3300037853 | Unclassified | 962 |
| 423 | Ga0436365_0152204 | 3300039437 | Bacteria | 32272 |
| 424 | Ga0436365_0289034 | 3300039437 | Unclassified | 749 |
| 425 | Ga0436365_0924513 | 3300039437 | Bacteria | 3002 |
| 426 | Ga0436365_1852273 | 3300039437 | Bacteria | 1029 |
| 427 | Ga0436361_0282335 | 3300039447 | Archaea | 1058 |
| 428 | Ga0436361_0482954 | 3300039447 | Bacteria | 2820 |
| 429 | Ga0436361_0610116 | 3300039447 | Bacteria | 176709 |
| 430 | Ga0436363_0488288 | 3300039450 | Bacteria | 693 |
| 431 | Ga0436363_1617116 | 3300039450 | Bacteria | 3133 |
| 432 | Ga0466972_0385360 | 3300044658 | Unclassified | 657 |
| 433 | Ga0466963_0242654 | 3300044694 | Bacteria | 1264 |
| 434 | Ga0466957_0231401 | 3300044842 | Bacteria | 1224 |
| 435 | Ga0466957_1043298 | 3300044842 | Bacteria | 588 |
| 436 | Ga0451576_0039203 | 3300045051 | Bacteria | 5014 |
| 437 | Ga0451576_0823019 | 3300045051 | Bacteria | 975 |
| 438 | Ga0466967_0081391 | 3300045976 | Bacteria | 2925 |
| 439 | Ga0466967_0276881 | 3300045976 | Bacteria | 1609 |
| 440 | Ga0495629_0088645 | 3300046459 | Bacteria | 2158 |
| 441 | Ga0495582_0125473 | 3300046473 | Bacteria | 1448 |
| 442 | Ga0495639_0473394 | 3300046475 | Bacteria | 638 |
| 443 | Ga0495621_0308776 | 3300046539 | Unclassified | 657 |
| 444 | Ga0495658_0048593 | 3300046683 | Bacteria | 2393 |
| 445 | Ga0495670_0245840 | 3300046691 | Unclassified | 953 |
| 446 | Ga0496106_0382309 | 3300048909 | Bacteria | 1131 |
| 447 | Ga0496109_0072961 | 3300048912 | Bacteria | 3154 |
| 448 | Ga0496110_1399891 | 3300048913 | Bacteria | 609 |
| 449 | Ga0496113_0833965 | 3300048916 | Unclassified | 731 |
| 450 | Ga0501306_033230 | 3300049127 | Bacteria | 775 |
| 451 | Ga0501308_026253 | 3300049128 | Bacteria | 759 |
| 452 | Ga0501309_024531 | 3300049129 | Bacteria | 862 |
| 453 | Ga0501304_021701 | 3300049160 | Bacteria | 640 |
| 454 | Ga0501304_038154 | 3300049160 | Unclassified | 530 |
| 455 | Ga0501305_050458 | 3300049161 | Bacteria | 697 |
| 456 | Ga0501305_107806 | 3300049161 | Bacteria | 524 |
| 457 | Ga0501305_107892 | 3300049161 | Bacteria | 524 |
| 458 | Ga0501307_038029 | 3300049162 | Bacteria | 690 |
| 459 | Ga0501307_068643 | 3300049162 | Bacteria | 562 |
| 460 | Ga0501298_071718 | 3300049521 | Bacteria | 749 |
| 461 | Ga0501311_034545 | 3300049527 | Unclassified | 745 |
| 462 | Ga0501311_035920 | 3300049527 | Unclassified | 735 |
| 463 | Ga0501312_051317 | 3300049528 | Bacteria | 696 |
| 464 | Ga0501314_023775 | 3300049530 | Bacteria | 651 |
| 465 | Ga0501317_024418 | 3300049533 | Bacteria | 841 |
| 466 | Ga0501318_029747 | 3300049534 | Bacteria | 738 |
| 467 | Ga0501320_017243 | 3300049536 | Bacteria | 806 |
| 468 | Ga0501321_039265 | 3300049537 | Bacteria | 660 |
| 469 | Ga0501321_062981 | 3300049537 | Bacteria | 564 |
| 470 | Ga0501322_007465 | 3300049538 | Bacteria | 797 |
| 471 | Ga0501323_018212 | 3300049539 | Bacteria | 907 |
| 472 | Ga0501323_073047 | 3300049539 | Unclassified | 551 |
| 473 | Ga0501324_023484 | 3300049540 | Bacteria | 642 |
| 474 | Ga0501333_011320 | 3300049549 | Bacteria | 643 |
| 475 | Ga0501227_174642 | 3300049665 | Bacteria | 602 |
| 476 | Ga0501235_133151 | 3300049669 | Unclassified | 631 |
| 477 | Ga0501242_039431 | 3300049674 | Bacteria | 664 |
| 478 | Ga0501249_121170 | 3300049679 | Bacteria | 639 |
| 479 | Ga0501261_037334 | 3300049690 | Bacteria | 755 |
| 480 | Ga0501225_0167629 | 3300049705 | Bacteria | 679 |
| 481 | Ga0501229_064231 | 3300049706 | Unclassified | 565 |
| 482 | Ga0501283_081996 | 3300049779 | Bacteria | 608 |
| 483 | nmdc:mga05p37_252491_c1 | 3300050507 | Bacteria | 2114 |
| 484 | nmdc:mga05p37_277217_c1 | 3300050507 | Bacteria | 2001 |
| 485 | nmdc:mga05p37_554551_c1 | 3300050507 | Bacteria | 1307 |
| 486 | nmdc:mga09592_64978_c1 | 3300050508 | Bacteria | 3089 |
| 487 | nmdc:mga0qj67_35220_c1 | 3300050509 | Bacteria | 3913 |
| 488 | nmdc:mga0qj67_4675_c1 | 3300050509 | Bacteria | 9938 |
| 489 | nmdc:mga06r32_257246_c1 | 3300050510 | Bacteria | 1734 |
| 490 | nmdc:mga08y16_58011_c1 | 3300050511 | Bacteria | 4045 |
| 491 | nmdc:mga08y16_59257_c1 | 3300050511 | Plasmid | 4000 |
| 492 | nmdc:mga0n895_408074_c1 | 3300050512 | Bacteria | 1374 |
| 493 | nmdc:mga0rr50_132519_c1 | 3300050513 | Bacteria | 1997 |
| 494 | nmdc:mga08x19_19436_c1 | 3300050514 | Bacteria | 4168 |
| 495 | nmdc:mga08x19_215250_c1 | 3300050514 | Bacteria | 1319 |
| 496 | nmdc:mga0a205_1059936_c1 | 3300050515 | Bacteria | 658 |
| 497 | nmdc:mga0a205_185077_c1 | 3300050515 | Bacteria | 1976 |
| 498 | nmdc:mga0sz30_14723_c1 | 3300050516 | Bacteria | 3083 |
| 499 | Ga0500646_0002211 | 3300053090 | Bacteria | 5075 |
| 500 | Ga0500655_015196 | 3300053133 | Bacteria | 1411 |
| 501 | Ga0500568_0038706 | 3300053139 | Bacteria | 1929 |
| 502 | Ga0500604_0006628 | 3300053151 | Bacteria | 3062 |
| 503 | Ga0500616_0031076 | 3300053153 | Bacteria | 2928 |
| 504 | Ga0587084_013505 | 3300059477 | Bacteria | 1124 |
| 505 | Ga0587066_008238 | 3300059490 | Bacteria | 1441 |
| 506 | Ga0587066_014044 | 3300059490 | Bacteria | 1224 |
| 507 | Ga0587066_052377 | 3300059490 | Bacteria | 808 |
| 508 | Ga0587066_067802 | 3300059490 | Bacteria | 744 |
| 509 | Ga0587070_011739 | 3300059491 | Bacteria | 1317 |
| 510 | Ga0587070_047361 | 3300059491 | Bacteria | 846 |
| 511 | Ga0587070_076424 | 3300059491 | Unclassified | 726 |
| 512 | Ga0587070_124662 | 3300059491 | Bacteria | 620 |
| 513 | Ga0587077_019083 | 3300059493 | Bacteria | 1189 |
| 514 | Ga0587077_049869 | 3300059493 | Unclassified | 872 |
| 515 | Ga0587077_062594 | 3300059493 | Bacteria | 810 |
| 516 | Ga0587080_017725 | 3300059503 | Bacteria | 1137 |
| 517 | Ga0587080_031076 | 3300059503 | Unclassified | 931 |
| 518 | Ga0587082_009145 | 3300059504 | Bacteria | 1399 |
| 519 | Ga0587082_013629 | 3300059504 | Bacteria | 1228 |
| 520 | Ga0587083_0004065 | 3300059505 | Bacteria | 1999 |
| 521 | Ga0587083_0008362 | 3300059505 | Bacteria | 1616 |
| 522 | Ga0587083_0028972 | 3300059505 | Bacteria | 1087 |
| 523 | Ga0587083_0099509 | 3300059505 | Unclassified | 722 |
| 524 | Ga0587085_005279 | 3300059506 | Bacteria | 1514 |
| 525 | Ga0587085_008289 | 3300059506 | Bacteria | 1322 |
| 526 | Ga0587085_047530 | 3300059506 | Unclassified | 771 |
| 527 | Ga0587086_030788 | 3300059507 | Unclassified | 788 |
| 528 | Ga0587088_010172 | 3300059508 | Bacteria | 1372 |
| 529 | Ga0587089_026175 | 3300059509 | Unclassified | 836 |
| 530 | Ga0587090_014984 | 3300059510 | Bacteria | 1140 |
| 531 | Ga0587091_016977 | 3300059511 | Bacteria | 1220 |
| 532 | Ga0587091_020249 | 3300059511 | Bacteria | 1153 |
| 533 | Ga0587092_015765 | 3300059512 | Bacteria | 1111 |
| 534 | Ga0587092_016062 | 3300059512 | Bacteria | 1104 |
| 535 | Ga0587094_010459 | 3300059513 | Bacteria | 1204 |
| 536 | Ga0587094_034167 | 3300059513 | Unclassified | 802 |
| 537 | Ga0587106_015741 | 3300059605 | Unclassified | 1061 |
| 538 | Ga0587106_022988 | 3300059605 | Unclassified | 942 |
| 539 | Ga0587106_047487 | 3300059605 | Unclassified | 750 |
| 540 | Ga0587125_011741 | 3300059607 | Bacteria | 924 |
| 541 | Ga0587101_025031 | 3300059623 | Unclassified | 891 |
| 542 | Ga0587109_013958 | 3300059624 | Bacteria | 1341 |
| 543 | Ga0587109_056521 | 3300059624 | Unclassified | 817 |
| 544 | Ga0587115_024954 | 3300059626 | Unclassified | 856 |
| 545 | Ga0587117_018263 | 3300059627 | Bacteria | 952 |
| 546 | Ga0587117_025262 | 3300059627 | Unclassified | 859 |
| 547 | Ga0587128_086704 | 3300059630 | Unclassified | 636 |
| 548 | Ga0587062_021049 | 3300059639 | Bacteria | 925 |
| 549 | Ga0587067_183804 | 3300059640 | Bacteria | 546 |
| 550 | Ga0587068_053639 | 3300059641 | Unclassified | 760 |
| 551 | Ga0587075_012539 | 3300059644 | Bacteria | 1153 |
| 552 | Ga0587076_021116 | 3300059645 | Bacteria | 1075 |
| 553 | Ga0587076_058408 | 3300059645 | Unclassified | 771 |
| 554 | Ga0587076_104102 | 3300059645 | Unclassified | 638 |
| 555 | Ga0587078_007923 | 3300059646 | Unclassified | 1181 |
| 556 | Ga0587078_044305 | 3300059646 | Unclassified | 637 |
| 557 | Ga0587078_050147 | 3300059646 | Unclassified | 610 |
| 558 | Ga0587079_000838 | 3300059647 | Bacteria | 3094 |
| 559 | Ga0587102_022410 | 3300059649 | Unclassified | 722 |
| 560 | Ga0587107_006324 | 3300059652 | Bacteria | 1293 |
| 561 | Ga0587071_001679 | 3300060344 | Bacteria | 2839 |
| 562 | Ga0587071_015825 | 3300060344 | Bacteria | 1328 |
| 563 | Ga0587071_062560 | 3300060344 | Unclassified | 794 |
| 564 | Ga0587111_0017988 | 3300060346 | Bacteria | 1324 |
| 565 | Ga0587111_0078762 | 3300060346 | Bacteria | 784 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100009784 | Ga0068855_10000978413 | 126 |
| 2 | 3300020078 | Ga0206352_10622456 | Ga0206352_106224561 | 126 |
| 3 | 3300025949 | Ga0207667_10002390 | Ga0207667_100023906 | 126 |
| 4 | 3300025906 | Ga0207699_10474400 | Ga0207699_104744002 | 143 |
| 5 | 3300004801 | Ga0058860_11935308 | Ga0058860_119353081 | 145 |
| 6 | 3300031731 | Ga0307405_10086383 | Ga0307405_100863832 | 145 |
| 7 | 3300031852 | Ga0307410_10211860 | Ga0307410_102118602 | 145 |
| 8 | 3300032126 | Ga0307415_100045485 | Ga0307415_1000454852 | 145 |
| 9 | 3300031731 | Ga0307405_11758886 | Ga0307405_117588861 | 148 |
| 10 | 3300031824 | Ga0307413_10095838 | Ga0307413_100958381 | 148 |
| 11 | 3300031852 | Ga0307410_10235126 | Ga0307410_102351262 | 148 |
| 12 | 3300031901 | Ga0307406_10072572 | Ga0307406_100725722 | 148 |
| 13 | 3300031901 | Ga0307406_11156243 | Ga0307406_111562432 | 148 |
| 14 | 3300031995 | Ga0307409_100579820 | Ga0307409_1005798202 | 148 |
| 15 | 3300032002 | Ga0307416_100142351 | Ga0307416_1001423512 | 148 |
| 16 | 3300032004 | Ga0307414_10139212 | Ga0307414_101392122 | 148 |
| 17 | 3300032004 | Ga0307414_10746585 | Ga0307414_107465852 | 148 |
| 18 | 3300032005 | Ga0307411_10162226 | Ga0307411_101622263 | 148 |
| 19 | 3300032126 | Ga0307415_100029467 | Ga0307415_1000294674 | 148 |
| 20 | 3300049521 | Ga0501298_071718 | Ga0501298_071718_18_509 | 148 |
| 21 | 3300049669 | Ga0501235_133151 | Ga0501235_133151_60_551 | 148 |
| 22 | 3300049679 | Ga0501249_121170 | Ga0501249_121170_137_628 | 148 |
| 23 | 3300049706 | Ga0501229_064231 | Ga0501229_064231_39_530 | 148 |
| 24 | 3300032126 | Ga0307415_100395540 | Ga0307415_1003955402 | 150 |
| 25 | 3300005563 | Ga0068855_100433172 | Ga0068855_1004331722 | 151 |
| 26 | 3300032002 | Ga0307416_100286094 | Ga0307416_1002860941 | 151 |
| 27 | 3300031852 | Ga0307410_10042651 | Ga0307410_100426512 | 152 |
| 28 | 3300031903 | Ga0307407_10392506 | Ga0307407_103925062 | 152 |
| 29 | 3300031995 | Ga0307409_100080733 | Ga0307409_1000807333 | 152 |
| 30 | 3300032126 | Ga0307415_100024831 | Ga0307415_1000248312 | 152 |
| 31 | 3300039447 | Ga0436361_0482954 | Ga0436361_0482954_261_749 | 152 |
| 32 | 3300049527 | Ga0501311_034545 | Ga0501311_034545_55_546 | 152 |
| 33 | 3300028653 | Ga0265323_10004555 | Ga0265323_100045554 | 154 |
| 34 | 3300044658 | Ga0466972_0385360 | Ga0466972_0385360_40_540 | 155 |
| 35 | 3300059490 | Ga0587066_067802 | Ga0587066_067802_244_729 | 155 |
| 36 | iso_pu_bacteria | 2920107658 | 2920114291 | 155 |
| 37 | 3300025909 | Ga0207705_10466669 | Ga0207705_104666691 | 156 |
| 38 | 3300006846 | Ga0075430_100140167 | Ga0075430_1001401672 | 158 |
| 39 | 3300006847 | Ga0075431_100204134 | Ga0075431_1002041342 | 158 |
| 40 | 3300009147 | Ga0114129_10084955 | Ga0114129_100849556 | 158 |
| 41 | 3300021361 | Ga0213872_10000128 | Ga0213872_1000012839 | 158 |
| 42 | 3300021377 | Ga0213874_10037005 | Ga0213874_100370051 | 158 |
| 43 | 3300021388 | Ga0213875_10016864 | Ga0213875_100168643 | 158 |
| 44 | 3300037853 | Ga0436364_0459198 | Ga0436364_0459198_5325_5831 | 158 |
| 45 | 3300039447 | Ga0436361_0282335 | Ga0436361_0282335_200_706 | 158 |
| 46 | 3300039447 | Ga0436361_0610116 | Ga0436361_0610116_42209_42715 | 158 |
| 47 | 3300039450 | Ga0436363_1617116 | Ga0436363_1617116_1405_1911 | 158 |
| 48 | 3300045051 | Ga0451576_0823019 | Ga0451576_0823019_356_856 | 158 |
| 49 | 3300050510 | nmdc:mga06r32_257246_c1 | nmdc:mga06r32_257246_c1_646_1152 | 158 |
| 50 | 3300005295 | Ga0065707_10408345 | Ga0065707_104083451 | 159 |
| 51 | 3300005347 | Ga0070668_100050950 | Ga0070668_1000509503 | 159 |
| 52 | 3300005353 | Ga0070669_100022607 | Ga0070669_1000226075 | 159 |
| 53 | 3300005457 | Ga0070662_100177923 | Ga0070662_1001779233 | 159 |
| 54 | 3300005549 | Ga0070704_100367846 | Ga0070704_1003678461 | 159 |
| 55 | 3300005577 | Ga0068857_100025870 | Ga0068857_1000258703 | 159 |
| 56 | 3300005719 | Ga0068861_100003562 | Ga0068861_1000035623 | 159 |
| 57 | 3300005840 | Ga0068870_10013131 | Ga0068870_100131314 | 159 |
| 58 | 3300005844 | Ga0068862_100000615 | Ga0068862_10000061519 | 159 |
| 59 | 3300006844 | Ga0075428_100077788 | Ga0075428_1000777882 | 159 |
| 60 | 3300009094 | Ga0111539_10050328 | Ga0111539_100503285 | 159 |
| 61 | 3300009148 | Ga0105243_10093455 | Ga0105243_100934552 | 159 |
| 62 | 3300009553 | Ga0105249_10001343 | Ga0105249_1000134312 | 159 |
| 63 | 3300011119 | Ga0105246_10205190 | Ga0105246_102051902 | 159 |
| 64 | 3300013306 | Ga0163162_10513363 | Ga0163162_105133632 | 159 |
| 65 | 3300013308 | Ga0157375_10517079 | Ga0157375_105170792 | 159 |
| 66 | 3300014326 | Ga0157380_10123830 | Ga0157380_101238303 | 159 |
| 67 | 3300025908 | Ga0207643_10004073 | Ga0207643_100040737 | 159 |
| 68 | 3300025923 | Ga0207681_10016554 | Ga0207681_100165545 | 159 |
| 69 | 3300025933 | Ga0207706_10246043 | Ga0207706_102460432 | 159 |
| 70 | 3300025935 | Ga0207709_10106838 | Ga0207709_101068382 | 159 |
| 71 | 3300025940 | Ga0207691_10019226 | Ga0207691_100192265 | 159 |
| 72 | 3300025961 | Ga0207712_10000556 | Ga0207712_1000055615 | 159 |
| 73 | 3300025972 | Ga0207668_10013281 | Ga0207668_100132814 | 159 |
| 74 | 3300026116 | Ga0207674_10001289 | Ga0207674_1000128920 | 159 |
| 75 | 3300026118 | Ga0207675_100036407 | Ga0207675_1000364074 | 159 |
| 76 | 3300028380 | Ga0268265_10001840 | Ga0268265_1000184010 | 159 |
| 77 | 3300050511 | nmdc:mga08y16_58011_c1 | nmdc:mga08y16_58011_c1_3482_3976 | 159 |
| 78 | 3300004799 | Ga0058863_10160248 | Ga0058863_101602482 | 161 |
| 79 | 3300004800 | Ga0058861_10060554 | Ga0058861_100605542 | 161 |
| 80 | 3300004800 | Ga0058861_12005798 | Ga0058861_120057982 | 161 |
| 81 | 3300004801 | Ga0058860_11384070 | Ga0058860_113840701 | 161 |
| 82 | 3300004803 | Ga0058862_10019101 | Ga0058862_100191012 | 161 |
| 83 | 3300005327 | Ga0070658_10532394 | Ga0070658_105323942 | 161 |
| 84 | 3300005329 | Ga0070683_100451780 | Ga0070683_1004517801 | 161 |
| 85 | 3300005336 | Ga0070680_100044849 | Ga0070680_1000448492 | 161 |
| 86 | 3300005336 | Ga0070680_100093191 | Ga0070680_1000931912 | 161 |
| 87 | 3300005337 | Ga0070682_100173940 | Ga0070682_1001739402 | 161 |
| 88 | 3300005339 | Ga0070660_100119309 | Ga0070660_1001193092 | 161 |
| 89 | 3300005353 | Ga0070669_100373946 | Ga0070669_1003739462 | 161 |
| 90 | 3300005435 | Ga0070714_100005654 | Ga0070714_1000056548 | 161 |
| 91 | 3300005435 | Ga0070714_100854849 | Ga0070714_1008548492 | 161 |
| 92 | 3300005458 | Ga0070681_10013569 | Ga0070681_100135692 | 161 |
| 93 | 3300005458 | Ga0070681_11095034 | Ga0070681_110950341 | 161 |
| 94 | 3300005518 | Ga0070699_100308751 | Ga0070699_1003087512 | 161 |
| 95 | 3300005530 | Ga0070679_100084500 | Ga0070679_1000845002 | 161 |
| 96 | 3300005530 | Ga0070679_100679220 | Ga0070679_1006792202 | 161 |
| 97 | 3300005535 | Ga0070684_100207260 | Ga0070684_1002072602 | 161 |
| 98 | 3300005539 | Ga0068853_101193960 | Ga0068853_1011939602 | 161 |
| 99 | 3300005563 | Ga0068855_100161798 | Ga0068855_1001617983 | 161 |
| 100 | 3300005563 | Ga0068855_100169573 | Ga0068855_1001695732 | 161 |
| 101 | 3300005564 | Ga0070664_100077612 | Ga0070664_1000776122 | 161 |
| 102 | 3300005577 | Ga0068857_100650282 | Ga0068857_1006502822 | 161 |
| 103 | 3300005578 | Ga0068854_100030696 | Ga0068854_1000306963 | 161 |
| 104 | 3300005614 | Ga0068856_100123323 | Ga0068856_1001233232 | 161 |
| 105 | 3300005616 | Ga0068852_100099841 | Ga0068852_1000998413 | 161 |
| 106 | 3300005617 | Ga0068859_100854677 | Ga0068859_1008546772 | 161 |
| 107 | 3300005719 | Ga0068861_100262581 | Ga0068861_1002625811 | 161 |
| 108 | 3300005844 | Ga0068862_100086752 | Ga0068862_1000867522 | 161 |
| 109 | 3300006028 | Ga0070717_10262815 | Ga0070717_102628152 | 161 |
| 110 | 3300006195 | Ga0075366_10366758 | Ga0075366_103667582 | 161 |
| 111 | 3300006844 | Ga0075428_100022293 | Ga0075428_1000222933 | 161 |
| 112 | 3300006852 | Ga0075433_10147469 | Ga0075433_101474692 | 161 |
| 113 | 3300006871 | Ga0075434_100362520 | Ga0075434_1003625202 | 161 |
| 114 | 3300006914 | Ga0075436_100029167 | Ga0075436_1000291673 | 161 |
| 115 | 3300006931 | Ga0097620_100854763 | Ga0097620_1008547631 | 161 |
| 116 | 3300009093 | Ga0105240_10065804 | Ga0105240_100658044 | 161 |
| 117 | 3300009093 | Ga0105240_10699435 | Ga0105240_106994352 | 161 |
| 118 | 3300009094 | Ga0111539_10827655 | Ga0111539_108276552 | 161 |
| 119 | 3300009147 | Ga0114129_10458990 | Ga0114129_104589902 | 161 |
| 120 | 3300009174 | Ga0105241_10070795 | Ga0105241_100707953 | 161 |
| 121 | 3300009545 | Ga0105237_10307862 | Ga0105237_103078622 | 161 |
| 122 | 3300009551 | Ga0105238_10231130 | Ga0105238_102311302 | 161 |
| 123 | 3300009553 | Ga0105249_10188470 | Ga0105249_101884701 | 161 |
| 124 | 3300009553 | Ga0105249_11031242 | Ga0105249_110312422 | 161 |
| 125 | 3300010375 | Ga0105239_10722447 | Ga0105239_107224472 | 161 |
| 126 | 3300013100 | Ga0157373_10049317 | Ga0157373_100493172 | 161 |
| 127 | 3300013100 | Ga0157373_10105699 | Ga0157373_101056992 | 161 |
| 128 | 3300013104 | Ga0157370_10016201 | Ga0157370_100162015 | 161 |
| 129 | 3300013104 | Ga0157370_10196751 | Ga0157370_101967512 | 161 |
| 130 | 3300013104 | Ga0157370_10480988 | Ga0157370_104809882 | 161 |
| 131 | 3300013104 | Ga0157370_10610952 | Ga0157370_106109522 | 161 |
| 132 | 3300013104 | Ga0157370_10949370 | Ga0157370_109493702 | 161 |
| 133 | 3300013105 | Ga0157369_10080666 | Ga0157369_100806662 | 161 |
| 134 | 3300013105 | Ga0157369_10945693 | Ga0157369_109456932 | 161 |
| 135 | 3300013297 | Ga0157378_10101881 | Ga0157378_101018813 | 161 |
| 136 | 3300013306 | Ga0163162_10024346 | Ga0163162_100243468 | 161 |
| 137 | 3300013307 | Ga0157372_10017435 | Ga0157372_100174353 | 161 |
| 138 | 3300013307 | Ga0157372_10343204 | Ga0157372_103432042 | 161 |
| 139 | 3300013308 | Ga0157375_10355447 | Ga0157375_103554471 | 161 |
| 140 | 3300014326 | Ga0157380_10068112 | Ga0157380_100681123 | 161 |
| 141 | 3300014326 | Ga0157380_12168625 | Ga0157380_121686251 | 161 |
| 142 | 3300020069 | Ga0197907_10706547 | Ga0197907_107065472 | 161 |
| 143 | 3300020070 | Ga0206356_11847643 | Ga0206356_118476432 | 161 |
| 144 | 3300020076 | Ga0206355_1577345 | Ga0206355_15773452 | 161 |
| 145 | 3300020078 | Ga0206352_11166897 | Ga0206352_111668972 | 161 |
| 146 | 3300020080 | Ga0206350_10230214 | Ga0206350_102302142 | 161 |
| 147 | 3300020081 | Ga0206354_11317698 | Ga0206354_113176983 | 161 |
| 148 | 3300020082 | Ga0206353_11792761 | Ga0206353_117927613 | 161 |
| 149 | 3300022467 | Ga0224712_10154541 | Ga0224712_101545412 | 161 |
| 150 | 3300022467 | Ga0224712_10341565 | Ga0224712_103415651 | 161 |
| 151 | 3300025912 | Ga0207707_10003061 | Ga0207707_100030614 | 161 |
| 152 | 3300025912 | Ga0207707_10032019 | Ga0207707_100320193 | 161 |
| 153 | 3300025912 | Ga0207707_10637388 | Ga0207707_106373882 | 161 |
| 154 | 3300025913 | Ga0207695_10002651 | Ga0207695_100026514 | 161 |
| 155 | 3300025913 | Ga0207695_10032703 | Ga0207695_100327034 | 161 |
| 156 | 3300025914 | Ga0207671_10418040 | Ga0207671_104180402 | 161 |
| 157 | 3300025917 | Ga0207660_10230448 | Ga0207660_102304482 | 161 |
| 158 | 3300025919 | Ga0207657_10062691 | Ga0207657_100626914 | 161 |
| 159 | 3300025920 | Ga0207649_10124688 | Ga0207649_101246882 | 161 |
| 160 | 3300025921 | Ga0207652_10003734 | Ga0207652_100037343 | 161 |
| 161 | 3300025921 | Ga0207652_10113015 | Ga0207652_101130153 | 161 |
| 162 | 3300025924 | Ga0207694_10717788 | Ga0207694_107177882 | 161 |
| 163 | 3300025929 | Ga0207664_10016765 | Ga0207664_100167654 | 161 |
| 164 | 3300025929 | Ga0207664_10743126 | Ga0207664_107431262 | 161 |
| 165 | 3300025944 | Ga0207661_10314158 | Ga0207661_103141582 | 161 |
| 166 | 3300025945 | Ga0207679_10087897 | Ga0207679_100878971 | 161 |
| 167 | 3300025949 | Ga0207667_10353564 | Ga0207667_103535642 | 161 |
| 168 | 3300025961 | Ga0207712_10349153 | Ga0207712_103491531 | 161 |
| 169 | 3300025961 | Ga0207712_11021289 | Ga0207712_110212891 | 161 |
| 170 | 3300026078 | Ga0207702_10216141 | Ga0207702_102161412 | 161 |
| 171 | 3300026116 | Ga0207674_10335219 | Ga0207674_103352192 | 161 |
| 172 | 3300026118 | Ga0207675_100366281 | Ga0207675_1003662811 | 161 |
| 173 | 3300027907 | Ga0207428_10350777 | Ga0207428_103507772 | 161 |
| 174 | 3300028380 | Ga0268265_10365737 | Ga0268265_103657371 | 161 |
| 175 | 3300031731 | Ga0307405_10007099 | Ga0307405_100070993 | 161 |
| 176 | 3300031824 | Ga0307413_10295718 | Ga0307413_102957182 | 161 |
| 177 | 3300031852 | Ga0307410_10000129 | Ga0307410_100001298 | 161 |
| 178 | 3300031901 | Ga0307406_10002422 | Ga0307406_100024224 | 161 |
| 179 | 3300031995 | Ga0307409_100000079 | Ga0307409_10000007915 | 161 |
| 180 | 3300032002 | Ga0307416_100004690 | Ga0307416_1000046902 | 161 |
| 181 | 3300032004 | Ga0307414_10004632 | Ga0307414_100046326 | 161 |
| 182 | 3300032126 | Ga0307415_100061777 | Ga0307415_1000617772 | 161 |
| 183 | 3300044842 | Ga0466957_1043298 | Ga0466957_1043298_43_543 | 161 |
| 184 | 3300048913 | Ga0496110_1399891 | Ga0496110_1399891_89_592 | 161 |
| 185 | 3300049160 | Ga0501304_038154 | Ga0501304_038154_18_509 | 161 |
| 186 | 3300050507 | nmdc:mga05p37_554551_c1 | nmdc:mga05p37_554551_c1_170_658 | 161 |
| 187 | 3300050511 | nmdc:mga08y16_59257_c1 | nmdc:mga08y16_59257_c1_2022_2510 | 161 |
| 188 | 3300050514 | nmdc:mga08x19_19436_c1 | nmdc:mga08x19_19436_c1_371_862 | 161 |
| 189 | 3300050514 | nmdc:mga08x19_215250_c1 | nmdc:mga08x19_215250_c1_530_1021 | 161 |
| 190 | 3300050515 | nmdc:mga0a205_185077_c1 | nmdc:mga0a205_185077_c1_1148_1636 | 161 |
| 191 | 3300059477 | Ga0587084_013505 | Ga0587084_013505_487_978 | 161 |
| 192 | 3300059490 | Ga0587066_014044 | Ga0587066_014044_149_640 | 161 |
| 193 | 3300059491 | Ga0587070_047361 | Ga0587070_047361_331_834 | 161 |
| 194 | 3300059491 | Ga0587070_076424 | Ga0587070_076424_72_563 | 161 |
| 195 | 3300059493 | Ga0587077_019083 | Ga0587077_019083_146_637 | 161 |
| 196 | 3300059503 | Ga0587080_017725 | Ga0587080_017725_520_1011 | 161 |
| 197 | 3300059504 | Ga0587082_013629 | Ga0587082_013629_677_1168 | 161 |
| 198 | 3300059505 | Ga0587083_0008362 | Ga0587083_0008362_198_689 | 161 |
| 199 | 3300059508 | Ga0587088_010172 | Ga0587088_010172_197_688 | 161 |
| 200 | 3300059509 | Ga0587089_026175 | Ga0587089_026175_131_622 | 161 |
| 201 | 3300059510 | Ga0587090_014984 | Ga0587090_014984_147_638 | 161 |
| 202 | 3300059511 | Ga0587091_020249 | Ga0587091_020249_518_1009 | 161 |
| 203 | 3300059512 | Ga0587092_015765 | Ga0587092_015765_492_983 | 161 |
| 204 | 3300059513 | Ga0587094_010459 | Ga0587094_010459_196_687 | 161 |
| 205 | 3300059605 | Ga0587106_047487 | Ga0587106_047487_89_580 | 161 |
| 206 | 3300059630 | Ga0587128_086704 | Ga0587128_086704_57_548 | 161 |
| 207 | 3300059644 | Ga0587075_012539 | Ga0587075_012539_531_1022 | 161 |
| 208 | 3300059645 | Ga0587076_104102 | Ga0587076_104102_61_552 | 161 |
| 209 | 3300059647 | Ga0587079_000838 | Ga0587079_000838_2415_2906 | 161 |
| 210 | 3300059652 | Ga0587107_006324 | Ga0587107_006324_201_692 | 161 |
| 211 | 3300060344 | Ga0587071_015825 | Ga0587071_015825_147_638 | 161 |
| 212 | 3300060346 | Ga0587111_0017988 | Ga0587111_0017988_687_1178 | 161 |
| 213 | 3300003323 | rootH1_10223371 | rootH1_102233712 | 162 |
| 214 | 3300004799 | Ga0058863_10043916 | Ga0058863_100439161 | 162 |
| 215 | 3300004799 | Ga0058863_11250156 | Ga0058863_112501561 | 162 |
| 216 | 3300004800 | Ga0058861_10880106 | Ga0058861_108801062 | 162 |
| 217 | 3300004800 | Ga0058861_12030534 | Ga0058861_120305341 | 162 |
| 218 | 3300004803 | Ga0058862_12675497 | Ga0058862_126754972 | 162 |
| 219 | 3300004803 | Ga0058862_12811295 | Ga0058862_128112951 | 162 |
| 220 | 3300005336 | Ga0070680_100005343 | Ga0070680_1000053436 | 162 |
| 221 | 3300005339 | Ga0070660_100804223 | Ga0070660_1008042231 | 162 |
| 222 | 3300005530 | Ga0070679_100017382 | Ga0070679_1000173822 | 162 |
| 223 | 3300005530 | Ga0070679_100095790 | Ga0070679_1000957903 | 162 |
| 224 | 3300005563 | Ga0068855_100023427 | Ga0068855_1000234276 | 162 |
| 225 | 3300005616 | Ga0068852_100084681 | Ga0068852_1000846812 | 162 |
| 226 | 3300006186 | Ga0075369_10013690 | Ga0075369_100136902 | 162 |
| 227 | 3300013104 | Ga0157370_10002945 | Ga0157370_1000294514 | 162 |
| 228 | 3300013105 | Ga0157369_10037789 | Ga0157369_100377892 | 162 |
| 229 | 3300013307 | Ga0157372_10154293 | Ga0157372_101542932 | 162 |
| 230 | 3300020069 | Ga0197907_11348615 | Ga0197907_113486155 | 162 |
| 231 | 3300020075 | Ga0206349_1352915 | Ga0206349_13529152 | 162 |
| 232 | 3300020076 | Ga0206355_1576845 | Ga0206355_15768452 | 162 |
| 233 | 3300020077 | Ga0206351_10048966 | Ga0206351_100489662 | 162 |
| 234 | 3300020078 | Ga0206352_10174033 | Ga0206352_101740332 | 162 |
| 235 | 3300020080 | Ga0206350_10156355 | Ga0206350_101563551 | 162 |
| 236 | 3300020081 | Ga0206354_10852653 | Ga0206354_108526531 | 162 |
| 237 | 3300020082 | Ga0206353_10877890 | Ga0206353_108778901 | 162 |
| 238 | 3300022467 | Ga0224712_10057958 | Ga0224712_100579582 | 162 |
| 239 | 3300025917 | Ga0207660_10039206 | Ga0207660_100392062 | 162 |
| 240 | 3300025919 | Ga0207657_10535229 | Ga0207657_105352292 | 162 |
| 241 | 3300025921 | Ga0207652_10147492 | Ga0207652_101474923 | 162 |
| 242 | 3300025949 | Ga0207667_10022089 | Ga0207667_100220896 | 162 |
| 243 | 3300026142 | Ga0207698_10015930 | Ga0207698_100159307 | 162 |
| 244 | 3300030521 | Ga0307511_10000295 | Ga0307511_1000029510 | 162 |
| 245 | 3300030521 | Ga0307511_10000379 | Ga0307511_1000037950 | 162 |
| 246 | 3300031251 | Ga0265327_10133739 | Ga0265327_101337392 | 162 |
| 247 | 3300037312 | Ga0395899_0614480 | Ga0395899_0614480_78_587 | 162 |
| 248 | 3300044694 | Ga0466963_0242654 | Ga0466963_0242654_46_555 | 162 |
| 249 | 3300045976 | Ga0466967_0081391 | Ga0466967_0081391_64_573 | 162 |
| 250 | 3300049527 | Ga0501311_035920 | Ga0501311_035920_24_521 | 162 |
| 251 | 3300050516 | nmdc:mga0sz30_14723_c1 | nmdc:mga0sz30_14723_c1_1490_1981 | 162 |
| 252 | 3300053090 | Ga0500646_0002211 | Ga0500646_0002211_1993_2484 | 162 |
| 253 | 3300053133 | Ga0500655_015196 | Ga0500655_015196_327_818 | 162 |
| 254 | 3300053139 | Ga0500568_0038706 | Ga0500568_0038706_422_913 | 162 |
| 255 | 3300053151 | Ga0500604_0006628 | Ga0500604_0006628_1163_1654 | 162 |
| 256 | 3300053153 | Ga0500616_0031076 | Ga0500616_0031076_2306_2797 | 162 |
| 257 | 3300059503 | Ga0587080_031076 | Ga0587080_031076_266_775 | 162 |
| 258 | 3300059504 | Ga0587082_009145 | Ga0587082_009145_157_666 | 162 |
| 259 | 3300059505 | Ga0587083_0004065 | Ga0587083_0004065_938_1432 | 162 |
| 260 | 3300059506 | Ga0587085_005279 | Ga0587085_005279_215_709 | 162 |
| 261 | 3300059605 | Ga0587106_015741 | Ga0587106_015741_396_905 | 162 |
| 262 | 3300059645 | Ga0587076_021116 | Ga0587076_021116_141_635 | 162 |
| 263 | 3300059646 | Ga0587078_007923 | Ga0587078_007923_431_940 | 162 |
| 264 | 3300059646 | Ga0587078_044305 | Ga0587078_044305_37_531 | 162 |
| 265 | 3300059646 | Ga0587078_050147 | Ga0587078_050147_58_558 | 162 |
| 266 | 3300060344 | Ga0587071_001679 | Ga0587071_001679_1176_1685 | 162 |
| 267 | 3300004799 | Ga0058863_11768152 | Ga0058863_117681522 | 163 |
| 268 | 3300004799 | Ga0058863_11879184 | Ga0058863_118791842 | 163 |
| 269 | 3300004800 | Ga0058861_10055520 | Ga0058861_100555201 | 163 |
| 270 | 3300004800 | Ga0058861_11851212 | Ga0058861_118512123 | 163 |
| 271 | 3300004803 | Ga0058862_12462831 | Ga0058862_124628312 | 163 |
| 272 | 3300004803 | Ga0058862_12789120 | Ga0058862_127891202 | 163 |
| 273 | 3300004803 | Ga0058862_12863375 | Ga0058862_128633751 | 163 |
| 274 | 3300005458 | Ga0070681_11584414 | Ga0070681_115844141 | 163 |
| 275 | 3300005530 | Ga0070679_100136163 | Ga0070679_1001361632 | 163 |
| 276 | 3300020070 | Ga0206356_11816379 | Ga0206356_118163792 | 163 |
| 277 | 3300021384 | Ga0213876_10007122 | Ga0213876_100071225 | 163 |
| 278 | 3300025921 | Ga0207652_10211811 | Ga0207652_102118112 | 163 |
| 279 | 3300031824 | Ga0307413_11741431 | Ga0307413_117414311 | 163 |
| 280 | 3300031995 | Ga0307409_100518130 | Ga0307409_1005181302 | 163 |
| 281 | 3300032002 | Ga0307416_100842966 | Ga0307416_1008429661 | 163 |
| 282 | 3300039437 | Ga0436365_0152204 | Ga0436365_0152204_17146_17640 | 163 |
| 283 | 3300039437 | Ga0436365_0289034 | Ga0436365_0289034_123_620 | 163 |
| 284 | 3300039450 | Ga0436363_0488288 | Ga0436363_0488288_155_655 | 163 |
| 285 | 3300059490 | Ga0587066_008238 | Ga0587066_008238_130_630 | 163 |
| 286 | 3300059490 | Ga0587066_052377 | Ga0587066_052377_16_516 | 163 |
| 287 | 3300059491 | Ga0587070_011739 | Ga0587070_011739_36_536 | 163 |
| 288 | 3300059491 | Ga0587070_124662 | Ga0587070_124662_92_607 | 163 |
| 289 | 3300059493 | Ga0587077_049869 | Ga0587077_049869_34_534 | 163 |
| 290 | 3300059493 | Ga0587077_062594 | Ga0587077_062594_51_551 | 163 |
| 291 | 3300059505 | Ga0587083_0099509 | Ga0587083_0099509_34_534 | 163 |
| 292 | 3300059506 | Ga0587085_008289 | Ga0587085_008289_556_1056 | 163 |
| 293 | 3300059506 | Ga0587085_047530 | Ga0587085_047530_119_619 | 163 |
| 294 | 3300059507 | Ga0587086_030788 | Ga0587086_030788_48_548 | 163 |
| 295 | 3300059511 | Ga0587091_016977 | Ga0587091_016977_549_1049 | 163 |
| 296 | 3300059512 | Ga0587092_016062 | Ga0587092_016062_56_556 | 163 |
| 297 | 3300059513 | Ga0587094_034167 | Ga0587094_034167_232_732 | 163 |
| 298 | 3300059605 | Ga0587106_022988 | Ga0587106_022988_231_731 | 163 |
| 299 | 3300059607 | Ga0587125_011741 | Ga0587125_011741_160_660 | 163 |
| 300 | 3300059623 | Ga0587101_025031 | Ga0587101_025031_35_535 | 163 |
| 301 | 3300059624 | Ga0587109_013958 | Ga0587109_013958_270_770 | 163 |
| 302 | 3300059624 | Ga0587109_056521 | Ga0587109_056521_189_689 | 163 |
| 303 | 3300059626 | Ga0587115_024954 | Ga0587115_024954_136_636 | 163 |
| 304 | 3300059627 | Ga0587117_018263 | Ga0587117_018263_244_744 | 163 |
| 305 | 3300059627 | Ga0587117_025262 | Ga0587117_025262_153_653 | 163 |
| 306 | 3300059639 | Ga0587062_021049 | Ga0587062_021049_405_905 | 163 |
| 307 | 3300059640 | Ga0587067_183804 | Ga0587067_183804_17_511 | 163 |
| 308 | 3300059641 | Ga0587068_053639 | Ga0587068_053639_40_540 | 163 |
| 309 | 3300059645 | Ga0587076_058408 | Ga0587076_058408_203_703 | 163 |
| 310 | 3300059649 | Ga0587102_022410 | Ga0587102_022410_34_534 | 163 |
| 311 | 3300060346 | Ga0587111_0078762 | Ga0587111_0078762_159_662 | 163 |
| 312 | 3300002070 | JGI24750J21931_1017266 | JGI24750J21931_10172662 | 164 |
| 313 | 3300002126 | JGI24035J26624_1036463 | JGI24035J26624_10364631 | 164 |
| 314 | 3300003163 | Ga0006759J45824_1030530 | Ga0006759J45824_10305301 | 164 |
| 315 | 3300004798 | Ga0058859_10002689 | Ga0058859_100026892 | 164 |
| 316 | 3300004799 | Ga0058863_11600567 | Ga0058863_116005671 | 164 |
| 317 | 3300004799 | Ga0058863_11692573 | Ga0058863_116925731 | 164 |
| 318 | 3300004800 | Ga0058861_10021285 | Ga0058861_100212852 | 164 |
| 319 | 3300004800 | Ga0058861_11678193 | Ga0058861_116781931 | 164 |
| 320 | 3300004801 | Ga0058860_11827503 | Ga0058860_118275031 | 164 |
| 321 | 3300004803 | Ga0058862_12602324 | Ga0058862_126023242 | 164 |
| 322 | 3300004803 | Ga0058862_12826774 | Ga0058862_128267742 | 164 |
| 323 | 3300005293 | Ga0065715_10213561 | Ga0065715_102135612 | 164 |
| 324 | 3300005295 | Ga0065707_10411715 | Ga0065707_104117152 | 164 |
| 325 | 3300005327 | Ga0070658_10476286 | Ga0070658_104762862 | 164 |
| 326 | 3300005327 | Ga0070658_10823848 | Ga0070658_108238481 | 164 |
| 327 | 3300005327 | Ga0070658_11430995 | Ga0070658_114309951 | 164 |
| 328 | 3300005328 | Ga0070676_10006828 | Ga0070676_100068283 | 164 |
| 329 | 3300005329 | Ga0070683_100032368 | Ga0070683_1000323682 | 164 |
| 330 | 3300005329 | Ga0070683_100074274 | Ga0070683_1000742742 | 164 |
| 331 | 3300005330 | Ga0070690_100112985 | Ga0070690_1001129852 | 164 |
| 332 | 3300005331 | Ga0070670_100097790 | Ga0070670_1000977903 | 164 |
| 333 | 3300005331 | Ga0070670_100673358 | Ga0070670_1006733582 | 164 |
| 334 | 3300005334 | Ga0068869_100044414 | Ga0068869_1000444142 | 164 |
| 335 | 3300005336 | Ga0070680_100084812 | Ga0070680_1000848123 | 164 |
| 336 | 3300005337 | Ga0070682_100259043 | Ga0070682_1002590432 | 164 |
| 337 | 3300005338 | Ga0068868_100032896 | Ga0068868_1000328964 | 164 |
| 338 | 3300005338 | Ga0068868_100332572 | Ga0068868_1003325722 | 164 |
| 339 | 3300005339 | Ga0070660_100009773 | Ga0070660_1000097735 | 164 |
| 340 | 3300005339 | Ga0070660_100343778 | Ga0070660_1003437782 | 164 |
| 341 | 3300005340 | Ga0070689_100005824 | Ga0070689_1000058243 | 164 |
| 342 | 3300005343 | Ga0070687_100000855 | Ga0070687_1000008557 | 164 |
| 343 | 3300005344 | Ga0070661_100002293 | Ga0070661_1000022933 | 164 |
| 344 | 3300005344 | Ga0070661_100372414 | Ga0070661_1003724142 | 164 |
| 345 | 3300005345 | Ga0070692_10063304 | Ga0070692_100633043 | 164 |
| 346 | 3300005345 | Ga0070692_10294959 | Ga0070692_102949591 | 164 |
| 347 | 3300005347 | Ga0070668_100016538 | Ga0070668_1000165383 | 164 |
| 348 | 3300005353 | Ga0070669_100011724 | Ga0070669_1000117245 | 164 |
| 349 | 3300005354 | Ga0070675_100015280 | Ga0070675_1000152803 | 164 |
| 350 | 3300005354 | Ga0070675_100544511 | Ga0070675_1005445111 | 164 |
| 351 | 3300005355 | Ga0070671_100313880 | Ga0070671_1003138802 | 164 |
| 352 | 3300005355 | Ga0070671_100786648 | Ga0070671_1007866482 | 164 |
| 353 | 3300005356 | Ga0070674_100030942 | Ga0070674_1000309423 | 164 |
| 354 | 3300005356 | Ga0070674_100184007 | Ga0070674_1001840072 | 164 |
| 355 | 3300005364 | Ga0070673_100002971 | Ga0070673_1000029712 | 164 |
| 356 | 3300005365 | Ga0070688_100217115 | Ga0070688_1002171152 | 164 |
| 357 | 3300005366 | Ga0070659_100012262 | Ga0070659_1000122623 | 164 |
| 358 | 3300005367 | Ga0070667_100011965 | Ga0070667_1000119655 | 164 |
| 359 | 3300005367 | Ga0070667_101178817 | Ga0070667_1011788171 | 164 |
| 360 | 3300005434 | Ga0070709_10217762 | Ga0070709_102177622 | 164 |
| 361 | 3300005438 | Ga0070701_10013570 | Ga0070701_100135703 | 164 |
| 362 | 3300005439 | Ga0070711_100225703 | Ga0070711_1002257033 | 164 |
| 363 | 3300005441 | Ga0070700_100176697 | Ga0070700_1001766972 | 164 |
| 364 | 3300005444 | Ga0070694_100050722 | Ga0070694_1000507223 | 164 |
| 365 | 3300005455 | Ga0070663_100011509 | Ga0070663_1000115094 | 164 |
| 366 | 3300005457 | Ga0070662_100701124 | Ga0070662_1007011241 | 164 |
| 367 | 3300005458 | Ga0070681_10000138 | Ga0070681_1000013835 | 164 |
| 368 | 3300005459 | Ga0068867_100013811 | Ga0068867_1000138113 | 164 |
| 369 | 3300005459 | Ga0068867_100447335 | Ga0068867_1004473351 | 164 |
| 370 | 3300005466 | Ga0070685_10010771 | Ga0070685_100107712 | 164 |
| 371 | 3300005530 | Ga0070679_100048201 | Ga0070679_1000482013 | 164 |
| 372 | 3300005535 | Ga0070684_100023416 | Ga0070684_1000234163 | 164 |
| 373 | 3300005535 | Ga0070684_100071222 | Ga0070684_1000712222 | 164 |
| 374 | 3300005539 | Ga0068853_100012448 | Ga0068853_1000124482 | 164 |
| 375 | 3300005543 | Ga0070672_100011732 | Ga0070672_1000117325 | 164 |
| 376 | 3300005543 | Ga0070672_101070864 | Ga0070672_1010708641 | 164 |
| 377 | 3300005545 | Ga0070695_100124582 | Ga0070695_1001245822 | 164 |
| 378 | 3300005547 | Ga0070693_100268818 | Ga0070693_1002688182 | 164 |
| 379 | 3300005548 | Ga0070665_100069054 | Ga0070665_1000690542 | 164 |
| 380 | 3300005549 | Ga0070704_100328776 | Ga0070704_1003287762 | 164 |
| 381 | 3300005563 | Ga0068855_100450395 | Ga0068855_1004503952 | 164 |
| 382 | 3300005564 | Ga0070664_100018191 | Ga0070664_1000181913 | 164 |
| 383 | 3300005564 | Ga0070664_102045798 | Ga0070664_1020457981 | 164 |
| 384 | 3300005577 | Ga0068857_100006328 | Ga0068857_1000063289 | 164 |
| 385 | 3300005577 | Ga0068857_100047331 | Ga0068857_1000473312 | 164 |
| 386 | 3300005578 | Ga0068854_100005214 | Ga0068854_1000052147 | 164 |
| 387 | 3300005615 | Ga0070702_100061349 | Ga0070702_1000613492 | 164 |
| 388 | 3300005616 | Ga0068852_100009334 | Ga0068852_1000093345 | 164 |
| 389 | 3300005616 | Ga0068852_100224043 | Ga0068852_1002240431 | 164 |
| 390 | 3300005616 | Ga0068852_100502219 | Ga0068852_1005022192 | 164 |
| 391 | 3300005617 | Ga0068859_100016780 | Ga0068859_1000167802 | 164 |
| 392 | 3300005618 | Ga0068864_100047063 | Ga0068864_1000470633 | 164 |
| 393 | 3300005618 | Ga0068864_100479288 | Ga0068864_1004792881 | 164 |
| 394 | 3300005718 | Ga0068866_10147712 | Ga0068866_101477122 | 164 |
| 395 | 3300005719 | Ga0068861_100022754 | Ga0068861_1000227543 | 164 |
| 396 | 3300005834 | Ga0068851_10051220 | Ga0068851_100512202 | 164 |
| 397 | 3300005834 | Ga0068851_10246283 | Ga0068851_102462832 | 164 |
| 398 | 3300005841 | Ga0068863_100007854 | Ga0068863_1000078547 | 164 |
| 399 | 3300005842 | Ga0068858_100030490 | Ga0068858_1000304903 | 164 |
| 400 | 3300005843 | Ga0068860_100064974 | Ga0068860_1000649742 | 164 |
| 401 | 3300005844 | Ga0068862_100063715 | Ga0068862_1000637153 | 164 |
| 402 | 3300006175 | Ga0070712_100020282 | Ga0070712_1000202823 | 164 |
| 403 | 3300006237 | Ga0097621_100673004 | Ga0097621_1006730042 | 164 |
| 404 | 3300006358 | Ga0068871_100577132 | Ga0068871_1005771321 | 164 |
| 405 | 3300006846 | Ga0075430_100002899 | Ga0075430_1000028998 | 164 |
| 406 | 3300006852 | Ga0075433_10257013 | Ga0075433_102570131 | 164 |
| 407 | 3300006871 | Ga0075434_100009939 | Ga0075434_1000099392 | 164 |
| 408 | 3300006881 | Ga0068865_100003660 | Ga0068865_1000036603 | 164 |
| 409 | 3300006931 | Ga0097620_100016780 | Ga0097620_1000167802 | 164 |
| 410 | 3300007076 | Ga0075435_100305827 | Ga0075435_1003058272 | 164 |
| 411 | 3300009093 | Ga0105240_10969627 | Ga0105240_109696272 | 164 |
| 412 | 3300009098 | Ga0105245_10143363 | Ga0105245_101433633 | 164 |
| 413 | 3300009101 | Ga0105247_10358408 | Ga0105247_103584082 | 164 |
| 414 | 3300009147 | Ga0114129_10162678 | Ga0114129_101626783 | 164 |
| 415 | 3300009176 | Ga0105242_10013791 | Ga0105242_100137914 | 164 |
| 416 | 3300009176 | Ga0105242_10470888 | Ga0105242_104708882 | 164 |
| 417 | 3300009177 | Ga0105248_10240729 | Ga0105248_102407292 | 164 |
| 418 | 3300009177 | Ga0105248_12138956 | Ga0105248_121389561 | 164 |
| 419 | 3300009545 | Ga0105237_10476559 | Ga0105237_104765592 | 164 |
| 420 | 3300009553 | Ga0105249_10007447 | Ga0105249_100074472 | 164 |
| 421 | 3300010375 | Ga0105239_10051269 | Ga0105239_100512693 | 164 |
| 422 | 3300013100 | Ga0157373_10521256 | Ga0157373_105212562 | 164 |
| 423 | 3300013100 | Ga0157373_10715023 | Ga0157373_107150231 | 164 |
| 424 | 3300013102 | Ga0157371_10017291 | Ga0157371_100172912 | 164 |
| 425 | 3300013105 | Ga0157369_10244768 | Ga0157369_102447682 | 164 |
| 426 | 3300013296 | Ga0157374_10182715 | Ga0157374_101827152 | 164 |
| 427 | 3300013297 | Ga0157378_10041350 | Ga0157378_100413502 | 164 |
| 428 | 3300013306 | Ga0163162_10018823 | Ga0163162_100188233 | 164 |
| 429 | 3300013307 | Ga0157372_10178593 | Ga0157372_101785933 | 164 |
| 430 | 3300013308 | Ga0157375_10010504 | Ga0157375_100105046 | 164 |
| 431 | 3300014325 | Ga0163163_10267348 | Ga0163163_102673482 | 164 |
| 432 | 3300014326 | Ga0157380_10150703 | Ga0157380_101507032 | 164 |
| 433 | 3300014745 | Ga0157377_10063072 | Ga0157377_100630722 | 164 |
| 434 | 3300014968 | Ga0157379_10003198 | Ga0157379_100031983 | 164 |
| 435 | 3300017792 | Ga0163161_10186493 | Ga0163161_101864932 | 164 |
| 436 | 3300021384 | Ga0213876_10021352 | Ga0213876_100213522 | 164 |
| 437 | 3300025315 | Ga0207697_10005846 | Ga0207697_100058464 | 164 |
| 438 | 3300025321 | Ga0207656_10011296 | Ga0207656_100112963 | 164 |
| 439 | 3300025899 | Ga0207642_10043919 | Ga0207642_100439192 | 164 |
| 440 | 3300025900 | Ga0207710_10482636 | Ga0207710_104826361 | 164 |
| 441 | 3300025901 | Ga0207688_10035092 | Ga0207688_100350922 | 164 |
| 442 | 3300025904 | Ga0207647_10048946 | Ga0207647_100489463 | 164 |
| 443 | 3300025906 | Ga0207699_10498285 | Ga0207699_104982851 | 164 |
| 444 | 3300025907 | Ga0207645_10000786 | Ga0207645_1000078617 | 164 |
| 445 | 3300025909 | Ga0207705_10354427 | Ga0207705_103544272 | 164 |
| 446 | 3300025911 | Ga0207654_10461931 | Ga0207654_104619312 | 164 |
| 447 | 3300025912 | Ga0207707_10039094 | Ga0207707_100390944 | 164 |
| 448 | 3300025913 | Ga0207695_10846718 | Ga0207695_108467182 | 164 |
| 449 | 3300025916 | Ga0207663_10150106 | Ga0207663_101501062 | 164 |
| 450 | 3300025917 | Ga0207660_10279080 | Ga0207660_102790802 | 164 |
| 451 | 3300025918 | Ga0207662_10001813 | Ga0207662_100018137 | 164 |
| 452 | 3300025919 | Ga0207657_10049205 | Ga0207657_100492053 | 164 |
| 453 | 3300025919 | Ga0207657_10747855 | Ga0207657_107478552 | 164 |
| 454 | 3300025920 | Ga0207649_10008483 | Ga0207649_100084833 | 164 |
| 455 | 3300025920 | Ga0207649_10014851 | Ga0207649_100148514 | 164 |
| 456 | 3300025921 | Ga0207652_10067380 | Ga0207652_100673803 | 164 |
| 457 | 3300025923 | Ga0207681_10013302 | Ga0207681_100133025 | 164 |
| 458 | 3300025925 | Ga0207650_10015220 | Ga0207650_100152202 | 164 |
| 459 | 3300025926 | Ga0207659_10046573 | Ga0207659_100465732 | 164 |
| 460 | 3300025927 | Ga0207687_11009218 | Ga0207687_110092182 | 164 |
| 461 | 3300025931 | Ga0207644_10536114 | Ga0207644_105361142 | 164 |
| 462 | 3300025932 | Ga0207690_10027238 | Ga0207690_100272381 | 164 |
| 463 | 3300025932 | Ga0207690_10114423 | Ga0207690_101144232 | 164 |
| 464 | 3300025933 | Ga0207706_10000699 | Ga0207706_100006998 | 164 |
| 465 | 3300025934 | Ga0207686_10069220 | Ga0207686_100692203 | 164 |
| 466 | 3300025936 | Ga0207670_10089422 | Ga0207670_100894223 | 164 |
| 467 | 3300025937 | Ga0207669_10118050 | Ga0207669_101180503 | 164 |
| 468 | 3300025937 | Ga0207669_11037025 | Ga0207669_110370252 | 164 |
| 469 | 3300025938 | Ga0207704_10074271 | Ga0207704_100742712 | 164 |
| 470 | 3300025940 | Ga0207691_10000620 | Ga0207691_1000062025 | 164 |
| 471 | 3300025940 | Ga0207691_10834149 | Ga0207691_108341491 | 164 |
| 472 | 3300025941 | Ga0207711_10067035 | Ga0207711_100670353 | 164 |
| 473 | 3300025942 | Ga0207689_10004256 | Ga0207689_100042563 | 164 |
| 474 | 3300025944 | Ga0207661_10039298 | Ga0207661_100392982 | 164 |
| 475 | 3300025944 | Ga0207661_10072452 | Ga0207661_100724522 | 164 |
| 476 | 3300025945 | Ga0207679_10005170 | Ga0207679_100051701 | 164 |
| 477 | 3300025945 | Ga0207679_10007499 | Ga0207679_100074993 | 164 |
| 478 | 3300025949 | Ga0207667_10643536 | Ga0207667_106435362 | 164 |
| 479 | 3300025960 | Ga0207651_10022256 | Ga0207651_100222563 | 164 |
| 480 | 3300025961 | Ga0207712_10013819 | Ga0207712_100138195 | 164 |
| 481 | 3300025972 | Ga0207668_10023108 | Ga0207668_100231083 | 164 |
| 482 | 3300025981 | Ga0207640_10055318 | Ga0207640_100553182 | 164 |
| 483 | 3300025986 | Ga0207658_10036477 | Ga0207658_100364773 | 164 |
| 484 | 3300026023 | Ga0207677_10025641 | Ga0207677_100256412 | 164 |
| 485 | 3300026035 | Ga0207703_10060471 | Ga0207703_100604712 | 164 |
| 486 | 3300026041 | Ga0207639_10088322 | Ga0207639_100883222 | 164 |
| 487 | 3300026041 | Ga0207639_10765249 | Ga0207639_107652491 | 164 |
| 488 | 3300026067 | Ga0207678_10019269 | Ga0207678_100192693 | 164 |
| 489 | 3300026075 | Ga0207708_10010733 | Ga0207708_100107336 | 164 |
| 490 | 3300026088 | Ga0207641_10010432 | Ga0207641_100104323 | 164 |
| 491 | 3300026089 | Ga0207648_10041362 | Ga0207648_100413623 | 164 |
| 492 | 3300026089 | Ga0207648_10153056 | Ga0207648_101530563 | 164 |
| 493 | 3300026089 | Ga0207648_10481573 | Ga0207648_104815732 | 164 |
| 494 | 3300026116 | Ga0207674_10000562 | Ga0207674_1000056216 | 164 |
| 495 | 3300026118 | Ga0207675_100000109 | Ga0207675_10000010923 | 164 |
| 496 | 3300026142 | Ga0207698_10114329 | Ga0207698_101143292 | 164 |
| 497 | 3300026142 | Ga0207698_10526437 | Ga0207698_105264372 | 164 |
| 498 | 3300028379 | Ga0268266_10454885 | Ga0268266_104548851 | 164 |
| 499 | 3300028379 | Ga0268266_10889769 | Ga0268266_108897692 | 164 |
| 500 | 3300028380 | Ga0268265_10028860 | Ga0268265_100288602 | 164 |
| 501 | 3300028381 | Ga0268264_10048178 | Ga0268264_100481783 | 164 |
| 502 | 3300028800 | Ga0265338_10009700 | Ga0265338_100097006 | 164 |
| 503 | 3300031548 | Ga0307408_100019238 | Ga0307408_1000192384 | 164 |
| 504 | 3300031731 | Ga0307405_10076143 | Ga0307405_100761432 | 164 |
| 505 | 3300031814 | Ga0247548_100357 | Ga0247548_1003571 | 164 |
| 506 | 3300031824 | Ga0307413_10007449 | Ga0307413_100074493 | 164 |
| 507 | 3300031824 | Ga0307413_10071926 | Ga0307413_100719262 | 164 |
| 508 | 3300031852 | Ga0307410_10091101 | Ga0307410_100911013 | 164 |
| 509 | 3300031901 | Ga0307406_10000417 | Ga0307406_1000041710 | 164 |
| 510 | 3300031995 | Ga0307409_100186168 | Ga0307409_1001861683 | 164 |
| 511 | 3300032002 | Ga0307416_100157367 | Ga0307416_1001573672 | 164 |
| 512 | 3300032004 | Ga0307414_10186463 | Ga0307414_101864632 | 164 |
| 513 | 3300032126 | Ga0307415_100071208 | Ga0307415_1000712083 | 164 |
| 514 | 3300037471 | Ga0395905_0440733 | Ga0395905_0440733_677_1171 | 164 |
| 515 | 3300037853 | Ga0436364_0188943 | Ga0436364_0188943_538_1062 | 164 |
| 516 | 3300037853 | Ga0436364_1280777 | Ga0436364_1280777_271_768 | 164 |
| 517 | 3300039437 | Ga0436365_0924513 | Ga0436365_0924513_1645_2142 | 164 |
| 518 | 3300039437 | Ga0436365_1852273 | Ga0436365_1852273_381_905 | 164 |
| 519 | 3300044842 | Ga0466957_0231401 | Ga0466957_0231401_573_1091 | 164 |
| 520 | 3300045051 | Ga0451576_0039203 | Ga0451576_0039203_2244_2738 | 164 |
| 521 | 3300045976 | Ga0466967_0276881 | Ga0466967_0276881_502_1020 | 164 |
| 522 | 3300046459 | Ga0495629_0088645 | Ga0495629_0088645_826_1320 | 164 |
| 523 | 3300046473 | Ga0495582_0125473 | Ga0495582_0125473_592_1086 | 164 |
| 524 | 3300046475 | Ga0495639_0473394 | Ga0495639_0473394_27_521 | 164 |
| 525 | 3300046539 | Ga0495621_0308776 | Ga0495621_0308776_62_556 | 164 |
| 526 | 3300046683 | Ga0495658_0048593 | Ga0495658_0048593_1189_1683 | 164 |
| 527 | 3300046691 | Ga0495670_0245840 | Ga0495670_0245840_77_571 | 164 |
| 528 | 3300048909 | Ga0496106_0382309 | Ga0496106_0382309_75_569 | 164 |
| 529 | 3300048912 | Ga0496109_0072961 | Ga0496109_0072961_2470_2964 | 164 |
| 530 | 3300048916 | Ga0496113_0833965 | Ga0496113_0833965_217_711 | 164 |
| 531 | 3300049127 | Ga0501306_033230 | Ga0501306_033230_253_747 | 164 |
| 532 | 3300049128 | Ga0501308_026253 | Ga0501308_026253_237_731 | 164 |
| 533 | 3300049129 | Ga0501309_024531 | Ga0501309_024531_36_530 | 164 |
| 534 | 3300049160 | Ga0501304_021701 | Ga0501304_021701_16_510 | 164 |
| 535 | 3300049161 | Ga0501305_050458 | Ga0501305_050458_16_510 | 164 |
| 536 | 3300049161 | Ga0501305_107806 | Ga0501305_107806_16_510 | 164 |
| 537 | 3300049161 | Ga0501305_107892 | Ga0501305_107892_16_510 | 164 |
| 538 | 3300049162 | Ga0501307_038029 | Ga0501307_038029_179_673 | 164 |
| 539 | 3300049162 | Ga0501307_068643 | Ga0501307_068643_34_528 | 164 |
| 540 | 3300049528 | Ga0501312_051317 | Ga0501312_051317_15_509 | 164 |
| 541 | 3300049530 | Ga0501314_023775 | Ga0501314_023775_134_628 | 164 |
| 542 | 3300049533 | Ga0501317_024418 | Ga0501317_024418_147_641 | 164 |
| 543 | 3300049534 | Ga0501318_029747 | Ga0501318_029747_230_724 | 164 |
| 544 | 3300049536 | Ga0501320_017243 | Ga0501320_017243_267_761 | 164 |
| 545 | 3300049537 | Ga0501321_039265 | Ga0501321_039265_152_646 | 164 |
| 546 | 3300049537 | Ga0501321_062981 | Ga0501321_062981_13_507 | 164 |
| 547 | 3300049538 | Ga0501322_007465 | Ga0501322_007465_286_780 | 164 |
| 548 | 3300049539 | Ga0501323_018212 | Ga0501323_018212_160_654 | 164 |
| 549 | 3300049539 | Ga0501323_073047 | Ga0501323_073047_40_534 | 164 |
| 550 | 3300049540 | Ga0501324_023484 | Ga0501324_023484_121_615 | 164 |
| 551 | 3300049549 | Ga0501333_011320 | Ga0501333_011320_22_516 | 164 |
| 552 | 3300049665 | Ga0501227_174642 | Ga0501227_174642_16_513 | 164 |
| 553 | 3300049674 | Ga0501242_039431 | Ga0501242_039431_17_514 | 164 |
| 554 | 3300049690 | Ga0501261_037334 | Ga0501261_037334_59_556 | 164 |
| 555 | 3300049705 | Ga0501225_0167629 | Ga0501225_0167629_44_541 | 164 |
| 556 | 3300049779 | Ga0501283_081996 | Ga0501283_081996_54_551 | 164 |
| 557 | 3300050507 | nmdc:mga05p37_252491_c1 | nmdc:mga05p37_252491_c1_593_1090 | 164 |
| 558 | 3300050507 | nmdc:mga05p37_277217_c1 | nmdc:mga05p37_277217_c1_988_1482 | 164 |
| 559 | 3300050508 | nmdc:mga09592_64978_c1 | nmdc:mga09592_64978_c1_1940_2437 | 164 |
| 560 | 3300050509 | nmdc:mga0qj67_35220_c1 | nmdc:mga0qj67_35220_c1_2516_3013 | 164 |
| 561 | 3300050509 | nmdc:mga0qj67_4675_c1 | nmdc:mga0qj67_4675_c1_1992_2489 | 164 |
| 562 | 3300050512 | nmdc:mga0n895_408074_c1 | nmdc:mga0n895_408074_c1_475_969 | 164 |
| 563 | 3300050513 | nmdc:mga0rr50_132519_c1 | nmdc:mga0rr50_132519_c1_691_1185 | 164 |
| 564 | 3300050515 | nmdc:mga0a205_1059936_c1 | nmdc:mga0a205_1059936_c1_61_555 | 164 |
| 565 | 3300059505 | Ga0587083_0028972 | Ga0587083_0028972_437_949 | 164 |
| 566 | 3300060344 | Ga0587071_062560 | Ga0587071_062560_149_670 | 164 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3eaa-assembly1.cif.gz_A | structure of a type six secretion system protein | 0.9414 | 2 | 164 |
| 3eaa-assembly1.cif.gz_A | structure of a type six secretion system protein | 0.9358 | 2 | 164 |
| 4tv4-assembly1.cif.gz_B-2 | crystal structure of a putative uncharacterized protein from burkholderia pseudomallei | 0.9336 | 2 | 164 |
| 4tv4-assembly1.cif.gz_B-2 | crystal structure of a putative uncharacterized protein from burkholderia pseudomallei | 0.9273 | 2 | 164 |
| 4tv4-assembly1.cif.gz_A-2 | crystal structure of a putative uncharacterized protein from burkholderia pseudomallei | 0.9266 | 2 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3eaaB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.9403 | 2 | 164 | 2.30.110.20 |
| 3eaaB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.9346 | 2 | 164 | 2.30.110.20 |
| 5xeuF00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.9146 | 4 | 160 | 2.30.110.20 |
| 1y12B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.8946 | 2 | 164 | 2.30.110.20 |
| 1y12B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.8889 | 2 | 164 | 2.30.110.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A034T0E6-F1-model_v4 | deleted | 0.9563 | 1 | 164 |
|
| AF-A0A2U0A666-F1-model_v4 | Type VI secretion system tube protein Hcp | 0.9529 | 1 | 164 |
|
| AF-A0A0U2T6X9-F1-model_v4 | PEP-CTERM protein-sorting domain-containing protein | 0.9521 | 2 | 164 |
|
| AF-A0A5C4RLA0-F1-model_v4 | Type VI secretion system tube protein Hcp | 0.9513 | 1 | 164 |
|
| AF-A0A1W1XFU6-F1-model_v4 | Type VI secretion system secreted protein Hcp | 0.9511 | 1 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar