F464382

General Info

Members Datasets Scaffolds Average Seq Length
566 169 566 150

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_11331113|Ga0105241_113311132
Length 170
Sequence MVDARRYFDEIELGEEYESPGRTVTEADIVMFAGLSGDYNVLHTDAEFMKQTIFGERIAHGLLCLAIQSGLFTRATAPYATLGFGGLRWKFKAPVKIGDTIRLRAKVVEKKDLDKPDRGQITLDRTILNQRDEVVQQRQTDLVVQKRPSPPRPISRTSWSTRSSSRPPSP

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
98 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
99 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011476 3300003203 Bacteria 3885
2 Ga0065707_10310453 3300005295 Bacteria 986
3 Ga0065707_10499633 3300005295 Bacteria 758
4 Ga0065707_10802318 3300005295 Bacteria 599
5 Ga0065707_10950482 3300005295 Unclassified 552
6 Ga0070676_10364056 3300005328 Bacteria 997
7 Ga0068869_100124928 3300005334 Bacteria 1972
8 Ga0070666_10283989 3300005335 Unclassified 1177
9 Ga0070680_100095382 3300005336 Bacteria 2466
10 Ga0070689_100449718 3300005340 Bacteria 1096
11 Ga0070687_100598929 3300005343 Bacteria 757
12 Ga0070669_100005950 3300005353 Bacteria 8802
13 Ga0070675_100628578 3300005354 Bacteria 975
14 Ga0070671_100203303 3300005355 Bacteria 1680
15 Ga0070674_100265657 3300005356 Unclassified 1354
16 Ga0070688_100349126 3300005365 Bacteria 1083
17 Ga0070703_10037795 3300005406 Bacteria 1489
18 Ga0070705_100001602 3300005440 Bacteria 11856
19 Ga0070705_100057908 3300005440 Bacteria 2288
20 Ga0070705_101162771 3300005440 Bacteria 634
21 Ga0070694_100112158 3300005444 Bacteria 1944
22 Ga0070694_100367948 3300005444 Unclassified 1118
23 Ga0070694_100461327 3300005444 Bacteria 1005
24 Ga0070694_100545747 3300005444 Bacteria 927
25 Ga0070708_100020777 3300005445 Bacteria 5542
26 Ga0070708_100039779 3300005445 Bacteria 4116
27 Ga0070708_100264091 3300005445 Bacteria 1618
28 Ga0070662_100497184 3300005457 Bacteria 1017
29 Ga0068867_100191411 3300005459 Bacteria 1632
30 Ga0068867_100600312 3300005459 Bacteria 960
31 Ga0070706_100021203 3300005467 Bacteria 5984
32 Ga0070706_100234657 3300005467 Bacteria 1712
33 Ga0070706_101467962 3300005467 Unclassified 623
34 Ga0070707_100014834 3300005468 Bacteria 7305
35 Ga0070707_100029393 3300005468 Bacteria 5233
36 Ga0070707_101580252 3300005468 Unclassified 623
37 Ga0070698_100025496 3300005471 Bacteria 6163
38 Ga0070698_100384900 3300005471 Bacteria 1335
39 Ga0070699_100002285 3300005518 Bacteria 17239
40 Ga0070699_100065469 3300005518 Bacteria 3154
41 Ga0070699_100082247 3300005518 Bacteria 2807
42 Ga0070699_100470084 3300005518 Bacteria 1141
43 Ga0070679_101454517 3300005530 Bacteria 632
44 Ga0070697_100069126 3300005536 Bacteria 2892
45 Ga0070697_100130848 3300005536 Bacteria 2104
46 Ga0070697_100188543 3300005536 Bacteria 1750
47 Ga0070697_100218437 3300005536 Bacteria 1624
48 Ga0070697_100546257 3300005536 Bacteria 1016
49 Ga0070697_100580170 3300005536 Bacteria 985
50 Ga0070672_100194656 3300005543 Unclassified 1694
51 Ga0070686_100099279 3300005544 Bacteria 1964
52 Ga0070695_100252443 3300005545 Bacteria 1284
53 Ga0070696_100038253 3300005546 Bacteria 3311
54 Ga0070696_100081549 3300005546 Bacteria 2292
55 Ga0070696_100119851 3300005546 Bacteria 1903
56 Ga0070696_100327960 3300005546 Unclassified 1180
57 Ga0070704_100036960 3300005549 Bacteria 3331
58 Ga0070704_100183918 3300005549 Bacteria 1674
59 Ga0070664_100839560 3300005564 Bacteria 860
60 Ga0068857_101795309 3300005577 Bacteria 600
61 Ga0070702_100185812 3300005615 Bacteria 1364
62 Ga0068859_100020115 3300005617 Bacteria 6702
63 Ga0068859_100152031 3300005617 Bacteria 2390
64 Ga0068861_101077149 3300005719 Bacteria 771
65 Ga0068861_101140470 3300005719 Unclassified 751
66 Ga0068863_100197248 3300005841 Bacteria 1935
67 Ga0068862_100396640 3300005844 Bacteria 1290
68 Ga0068862_101987950 3300005844 Bacteria 592
69 Ga0081455_10054380 3300005937 Bacteria 3413
70 Ga0081540_1214395 3300005983 Unclassified 690
71 Ga0081539_10000050 3300005985 Bacteria 269342
72 Ga0075432_10093539 3300006058 Bacteria 1103
73 Ga0070716_100841335 3300006173 Bacteria 714
74 Ga0075428_100003038 3300006844 Bacteria 18316
75 Ga0075428_100005208 3300006844 Bacteria 14452
76 Ga0075428_100024996 3300006844 Bacteria 6608
77 Ga0075428_100027814 3300006844 Bacteria 6256
78 Ga0075428_100048174 3300006844 Bacteria 4678
79 Ga0075428_100168984 3300006844 Bacteria 2371
80 Ga0075428_100379423 3300006844 Unclassified 1516
81 Ga0075428_100707698 3300006844 Bacteria 1073
82 Ga0075428_101372856 3300006844 Bacteria 742
83 Ga0075430_100000051 3300006846 Bacteria 61002
84 Ga0075430_100004693 3300006846 Bacteria 11493
85 Ga0075430_100004785 3300006846 Bacteria 11390
86 Ga0075430_100100240 3300006846 Bacteria 2419
87 Ga0075430_100958208 3300006846 Bacteria 705
88 Ga0075431_100001402 3300006847 Bacteria 22101
89 Ga0075431_100006845 3300006847 Bacteria 11323
90 Ga0075431_100009950 3300006847 Bacteria 9552
91 Ga0075431_100010715 3300006847 Bacteria 9212
92 Ga0075431_100027525 3300006847 Bacteria 5834
93 Ga0075431_100033089 3300006847 Bacteria 5328
94 Ga0075431_100057286 3300006847 Bacteria 4019
95 Ga0075431_100088087 3300006847 Bacteria 3203
96 Ga0075431_100142818 3300006847 Bacteria 2468
97 Ga0075431_100173458 3300006847 Bacteria 2215
98 Ga0075431_100332727 3300006847 Bacteria 1529
99 Ga0075431_100352922 3300006847 Bacteria 1478
100 Ga0075431_100565103 3300006847 Bacteria 1124
101 Ga0075431_101193928 3300006847 Bacteria 724
102 Ga0075431_101307432 3300006847 Unclassified 686
103 Ga0075433_10000440 3300006852 Bacteria 26836
104 Ga0075433_10002763 3300006852 Bacteria 13428
105 Ga0075433_10045911 3300006852 Bacteria 3799
106 Ga0075433_10056339 3300006852 Bacteria 3432
107 Ga0075433_10205480 3300006852 Bacteria 1751
108 Ga0075433_10256966 3300006852 Bacteria 1549
109 Ga0075433_10393780 3300006852 Bacteria 1222
110 Ga0075433_10664086 3300006852 Bacteria 914
111 Ga0075434_100013446 3300006871 Bacteria 7791
112 Ga0075434_100040122 3300006871 Bacteria 4637
113 Ga0075434_100129252 3300006871 Bacteria 2544
114 Ga0075434_100243610 3300006871 Bacteria 1818
115 Ga0075434_100296852 3300006871 Bacteria 1636
116 Ga0075434_100397289 3300006871 Bacteria 1399
117 Ga0075434_100742922 3300006871 Bacteria 998
118 Ga0075434_101680780 3300006871 Unclassified 643
119 Ga0075429_100000587 3300006880 Bacteria 27992
120 Ga0075429_100001131 3300006880 Bacteria 21511
121 Ga0075429_100020653 3300006880 Bacteria 5716
122 Ga0075429_100028520 3300006880 Bacteria 4846
123 Ga0075429_100050491 3300006880 Bacteria 3618
124 Ga0075429_100112733 3300006880 Bacteria 2377
125 Ga0075429_100139722 3300006880 Bacteria 2120
126 Ga0075429_100221375 3300006880 Bacteria 1658
127 Ga0075436_100002041 3300006914 Bacteria 13918
128 Ga0075436_100088382 3300006914 Bacteria 2152
129 Ga0075436_100090220 3300006914 Bacteria 2130
130 Ga0075436_100151598 3300006914 Bacteria 1631
131 Ga0097620_100020115 3300006931 Bacteria 6702
132 Ga0097620_100152029 3300006931 Bacteria 2390
133 Ga0075435_100006744 3300007076 Bacteria 8146
134 Ga0075435_100008993 3300007076 Bacteria 7204
135 Ga0075435_100021347 3300007076 Bacteria 4979
136 Ga0075435_100727942 3300007076 Unclassified 863
137 Ga0075435_100902703 3300007076 Bacteria 770
138 Ga0075435_101100218 3300007076 Bacteria 695
139 Ga0099794_10012252 3300007265 Bacteria 3693
140 Ga0099794_10113318 3300007265 Bacteria 1360
141 Ga0099794_10228335 3300007265 Bacteria 957
142 Ga0111539_10002514 3300009094 Bacteria 24300
143 Ga0111539_10008389 3300009094 Bacteria 13146
144 Ga0111539_10012118 3300009094 Bacteria 10816
145 Ga0111539_10051679 3300009094 Bacteria 4894
146 Ga0111539_11847574 3300009094 Unclassified 700
147 Ga0105245_11257363 3300009098 Unclassified 789
148 Ga0114129_10000287 3300009147 Bacteria 58122
149 Ga0114129_10003614 3300009147 Bacteria 21748
150 Ga0114129_10003966 3300009147 Bacteria 20899
151 Ga0114129_10005903 3300009147 Bacteria 17322
152 Ga0114129_10011177 3300009147 Bacteria 12799
153 Ga0114129_10023163 3300009147 Bacteria 8808
154 Ga0114129_10035739 3300009147 Bacteria 7018
155 Ga0114129_10035830 3300009147 Bacteria 7007
156 Ga0114129_10083755 3300009147 Bacteria 4428
157 Ga0114129_10097423 3300009147 Bacteria 4072
158 Ga0114129_10189942 3300009147 Bacteria 2790
159 Ga0114129_10372699 3300009147 Bacteria 1886
160 Ga0114129_10419391 3300009147 Bacteria 1761
161 Ga0114129_10500249 3300009147 Bacteria 1588
162 Ga0114129_10643488 3300009147 Bacteria 1369
163 Ga0114129_10676717 3300009147 Bacteria 1329
164 Ga0105243_10694874 3300009148 Bacteria 991
165 Ga0105241_10022916 3300009174 Bacteria 4629
166 Ga0105241_11331113 3300009174 Bacteria 685
167 Ga0105242_10666252 3300009176 Bacteria 1014
168 Ga0105242_11334827 3300009176 Bacteria 742
169 Ga0105248_10537273 3300009177 Bacteria 1319
170 Ga0105249_10326409 3300009553 Bacteria 1547
171 Ga0105249_11731179 3300009553 Unclassified 698
172 Ga0105246_10384410 3300011119 Bacteria 1161
173 Ga0157378_10197255 3300013297 Bacteria 1902
174 Ga0157378_10233843 3300013297 Bacteria 1753
175 Ga0163162_10308119 3300013306 Bacteria 1716
176 Ga0163162_10714226 3300013306 Bacteria 1123
177 Ga0157375_11450509 3300013308 Unclassified 809
178 Ga0157380_11381956 3300014326 Unclassified 754
179 Ga0207680_10180534 3300025903 Bacteria 1427
180 Ga0207684_10000470 3300025910 Bacteria 52370
181 Ga0207684_10005453 3300025910 Bacteria 11724
182 Ga0207684_10060504 3300025910 Bacteria 3217
183 Ga0207684_10113063 3300025910 Bacteria 2324
184 Ga0207660_10088314 3300025917 Bacteria 2292
185 Ga0207662_10294856 3300025918 Unclassified 1076
186 Ga0207652_10358859 3300025921 Bacteria 1315
187 Ga0207646_10003035 3300025922 Bacteria 19317
188 Ga0207646_10007481 3300025922 Bacteria 11088
189 Ga0207646_10238150 3300025922 Bacteria 1644
190 Ga0207646_11009375 3300025922 Unclassified 735
191 Ga0207646_11292136 3300025922 Unclassified 637
192 Ga0207681_10022683 3300025923 Bacteria 4006
193 Ga0207644_10106731 3300025931 Bacteria 2112
194 Ga0207706_10059058 3300025933 Bacteria 3378
195 Ga0207665_10849422 3300025939 Bacteria 723
196 Ga0207691_10084093 3300025940 Bacteria 2857
197 Ga0207689_10156024 3300025942 Bacteria 1882
198 Ga0207712_10032157 3300025961 Bacteria 3539
199 Ga0207658_10453418 3300025986 Bacteria 1136
200 Ga0207708_10195028 3300026075 Bacteria 1614
201 Ga0207641_10401740 3300026088 Bacteria 1316
202 Ga0207675_100471574 3300026118 Bacteria 1246
203 Ga0209966_1013850 3300027695 Bacteria 1499
204 Ga0209974_10025141 3300027876 Unclassified 1972
205 Ga0209974_10084147 3300027876 Bacteria 1098
206 Ga0207428_10002252 3300027907 Bacteria 19373
207 Ga0207428_10466607 3300027907 Bacteria 919
208 Ga0207428_10523904 3300027907 Bacteria 859
209 Ga0207428_10694839 3300027907 Bacteria 728
210 Ga0268265_10452041 3300028380 Bacteria 1200
211 Ga0268265_10735402 3300028380 Unclassified 956
212 Ga0268264_11229540 3300028381 Bacteria 759
213 Ga0307408_100027799 3300031548 Bacteria 3902
214 Ga0307408_100045999 3300031548 Bacteria 3120
215 Ga0307405_11398203 3300031731 Bacteria 612
216 Ga0307413_10801973 3300031824 Bacteria 791
217 Ga0307407_10953814 3300031903 Bacteria 661
218 Ga0307412_10675033 3300031911 Bacteria 884
219 Ga0307409_100111716 3300031995 Bacteria 2293
220 Ga0307409_101253961 3300031995 Unclassified 766
221 Ga0307416_100223532 3300032002 Bacteria 1808
222 Ga0307416_100323112 3300032002 Bacteria 1546
223 Ga0307416_100708968 3300032002 Bacteria 1096
224 Ga0307416_101148428 3300032002 Bacteria 882
225 Ga0307411_10147036 3300032005 Bacteria 1746
226 Ga0307411_10314593 3300032005 Bacteria 1262
227 Ga0307411_10859609 3300032005 Bacteria 803
228 Ga0307411_11588582 3300032005 Bacteria 603
229 Ga0307415_101178762 3300032126 Bacteria 721
230 Ga0373930_0009660 3300034816 Bacteria 1711
231 Ga0373950_0031717 3300034818 Bacteria 981
232 Ga0373940_0009766 3300035088 Bacteria 2239
233 Ga0373931_0031620 3300035691 Bacteria 2733
234 Ga0373931_0054062 3300035691 Bacteria 2145
235 Ga0373931_0186983 3300035691 Bacteria 1230
236 Ga0373931_0357024 3300035691 Bacteria 916
237 Ga0395899_0040355 3300037312 Bacteria 3491
238 Ga0395900_0012495 3300037418 Bacteria 8684
239 Ga0395900_0293689 3300037418 Bacteria 1613
240 Ga0395898_0009464 3300037466 Bacteria 10236
241 Ga0395905_0091388 3300037471 Bacteria 2854
242 Ga0395901_0002730 3300038443 Bacteria 17800
243 Ga0395901_0039236 3300038443 Bacteria 4900
244 Ga0242420_058256 3300038996 Bacteria 766
245 Ga0439453_0058412 3300041408 Bacteria 794
246 Ga0439465_0240722 3300041413 Bacteria 667
247 Ga0439441_043933 3300042001 Bacteria 903
248 Ga0439435_0137412 3300042436 Bacteria 776
249 Ga0451577_0444723 3300042876 Bacteria 1177
250 Ga0451576_0034762 3300045051 Bacteria 5352
251 Ga0451576_0415225 3300045051 Bacteria 1412
252 Ga0451576_0577775 3300045051 Bacteria 1181
253 Ga0451576_0687518 3300045051 Bacteria 1075
254 Ga0451576_0731648 3300045051 Bacteria 1039
255 Ga0451576_0830622 3300045051 Bacteria 970
256 Ga0451576_0963328 3300045051 Bacteria 894
257 Ga0495603_0067839 3300046455 Bacteria 2099
258 Ga0495580_0017124 3300046472 Bacteria 5427
259 Ga0495642_0094172 3300046528 Unclassified 1270
260 Ga0495642_0448544 3300046528 Bacteria 570
261 Ga0495656_0059163 3300046615 Bacteria 1666
262 Ga0495659_0134961 3300046664 Unclassified 981
263 Ga0495669_0045570 3300046684 Bacteria 1956
264 Ga0495669_0059250 3300046684 Bacteria 1729
265 Ga0495669_0244370 3300046684 Unclassified 862
266 Ga0495677_0334411 3300047445 Unclassified 597
267 Ga0496102_0013333 3300048905 Bacteria 7120
268 Ga0496103_0301905 3300048906 Bacteria 1030
269 Ga0496104_0500076 3300048907 Bacteria 1127
270 Ga0496106_0049337 3300048909 Bacteria 3171
271 Ga0496106_0242021 3300048909 Bacteria 1442
272 Ga0496107_0372173 3300048910 Bacteria 1063
273 Ga0496107_1074509 3300048910 Bacteria 582
274 Ga0496108_0000013 3300048911 Bacteria 249814
275 Ga0501290_050710 3300049513 Bacteria 646
276 Ga0501031_0051217 3300049568 Bacteria 2689
277 Ga0501031_0319504 3300049568 Unclassified 1006
278 Ga0501031_0835858 3300049568 Bacteria 590
279 Ga0501031_0946563 3300049568 Bacteria 551
280 Ga0501032_0325340 3300049569 Bacteria 992
281 Ga0501033_0004324 3300049570 Bacteria 11400
282 Ga0501033_0030310 3300049570 Bacteria 4066
283 Ga0501033_0100487 3300049570 Bacteria 2111
284 Ga0501034_0272977 3300049571 Bacteria 1632
285 Ga0501036_0021486 3300049572 Bacteria 5427
286 Ga0501036_0068992 3300049572 Bacteria 2992
287 Ga0501036_0088617 3300049572 Bacteria 2615
288 Ga0501036_0663994 3300049572 Bacteria 863
289 Ga0501036_0865849 3300049572 Bacteria 742
290 Ga0501036_1250209 3300049572 Unclassified 604
291 Ga0501037_0568507 3300049573 Bacteria 764
292 Ga0501038_0002055 3300049574 Bacteria 18629
293 Ga0501038_0006322 3300049574 Bacteria 10957
294 Ga0501038_0179383 3300049574 Bacteria 1710
295 Ga0501038_0302115 3300049574 Unclassified 1256
296 Ga0501038_0528278 3300049574 Bacteria 900
297 Ga0501039_0001942 3300049575 Bacteria 15317
298 Ga0501039_0034389 3300049575 Bacteria 3911
299 Ga0501039_0065152 3300049575 Bacteria 2826
300 Ga0501039_0303873 3300049575 Bacteria 1254
301 Ga0501039_0536785 3300049575 Bacteria 918
302 Ga0501039_0847648 3300049575 Bacteria 712
303 Ga0501039_0943369 3300049575 Unclassified 671
304 Ga0501039_1521354 3300049575 Bacteria 514
305 Ga0501040_0009318 3300049576 Bacteria 6395
306 Ga0501040_0024954 3300049576 Bacteria 4017
307 Ga0501040_0177122 3300049576 Bacteria 1511
308 Ga0501040_0219224 3300049576 Bacteria 1353
309 Ga0501040_0234280 3300049576 Bacteria 1308
310 Ga0501040_0499272 3300049576 Bacteria 877
311 Ga0501040_0579458 3300049576 Bacteria 810
312 Ga0501041_0005362 3300049577 Bacteria 7509
313 Ga0501041_0009811 3300049577 Bacteria 5637
314 Ga0501041_0016545 3300049577 Bacteria 4385
315 Ga0501041_0059270 3300049577 Bacteria 2343
316 Ga0501041_0597143 3300049577 Unclassified 704
317 Ga0501042_0005811 3300049578 Bacteria 7968
318 Ga0501042_0043994 3300049578 Bacteria 3181
319 Ga0501042_0297474 3300049578 Bacteria 1166
320 Ga0501042_0470226 3300049578 Bacteria 912
321 Ga0501042_0531645 3300049578 Bacteria 854
322 Ga0501042_0618070 3300049578 Bacteria 788
323 Ga0501042_0720658 3300049578 Unclassified 725
324 Ga0501043_0023622 3300049579 Bacteria 4822
325 Ga0501043_0098489 3300049579 Bacteria 2298
326 Ga0501043_0610564 3300049579 Bacteria 805
327 Ga0501046_0017487 3300049580 Bacteria 5981
328 Ga0501046_0067114 3300049580 Bacteria 2794
329 Ga0501046_0069909 3300049580 Bacteria 2731
330 Ga0501046_0074595 3300049580 Bacteria 2632
331 Ga0501046_0157566 3300049580 Bacteria 1709
332 Ga0501046_0256977 3300049580 Bacteria 1284
333 Ga0501046_0474044 3300049580 Bacteria 899
334 Ga0501048_0000432 3300049582 Bacteria 29460
335 Ga0501048_0034810 3300049582 Bacteria 3630
336 Ga0501048_0219020 3300049582 Bacteria 1350
337 Ga0501048_0249234 3300049582 Bacteria 1260
338 Ga0501048_0351021 3300049582 Bacteria 1052
339 Ga0501048_0361356 3300049582 Bacteria 1036
340 Ga0501048_0523812 3300049582 Bacteria 850
341 Ga0501068_0012020 3300049584 Bacteria 4897
342 Ga0501068_0038927 3300049584 Bacteria 2850
343 Ga0501068_0060467 3300049584 Bacteria 2301
344 Ga0501068_0131351 3300049584 Bacteria 1566
345 Ga0501068_0181678 3300049584 Bacteria 1330
346 Ga0501068_0287645 3300049584 Bacteria 1051
347 Ga0501068_1213150 3300049584 Bacteria 500
348 Ga0501069_0082293 3300049585 Bacteria 1814
349 Ga0501069_0217833 3300049585 Bacteria 1109
350 Ga0501069_0329130 3300049585 Bacteria 898
351 Ga0501069_0553812 3300049585 Bacteria 688
352 Ga0501070_0406919 3300049586 Bacteria 1100
353 Ga0501070_0598515 3300049586 Bacteria 879
354 Ga0501071_0002678 3300049587 Bacteria 10903
355 Ga0501071_0093429 3300049587 Bacteria 2212
356 Ga0501071_0169389 3300049587 Bacteria 1635
357 Ga0501071_0202557 3300049587 Bacteria 1491
358 Ga0501071_0847625 3300049587 Bacteria 705
359 Ga0501072_0006879 3300049588 Bacteria 8634
360 Ga0501072_0014287 3300049588 Bacteria 6084
361 Ga0501072_0019420 3300049588 Bacteria 5252
362 Ga0501072_0042242 3300049588 Bacteria 3582
363 Ga0501072_0042399 3300049588 Bacteria 3575
364 Ga0501072_0113326 3300049588 Bacteria 2159
365 Ga0501072_0120548 3300049588 Bacteria 2090
366 Ga0501072_0160302 3300049588 Bacteria 1794
367 Ga0501072_0299630 3300049588 Bacteria 1278
368 Ga0501072_0518304 3300049588 Bacteria 943
369 Ga0501073_0223170 3300049589 Bacteria 1302
370 Ga0501073_0583720 3300049589 Bacteria 772
371 Ga0501073_0626102 3300049589 Unclassified 743
372 Ga0501074_0021526 3300049590 Bacteria 4681
373 Ga0501074_0035890 3300049590 Bacteria 3592
374 Ga0501074_0225950 3300049590 Bacteria 1333
375 Ga0501074_0553614 3300049590 Unclassified 814
376 Ga0501074_0900720 3300049590 Bacteria 623
377 Ga0501075_0002070 3300049591 Bacteria 13256
378 Ga0501075_0005304 3300049591 Bacteria 8812
379 Ga0501075_0024052 3300049591 Bacteria 4460
380 Ga0501075_0038212 3300049591 Bacteria 3588
381 Ga0501075_0046825 3300049591 Bacteria 3249
382 Ga0501075_0069110 3300049591 Bacteria 2669
383 Ga0501075_0197038 3300049591 Bacteria 1536
384 Ga0501075_0451352 3300049591 Bacteria 980
385 Ga0501075_0722682 3300049591 Bacteria 758
386 Ga0501075_0728713 3300049591 Bacteria 755
387 Ga0501076_0000066 3300049592 Bacteria 51984
388 Ga0501076_0007702 3300049592 Bacteria 7844
389 Ga0501076_0010649 3300049592 Bacteria 6831
390 Ga0501076_0018794 3300049592 Bacteria 5274
391 Ga0501076_0033537 3300049592 Bacteria 4009
392 Ga0501076_0057624 3300049592 Bacteria 3085
393 Ga0501076_0094387 3300049592 Bacteria 2409
394 Ga0501076_0145325 3300049592 Bacteria 1928
395 Ga0501076_0235153 3300049592 Bacteria 1498
396 Ga0501076_0250186 3300049592 Bacteria 1450
397 Ga0501076_0987649 3300049592 Bacteria 694
398 Ga0501076_1328568 3300049592 Unclassified 591
399 Ga0501077_0001136 3300049593 Bacteria 16068
400 Ga0501077_0003941 3300049593 Bacteria 8949
401 Ga0501077_0006907 3300049593 Bacteria 6990
402 Ga0501077_0081226 3300049593 Bacteria 2053
403 Ga0501077_0192434 3300049593 Bacteria 1296
404 Ga0501077_0246539 3300049593 Bacteria 1136
405 Ga0501077_0759320 3300049593 Bacteria 623
406 Ga0501077_0995369 3300049593 Bacteria 539
407 Ga0501079_0006569 3300049741 Bacteria 8743
408 Ga0501079_0019221 3300049741 Bacteria 5218
409 Ga0501079_0028931 3300049741 Bacteria 4253
410 Ga0501079_0031634 3300049741 Bacteria 4067
411 Ga0501079_0038036 3300049741 Bacteria 3711
412 Ga0501079_0080480 3300049741 Bacteria 2519
413 Ga0501079_0113955 3300049741 Bacteria 2102
414 Ga0501079_0783285 3300049741 Bacteria 751
415 Ga0501079_0933678 3300049741 Unclassified 683
416 Ga0501080_0003579 3300049742 Bacteria 13678
417 Ga0501080_0038802 3300049742 Bacteria 4445
418 Ga0501080_0086931 3300049742 Bacteria 2905
419 Ga0501080_0090128 3300049742 Bacteria 2849
420 Ga0501080_0203492 3300049742 Bacteria 1817
421 Ga0501080_0437932 3300049742 Bacteria 1173
422 Ga0501080_0505562 3300049742 Bacteria 1080
423 Ga0501081_0006079 3300049743 Bacteria 7822
424 Ga0501081_0012310 3300049743 Bacteria 5618
425 Ga0501081_0028076 3300049743 Bacteria 3796
426 Ga0501081_0036496 3300049743 Bacteria 3352
427 Ga0501081_0040956 3300049743 Bacteria 3171
428 Ga0501081_0049286 3300049743 Bacteria 2900
429 Ga0501081_0050231 3300049743 Bacteria 2873
430 Ga0501081_0063315 3300049743 Bacteria 2567
431 Ga0501081_0142308 3300049743 Bacteria 1719
432 Ga0501081_0335196 3300049743 Bacteria 1113
433 Ga0501081_0617043 3300049743 Bacteria 812
434 Ga0501083_0217035 3300049744 Bacteria 1246
435 Ga0501083_0318362 3300049744 Bacteria 1012
436 Ga0501083_0637043 3300049744 Unclassified 693
437 Ga0501035_0032990 3300049822 Bacteria 4709
438 Ga0501044_0546830 3300049823 Bacteria 1055
439 Ga0501045_0016312 3300049824 Bacteria 5273
440 Ga0501045_0022447 3300049824 Bacteria 4520
441 Ga0501045_0023174 3300049824 Bacteria 4449
442 Ga0501045_0034171 3300049824 Bacteria 3690
443 Ga0501045_0035326 3300049824 Bacteria 3629
444 Ga0501045_0042136 3300049824 Bacteria 3323
445 Ga0501045_0158821 3300049824 Bacteria 1682
446 Ga0501045_0210759 3300049824 Bacteria 1447
447 Ga0501045_0476180 3300049824 Unclassified 928
448 Ga0501045_0501959 3300049824 Bacteria 901
449 nmdc:mga05p37_128134_c1 3300050507 Bacteria 3116
450 nmdc:mga05p37_13715_c1 3300050507 Bacteria 9712
451 nmdc:mga05p37_13768_c1 3300050507 Bacteria 9692
452 nmdc:mga05p37_1450_c2 3300050507 Bacteria 21885
453 nmdc:mga05p37_15330_c1 3300050507 Bacteria 9207
454 nmdc:mga05p37_22283_c1 3300050507 Bacteria 7682
455 nmdc:mga05p37_250683_c1 3300050507 Bacteria 2124
456 nmdc:mga05p37_27212_c1 3300050507 Bacteria 6961
457 nmdc:mga05p37_27956_c1 3300050507 Bacteria 6870
458 nmdc:mga05p37_286475_c1 3300050507 Bacteria 1962
459 nmdc:mga05p37_29961_c1 3300050507 Bacteria 6641
460 nmdc:mga05p37_39979_c1 3300050507 Bacteria 5759
461 nmdc:mga05p37_411798_c1 3300050507 Bacteria 1576
462 nmdc:mga05p37_65078_c1 3300050507 Bacteria 4486
463 nmdc:mga05p37_677505_c1 3300050507 Bacteria 1150
464 nmdc:mga05p37_68561_c1 3300050507 Bacteria 4362
465 nmdc:mga05p37_79257_c1 3300050507 Bacteria 4045
466 nmdc:mga09592_118467_c1 3300050508 Bacteria 2273
467 nmdc:mga09592_1890_c1 3300050508 Bacteria 16868
468 nmdc:mga09592_4013_c1 3300050508 Bacteria 11873
469 nmdc:mga09592_507000_c1 3300050508 Bacteria 1038
470 nmdc:mga09592_55661_c1 3300050508 Bacteria 3343
471 nmdc:mga09592_72086_c1 3300050508 Bacteria 2933
472 nmdc:mga09592_80660_c1 3300050508 Bacteria 2771
473 nmdc:mga09592_8863_c1 3300050508 Bacteria 8180
474 nmdc:mga09592_920400_c1 3300050508 Archaea 734
475 nmdc:mga0qj67_13951_c1 3300050509 Bacteria 6068
476 nmdc:mga0qj67_177060_c1 3300050509 Bacteria 1732
477 nmdc:mga0qj67_21498_c1 3300050509 Bacteria 4950
478 nmdc:mga0qj67_29132_c1 3300050509 Bacteria 4289
479 nmdc:mga0qj67_40703_c1 3300050509 Bacteria 3652
480 nmdc:mga0qj67_80194_c1 3300050509 Bacteria 2615
481 nmdc:mga0qj67_97939_c1 3300050509 Bacteria 2362
482 nmdc:mga06r32_1628176_c1 3300050510 Bacteria 584
483 nmdc:mga06r32_167915_c1 3300050510 Bacteria 2178
484 nmdc:mga06r32_17957_c1 3300050510 Bacteria 6468
485 nmdc:mga06r32_181137_c1 3300050510 Bacteria 2093
486 nmdc:mga06r32_227554_c1 3300050510 Bacteria 1853
487 nmdc:mga06r32_509994_c1 3300050510 Unclassified 1179
488 nmdc:mga06r32_553713_c1 3300050510 Bacteria 1124
489 nmdc:mga06r32_55846_c1 3300050510 Bacteria 3789
490 nmdc:mga06r32_56979_c1 3300050510 Bacteria 3753
491 nmdc:mga06r32_633_c1 3300050510 Bacteria 30525
492 nmdc:mga06r32_86175_c1 3300050510 Bacteria 3063
493 nmdc:mga06r32_888387_c1 3300050510 Bacteria 848
494 nmdc:mga06r32_91120_c1 3300050510 Bacteria 2979
495 nmdc:mga08y16_101694_c1 3300050511 Bacteria 2992
496 nmdc:mga08y16_143340_c1 3300050511 Bacteria 2484
497 nmdc:mga08y16_228527_c1 3300050511 Bacteria 1925
498 nmdc:mga08y16_4252_c1 3300050511 Bacteria 14947
499 nmdc:mga08y16_550177_c1 3300050511 Bacteria 1168
500 nmdc:mga0n895_1237607_c1 3300050512 Bacteria 719
501 nmdc:mga0n895_13810_c1 3300050512 Bacteria 7305
502 nmdc:mga0n895_16412_c1 3300050512 Bacteria 6794
503 nmdc:mga0n895_20535_c1 3300050512 Bacteria 6162
504 nmdc:mga0n895_24907_c1 3300050512 Bacteria 5647
505 nmdc:mga0n895_25849_c1 3300050512 Bacteria 5553
506 nmdc:mga0n895_377775_c1 3300050512 Bacteria 1434
507 nmdc:mga0n895_49630_c1 3300050512 Bacteria 4113
508 nmdc:mga0n895_512453_c1 3300050512 Unclassified 1208
509 nmdc:mga0n895_54276_c1 3300050512 Bacteria 3941
510 nmdc:mga0n895_656650_c1 3300050512 Unclassified 1047
511 nmdc:mga0rr50_1029040_c1 3300050513 Bacteria 701
512 nmdc:mga0rr50_114987_c1 3300050513 Bacteria 2135
513 nmdc:mga0rr50_1290977_c1 3300050513 Bacteria 619
514 nmdc:mga0rr50_23019_c1 3300050513 Bacteria 4287
515 nmdc:mga0rr50_4783_c1 3300050513 Bacteria 7990
516 nmdc:mga0rr50_5513_c1 3300050513 Bacteria 7560
517 nmdc:mga0rr50_573797_c1 3300050513 Bacteria 961
518 nmdc:mga08x19_49103_c1 3300050514 Bacteria 2705
519 nmdc:mga08x19_512_c1 3300050514 Bacteria 25768
520 nmdc:mga08x19_8498_c1 3300050514 Bacteria 3598
521 nmdc:mga0a205_1138127_c1 3300050515 Bacteria 628
522 nmdc:mga0a205_203783_c1 3300050515 Bacteria 1868
523 nmdc:mga0a205_22209_c1 3300050515 Bacteria 6007
524 nmdc:mga0a205_2719_c1 3300050515 Bacteria 15628
525 nmdc:mga0a205_3306_c1 3300050515 Bacteria 14349
526 nmdc:mga0a205_362098_c1 3300050515 Bacteria 1317
527 nmdc:mga0a205_407953_c1 3300050515 Bacteria 1222
528 nmdc:mga0a205_419372_c1 3300050515 Bacteria 1201
529 nmdc:mga0a205_44577_c1 3300050515 Bacteria 4276
530 nmdc:mga0a205_502482_c1 3300050515 Unclassified 1069
531 nmdc:mga0a205_51055_c1 3300050515 Bacteria 3992
532 nmdc:mga0a205_52236_c1 3300050515 Bacteria 3945
533 nmdc:mga0a205_82683_c1 3300050515 Bacteria 3102
534 nmdc:mga0a205_93337_c1 3300050515 Bacteria 2908
535 Ga0501084_0003769 3300054114 Bacteria 12325
536 Ga0501084_0006950 3300054114 Bacteria 9320
537 Ga0501084_0007066 3300054114 Bacteria 9250
538 Ga0501084_0110318 3300054114 Bacteria 2311
539 Ga0501084_0241084 3300054114 Bacteria 1526
540 Ga0501084_0282243 3300054114 Unclassified 1402
541 Ga0501084_0327088 3300054114 Unclassified 1295
542 Ga0501084_0546665 3300054114 Bacteria 979
543 Ga0501084_0550415 3300054114 Bacteria 975
544 Ga0501084_0676552 3300054114 Unclassified 871
545 Ga0501084_0765404 3300054114 Unclassified 813
546 Ga0501082_0000188 3300060353 Bacteria 53522
547 Ga0501082_0005447 3300060353 Bacteria 11049
548 Ga0501082_0010140 3300060353 Bacteria 8114
549 Ga0501082_0122615 3300060353 Bacteria 2254
550 Ga0501082_0330266 3300060353 Bacteria 1329
551 Ga0501082_0405966 3300060353 Bacteria 1189
552 Ga0501082_0745271 3300060353 Bacteria 857
553 Ga0501082_1476715 3300060353 Bacteria 594
554 Ga0530510_0000009 3300061734 Bacteria 161973
555 Ga0530510_0001586 3300061734 Bacteria 15336
556 Ga0530510_0003012 3300061734 Bacteria 11558
557 Ga0530510_0006678 3300061734 Bacteria 8046
558 Ga0530510_0134525 3300061734 Bacteria 1820
559 Ga0530510_0145198 3300061734 Bacteria 1750
560 Ga0530510_0170169 3300061734 Bacteria 1614
561 Ga0530510_0184346 3300061734 Bacteria 1548
562 Ga0530510_0400813 3300061734 Bacteria 1034
563 Ga0530510_0422532 3300061734 Bacteria 1006
564 Ga0530510_0568804 3300061734 Bacteria 861
565 Ga0530510_0654705 3300061734 Bacteria 800
566 Ga0530510_0807026 3300061734 Unclassified 716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0031634 Ga0501079_0031634_23_403 125
2 3300061734 Ga0530510_0400813 Ga0530510_0400813_323_847 130
3 3300006847 Ga0075431_100033089 Ga0075431_1000330897 146
4 3300006871 Ga0075434_100742922 Ga0075434_1007429222 146
5 3300006880 Ga0075429_100001131 Ga0075429_10000113110 146
6 3300009147 Ga0114129_10011177 Ga0114129_1001117710 146
7 3300027695 Ga0209966_1013850 Ga0209966_10138502 146
8 3300027876 Ga0209974_10084147 Ga0209974_100841472 146
9 3300048911 Ga0496108_0000013 Ga0496108_0000013_29205_29648 146
10 3300050507 nmdc:mga05p37_15330_c1 nmdc:mga05p37_15330_c1_4270_4710 146
11 3300050508 nmdc:mga09592_4013_c1 nmdc:mga09592_4013_c1_6474_6914 146
12 3300050509 nmdc:mga0qj67_97939_c1 nmdc:mga0qj67_97939_c1_1006_1446 146
13 3300050510 nmdc:mga06r32_56979_c1 nmdc:mga06r32_56979_c1_1658_2098 146
14 3300005467 Ga0070706_100234657 Ga0070706_1002346573 147
15 3300005468 Ga0070707_101580252 Ga0070707_1015802521 147
16 3300006058 Ga0075432_10093539 Ga0075432_100935393 147
17 3300006846 Ga0075430_100100240 Ga0075430_1001002402 147
18 3300006847 Ga0075431_100332727 Ga0075431_1003327272 147
19 3300006847 Ga0075431_100352922 Ga0075431_1003529222 147
20 3300006880 Ga0075429_100139722 Ga0075429_1001397222 147
21 3300007265 Ga0099794_10228335 Ga0099794_102283352 147
22 3300009094 Ga0111539_10002514 Ga0111539_1000251411 147
23 3300009147 Ga0114129_10500249 Ga0114129_105002491 147
24 3300025922 Ga0207646_11292136 Ga0207646_112921361 147
25 3300027907 Ga0207428_10002252 Ga0207428_1000225220 147
26 3300034818 Ga0373950_0031717 Ga0373950_0031717_77_520 147
27 3300035088 Ga0373940_0009766 Ga0373940_0009766_34_477 147
28 3300035691 Ga0373931_0054062 Ga0373931_0054062_282_725 147
29 3300035691 Ga0373931_0357024 Ga0373931_0357024_408_863 147
30 3300045051 Ga0451576_0034762 Ga0451576_0034762_4152_4595 147
31 3300049580 Ga0501046_0474044 Ga0501046_0474044_259_714 147
32 3300050507 nmdc:mga05p37_411798_c1 nmdc:mga05p37_411798_c1_41_484 147
33 3300050508 nmdc:mga09592_118467_c1 nmdc:mga09592_118467_c1_118_561 147
34 3300050509 nmdc:mga0qj67_29132_c1 nmdc:mga0qj67_29132_c1_2134_2577 147
35 3300050510 nmdc:mga06r32_1628176_c1 nmdc:mga06r32_1628176_c1_128_571 147
36 3300050510 nmdc:mga06r32_181137_c1 nmdc:mga06r32_181137_c1_397_840 147
37 3300050511 nmdc:mga08y16_4252_c1 nmdc:mga08y16_4252_c1_14052_14495 147
38 3300050515 nmdc:mga0a205_362098_c1 nmdc:mga0a205_362098_c1_537_980 147
39 3300005295 Ga0065707_10310453 Ga0065707_103104532 148
40 3300005295 Ga0065707_10499633 Ga0065707_104996331 148
41 3300005295 Ga0065707_10802318 Ga0065707_108023181 148
42 3300005328 Ga0070676_10364056 Ga0070676_103640562 148
43 3300005335 Ga0070666_10283989 Ga0070666_102839891 148
44 3300005343 Ga0070687_100598929 Ga0070687_1005989292 148
45 3300005354 Ga0070675_100628578 Ga0070675_1006285782 148
46 3300005355 Ga0070671_100203303 Ga0070671_1002033032 148
47 3300005356 Ga0070674_100265657 Ga0070674_1002656572 148
48 3300005365 Ga0070688_100349126 Ga0070688_1003491262 148
49 3300005440 Ga0070705_100001602 Ga0070705_10000160215 148
50 3300005440 Ga0070705_101162771 Ga0070705_1011627711 148
51 3300005444 Ga0070694_100367948 Ga0070694_1003679483 148
52 3300005445 Ga0070708_100264091 Ga0070708_1002640913 148
53 3300005457 Ga0070662_100497184 Ga0070662_1004971841 148
54 3300005471 Ga0070698_100384900 Ga0070698_1003849001 148
55 3300005518 Ga0070699_100065469 Ga0070699_1000654694 148
56 3300005536 Ga0070697_100130848 Ga0070697_1001308482 148
57 3300005544 Ga0070686_100099279 Ga0070686_1000992793 148
58 3300005546 Ga0070696_100327960 Ga0070696_1003279602 148
59 3300005549 Ga0070704_100183918 Ga0070704_1001839182 148
60 3300005564 Ga0070664_100839560 Ga0070664_1008395601 148
61 3300005577 Ga0068857_101795309 Ga0068857_1017953092 148
62 3300005617 Ga0068859_100020115 Ga0068859_1000201158 148
63 3300005719 Ga0068861_101077149 Ga0068861_1010771492 148
64 3300005719 Ga0068861_101140470 Ga0068861_1011404702 148
65 3300005841 Ga0068863_100197248 Ga0068863_1001972482 148
66 3300005844 Ga0068862_100396640 Ga0068862_1003966402 148
67 3300005844 Ga0068862_101987950 Ga0068862_1019879501 148
68 3300005937 Ga0081455_10054380 Ga0081455_100543802 148
69 3300005983 Ga0081540_1214395 Ga0081540_12143952 148
70 3300006844 Ga0075428_100003038 Ga0075428_10000303815 148
71 3300006844 Ga0075428_100024996 Ga0075428_1000249967 148
72 3300006844 Ga0075428_100027814 Ga0075428_1000278142 148
73 3300006844 Ga0075428_100048174 Ga0075428_1000481743 148
74 3300006844 Ga0075428_100168984 Ga0075428_1001689842 148
75 3300006844 Ga0075428_100379423 Ga0075428_1003794232 148
76 3300006844 Ga0075428_100707698 Ga0075428_1007076982 148
77 3300006846 Ga0075430_100000051 Ga0075430_10000005158 148
78 3300006847 Ga0075431_100001402 Ga0075431_10000140223 148
79 3300006847 Ga0075431_100006845 Ga0075431_10000684510 148
80 3300006847 Ga0075431_100088087 Ga0075431_1000880873 148
81 3300006847 Ga0075431_100142818 Ga0075431_1001428183 148
82 3300006847 Ga0075431_100173458 Ga0075431_1001734583 148
83 3300006852 Ga0075433_10000440 Ga0075433_1000044013 148
84 3300006852 Ga0075433_10056339 Ga0075433_100563392 148
85 3300006852 Ga0075433_10205480 Ga0075433_102054801 148
86 3300006852 Ga0075433_10256966 Ga0075433_102569663 148
87 3300006852 Ga0075433_10393780 Ga0075433_103937802 148
88 3300006871 Ga0075434_100013446 Ga0075434_1000134461 148
89 3300006871 Ga0075434_100129252 Ga0075434_1001292523 148
90 3300006871 Ga0075434_100296852 Ga0075434_1002968523 148
91 3300006871 Ga0075434_100397289 Ga0075434_1003972893 148
92 3300006871 Ga0075434_101680780 Ga0075434_1016807802 148
93 3300006880 Ga0075429_100000587 Ga0075429_10000058725 148
94 3300006880 Ga0075429_100050491 Ga0075429_1000504915 148
95 3300006880 Ga0075429_100112733 Ga0075429_1001127333 148
96 3300006914 Ga0075436_100090220 Ga0075436_1000902202 148
97 3300006914 Ga0075436_100151598 Ga0075436_1001515982 148
98 3300006931 Ga0097620_100020115 Ga0097620_1000201158 148
99 3300007076 Ga0075435_100006744 Ga0075435_1000067443 148
100 3300007076 Ga0075435_100008993 Ga0075435_1000089936 148
101 3300007076 Ga0075435_100021347 Ga0075435_1000213473 148
102 3300007076 Ga0075435_100727942 Ga0075435_1007279422 148
103 3300009094 Ga0111539_10008389 Ga0111539_1000838912 148
104 3300009094 Ga0111539_10012118 Ga0111539_100121183 148
105 3300009094 Ga0111539_11847574 Ga0111539_118475741 148
106 3300009147 Ga0114129_10000287 Ga0114129_1000028724 148
107 3300009147 Ga0114129_10003614 Ga0114129_1000361413 148
108 3300009147 Ga0114129_10003966 Ga0114129_100039662 148
109 3300009147 Ga0114129_10005903 Ga0114129_1000590310 148
110 3300009147 Ga0114129_10023163 Ga0114129_100231637 148
111 3300009147 Ga0114129_10035739 Ga0114129_100357393 148
112 3300009147 Ga0114129_10097423 Ga0114129_100974232 148
113 3300009147 Ga0114129_10372699 Ga0114129_103726992 148
114 3300009147 Ga0114129_10643488 Ga0114129_106434883 148
115 3300009177 Ga0105248_10537273 Ga0105248_105372732 148
116 3300009553 Ga0105249_10326409 Ga0105249_103264093 148
117 3300009553 Ga0105249_11731179 Ga0105249_117311791 148
118 3300011119 Ga0105246_10384410 Ga0105246_103844102 148
119 3300013297 Ga0157378_10197255 Ga0157378_101972554 148
120 3300013306 Ga0163162_10714226 Ga0163162_107142262 148
121 3300013308 Ga0157375_11450509 Ga0157375_114505091 148
122 3300025910 Ga0207684_10005453 Ga0207684_1000545312 148
123 3300025910 Ga0207684_10113063 Ga0207684_101130633 148
124 3300025918 Ga0207662_10294856 Ga0207662_102948562 148
125 3300025922 Ga0207646_10238150 Ga0207646_102381501 148
126 3300025922 Ga0207646_11009375 Ga0207646_110093752 148
127 3300025931 Ga0207644_10106731 Ga0207644_101067313 148
128 3300025933 Ga0207706_10059058 Ga0207706_100590584 148
129 3300025961 Ga0207712_10032157 Ga0207712_100321574 148
130 3300025986 Ga0207658_10453418 Ga0207658_104534181 148
131 3300026118 Ga0207675_100471574 Ga0207675_1004715742 148
132 3300027876 Ga0209974_10025141 Ga0209974_100251412 148
133 3300027907 Ga0207428_10523904 Ga0207428_105239042 148
134 3300027907 Ga0207428_10694839 Ga0207428_106948391 148
135 3300028380 Ga0268265_10452041 Ga0268265_104520412 148
136 3300028380 Ga0268265_10735402 Ga0268265_107354022 148
137 3300028381 Ga0268264_11229540 Ga0268264_112295401 148
138 3300035691 Ga0373931_0186983 Ga0373931_0186983_225_671 148
139 3300037312 Ga0395899_0040355 Ga0395899_0040355_1460_1912 148
140 3300037418 Ga0395900_0012495 Ga0395900_0012495_1071_1523 148
141 3300037418 Ga0395900_0293689 Ga0395900_0293689_472_918 148
142 3300037466 Ga0395898_0009464 Ga0395898_0009464_3134_3586 148
143 3300037471 Ga0395905_0091388 Ga0395905_0091388_1490_1936 148
144 3300038443 Ga0395901_0002730 Ga0395901_0002730_12473_12925 148
145 3300038443 Ga0395901_0039236 Ga0395901_0039236_1536_1982 148
146 3300041408 Ga0439453_0058412 Ga0439453_0058412_132_584 148
147 3300042001 Ga0439441_043933 Ga0439441_043933_207_659 148
148 3300042876 Ga0451577_0444723 Ga0451577_0444723_360_806 148
149 3300045051 Ga0451576_0687518 Ga0451576_0687518_261_707 148
150 3300045051 Ga0451576_0731648 Ga0451576_0731648_362_820 148
151 3300045051 Ga0451576_0963328 Ga0451576_0963328_166_612 148
152 3300046472 Ga0495580_0017124 Ga0495580_0017124_1995_2441 148
153 3300046528 Ga0495642_0094172 Ga0495642_0094172_281_727 148
154 3300046528 Ga0495642_0448544 Ga0495642_0448544_93_539 148
155 3300046615 Ga0495656_0059163 Ga0495656_0059163_888_1340 148
156 3300046664 Ga0495659_0134961 Ga0495659_0134961_289_735 148
157 3300046684 Ga0495669_0244370 Ga0495669_0244370_264_710 148
158 3300048907 Ga0496104_0500076 Ga0496104_0500076_218_664 148
159 3300048909 Ga0496106_0242021 Ga0496106_0242021_270_722 148
160 3300048910 Ga0496107_0372173 Ga0496107_0372173_156_608 148
161 3300049568 Ga0501031_0835858 Ga0501031_0835858_77_526 148
162 3300049569 Ga0501032_0325340 Ga0501032_0325340_190_642 148
163 3300049570 Ga0501033_0004324 Ga0501033_0004324_9418_9870 148
164 3300049570 Ga0501033_0100487 Ga0501033_0100487_933_1385 148
165 3300049571 Ga0501034_0272977 Ga0501034_0272977_711_1163 148
166 3300049572 Ga0501036_0021486 Ga0501036_0021486_4557_5009 148
167 3300049572 Ga0501036_0088617 Ga0501036_0088617_333_785 148
168 3300049572 Ga0501036_1250209 Ga0501036_1250209_140_592 148
169 3300049573 Ga0501037_0568507 Ga0501037_0568507_207_656 148
170 3300049574 Ga0501038_0002055 Ga0501038_0002055_2815_3267 148
171 3300049574 Ga0501038_0006322 Ga0501038_0006322_4012_4464 148
172 3300049574 Ga0501038_0179383 Ga0501038_0179383_1011_1487 148
173 3300049574 Ga0501038_0528278 Ga0501038_0528278_45_500 148
174 3300049575 Ga0501039_0001942 Ga0501039_0001942_866_1318 148
175 3300049575 Ga0501039_0034389 Ga0501039_0034389_499_951 148
176 3300049575 Ga0501039_0065152 Ga0501039_0065152_462_914 148
177 3300049575 Ga0501039_0303873 Ga0501039_0303873_583_1035 148
178 3300049575 Ga0501039_0847648 Ga0501039_0847648_138_593 148
179 3300049576 Ga0501040_0009318 Ga0501040_0009318_4601_5053 148
180 3300049576 Ga0501040_0024954 Ga0501040_0024954_1030_1482 148
181 3300049576 Ga0501040_0177122 Ga0501040_0177122_1044_1496 148
182 3300049576 Ga0501040_0219224 Ga0501040_0219224_478_930 148
183 3300049576 Ga0501040_0499272 Ga0501040_0499272_17_466 148
184 3300049577 Ga0501041_0005362 Ga0501041_0005362_2625_3077 148
185 3300049577 Ga0501041_0016545 Ga0501041_0016545_976_1428 148
186 3300049577 Ga0501041_0059270 Ga0501041_0059270_1313_1765 148
187 3300049578 Ga0501042_0005811 Ga0501042_0005811_1936_2388 148
188 3300049578 Ga0501042_0043994 Ga0501042_0043994_2213_2665 148
189 3300049578 Ga0501042_0618070 Ga0501042_0618070_121_573 148
190 3300049579 Ga0501043_0023622 Ga0501043_0023622_4316_4768 148
191 3300049579 Ga0501043_0098489 Ga0501043_0098489_543_995 148
192 3300049579 Ga0501043_0610564 Ga0501043_0610564_330_782 148
193 3300049580 Ga0501046_0017487 Ga0501046_0017487_866_1318 148
194 3300049580 Ga0501046_0067114 Ga0501046_0067114_1286_1738 148
195 3300049580 Ga0501046_0069909 Ga0501046_0069909_1866_2318 148
196 3300049580 Ga0501046_0157566 Ga0501046_0157566_230_679 148
197 3300049580 Ga0501046_0256977 Ga0501046_0256977_782_1234 148
198 3300049582 Ga0501048_0000432 Ga0501048_0000432_17702_18154 148
199 3300049582 Ga0501048_0034810 Ga0501048_0034810_452_904 148
200 3300049582 Ga0501048_0219020 Ga0501048_0219020_815_1267 148
201 3300049582 Ga0501048_0249234 Ga0501048_0249234_125_577 148
202 3300049582 Ga0501048_0361356 Ga0501048_0361356_421_876 148
203 3300049582 Ga0501048_0523812 Ga0501048_0523812_346_795 148
204 3300049584 Ga0501068_0012020 Ga0501068_0012020_350_802 148
205 3300049584 Ga0501068_0038927 Ga0501068_0038927_2359_2811 148
206 3300049584 Ga0501068_0060467 Ga0501068_0060467_1337_1789 148
207 3300049584 Ga0501068_1213150 Ga0501068_1213150_15_467 148
208 3300049585 Ga0501069_0217833 Ga0501069_0217833_408_860 148
209 3300049585 Ga0501069_0329130 Ga0501069_0329130_416_868 148
210 3300049585 Ga0501069_0553812 Ga0501069_0553812_98_544 148
211 3300049586 Ga0501070_0406919 Ga0501070_0406919_541_993 148
212 3300049587 Ga0501071_0002678 Ga0501071_0002678_6770_7222 148
213 3300049587 Ga0501071_0169389 Ga0501071_0169389_899_1351 148
214 3300049588 Ga0501072_0006879 Ga0501072_0006879_2173_2625 148
215 3300049588 Ga0501072_0014287 Ga0501072_0014287_5454_5906 148
216 3300049588 Ga0501072_0019420 Ga0501072_0019420_1735_2187 148
217 3300049588 Ga0501072_0299630 Ga0501072_0299630_796_1248 148
218 3300049588 Ga0501072_0518304 Ga0501072_0518304_476_931 148
219 3300049589 Ga0501073_0223170 Ga0501073_0223170_427_879 148
220 3300049589 Ga0501073_0583720 Ga0501073_0583720_89_541 148
221 3300049589 Ga0501073_0626102 Ga0501073_0626102_249_701 148
222 3300049590 Ga0501074_0021526 Ga0501074_0021526_2763_3215 148
223 3300049590 Ga0501074_0035890 Ga0501074_0035890_494_946 148
224 3300049590 Ga0501074_0900720 Ga0501074_0900720_61_513 148
225 3300049591 Ga0501075_0002070 Ga0501075_0002070_5963_6415 148
226 3300049591 Ga0501075_0005304 Ga0501075_0005304_1529_1981 148
227 3300049591 Ga0501075_0038212 Ga0501075_0038212_216_668 148
228 3300049591 Ga0501075_0046825 Ga0501075_0046825_2550_3002 148
229 3300049591 Ga0501075_0197038 Ga0501075_0197038_466_918 148
230 3300049591 Ga0501075_0451352 Ga0501075_0451352_307_762 148
231 3300049591 Ga0501075_0722682 Ga0501075_0722682_203_652 148
232 3300049591 Ga0501075_0728713 Ga0501075_0728713_281_733 148
233 3300049592 Ga0501076_0000066 Ga0501076_0000066_32014_32466 148
234 3300049592 Ga0501076_0007702 Ga0501076_0007702_6654_7106 148
235 3300049592 Ga0501076_0010649 Ga0501076_0010649_1654_2106 148
236 3300049592 Ga0501076_0033537 Ga0501076_0033537_1731_2183 148
237 3300049592 Ga0501076_0057624 Ga0501076_0057624_1315_1767 148
238 3300049592 Ga0501076_0250186 Ga0501076_0250186_530_985 148
239 3300049592 Ga0501076_0987649 Ga0501076_0987649_155_607 148
240 3300049593 Ga0501077_0001136 Ga0501077_0001136_4781_5233 148
241 3300049593 Ga0501077_0081226 Ga0501077_0081226_468_920 148
242 3300049593 Ga0501077_0192434 Ga0501077_0192434_751_1203 148
243 3300049593 Ga0501077_0246539 Ga0501077_0246539_384_836 148
244 3300049741 Ga0501079_0006569 Ga0501079_0006569_1768_2220 148
245 3300049741 Ga0501079_0038036 Ga0501079_0038036_307_759 148
246 3300049741 Ga0501079_0080480 Ga0501079_0080480_964_1419 148
247 3300049742 Ga0501080_0003579 Ga0501080_0003579_5685_6137 148
248 3300049742 Ga0501080_0038802 Ga0501080_0038802_30_482 148
249 3300049742 Ga0501080_0086931 Ga0501080_0086931_59_511 148
250 3300049742 Ga0501080_0505562 Ga0501080_0505562_112_564 148
251 3300049743 Ga0501081_0006079 Ga0501081_0006079_2665_3117 148
252 3300049743 Ga0501081_0012310 Ga0501081_0012310_37_489 148
253 3300049743 Ga0501081_0028076 Ga0501081_0028076_1185_1637 148
254 3300049743 Ga0501081_0036496 Ga0501081_0036496_2835_3287 148
255 3300049743 Ga0501081_0049286 Ga0501081_0049286_118_570 148
256 3300049743 Ga0501081_0050231 Ga0501081_0050231_543_995 148
257 3300049743 Ga0501081_0335196 Ga0501081_0335196_164_613 148
258 3300049744 Ga0501083_0217035 Ga0501083_0217035_426_878 148
259 3300049744 Ga0501083_0318362 Ga0501083_0318362_517_969 148
260 3300049744 Ga0501083_0637043 Ga0501083_0637043_30_482 148
261 3300049822 Ga0501035_0032990 Ga0501035_0032990_1618_2070 148
262 3300049823 Ga0501044_0546830 Ga0501044_0546830_571_1023 148
263 3300049824 Ga0501045_0016312 Ga0501045_0016312_739_1191 148
264 3300049824 Ga0501045_0034171 Ga0501045_0034171_1488_1940 148
265 3300049824 Ga0501045_0042136 Ga0501045_0042136_1114_1566 148
266 3300049824 Ga0501045_0158821 Ga0501045_0158821_891_1340 148
267 3300049824 Ga0501045_0210759 Ga0501045_0210759_779_1231 148
268 3300049824 Ga0501045_0501959 Ga0501045_0501959_363_818 148
269 3300050507 nmdc:mga05p37_13768_c1 nmdc:mga05p37_13768_c1_8080_8526 148
270 3300050507 nmdc:mga05p37_1450_c2 nmdc:mga05p37_1450_c2_8733_9185 148
271 3300050507 nmdc:mga05p37_22283_c1 nmdc:mga05p37_22283_c1_4495_4941 148
272 3300050507 nmdc:mga05p37_250683_c1 nmdc:mga05p37_250683_c1_1213_1674 148
273 3300050507 nmdc:mga05p37_27956_c1 nmdc:mga05p37_27956_c1_949_1413 148
274 3300050507 nmdc:mga05p37_29961_c1 nmdc:mga05p37_29961_c1_5160_5606 148
275 3300050507 nmdc:mga05p37_39979_c1 nmdc:mga05p37_39979_c1_1910_2362 148
276 3300050507 nmdc:mga05p37_65078_c1 nmdc:mga05p37_65078_c1_3538_3984 148
277 3300050507 nmdc:mga05p37_79257_c1 nmdc:mga05p37_79257_c1_1087_1533 148
278 3300050508 nmdc:mga09592_507000_c1 nmdc:mga09592_507000_c1_496_957 148
279 3300050508 nmdc:mga09592_55661_c1 nmdc:mga09592_55661_c1_349_795 148
280 3300050508 nmdc:mga09592_72086_c1 nmdc:mga09592_72086_c1_1762_2214 148
281 3300050508 nmdc:mga09592_8863_c1 nmdc:mga09592_8863_c1_4464_4910 148
282 3300050509 nmdc:mga0qj67_13951_c1 nmdc:mga0qj67_13951_c1_3080_3532 148
283 3300050509 nmdc:mga0qj67_177060_c1 nmdc:mga0qj67_177060_c1_369_815 148
284 3300050510 nmdc:mga06r32_17957_c1 nmdc:mga06r32_17957_c1_3064_3516 148
285 3300050510 nmdc:mga06r32_86175_c1 nmdc:mga06r32_86175_c1_1500_1946 148
286 3300050510 nmdc:mga06r32_91120_c1 nmdc:mga06r32_91120_c1_1673_2119 148
287 3300050511 nmdc:mga08y16_143340_c1 nmdc:mga08y16_143340_c1_567_1013 148
288 3300050511 nmdc:mga08y16_228527_c1 nmdc:mga08y16_228527_c1_229_681 148
289 3300050511 nmdc:mga08y16_550177_c1 nmdc:mga08y16_550177_c1_563_1015 148
290 3300050512 nmdc:mga0n895_20535_c1 nmdc:mga0n895_20535_c1_98_544 148
291 3300050512 nmdc:mga0n895_25849_c1 nmdc:mga0n895_25849_c1_1730_2176 148
292 3300050512 nmdc:mga0n895_377775_c1 nmdc:mga0n895_377775_c1_872_1324 148
293 3300050512 nmdc:mga0n895_49630_c1 nmdc:mga0n895_49630_c1_3016_3462 148
294 3300050512 nmdc:mga0n895_512453_c1 nmdc:mga0n895_512453_c1_230_676 148
295 3300050513 nmdc:mga0rr50_1029040_c1 nmdc:mga0rr50_1029040_c1_143_595 148
296 3300050513 nmdc:mga0rr50_114987_c1 nmdc:mga0rr50_114987_c1_1344_1790 148
297 3300050513 nmdc:mga0rr50_23019_c1 nmdc:mga0rr50_23019_c1_200_646 148
298 3300050513 nmdc:mga0rr50_4783_c1 nmdc:mga0rr50_4783_c1_6815_7261 148
299 3300050514 nmdc:mga08x19_49103_c1 nmdc:mga08x19_49103_c1_1055_1501 148
300 3300050515 nmdc:mga0a205_203783_c1 nmdc:mga0a205_203783_c1_1292_1744 148
301 3300050515 nmdc:mga0a205_22209_c1 nmdc:mga0a205_22209_c1_1479_1925 148
302 3300050515 nmdc:mga0a205_2719_c1 nmdc:mga0a205_2719_c1_15026_15472 148
303 3300050515 nmdc:mga0a205_419372_c1 nmdc:mga0a205_419372_c1_502_948 148
304 3300050515 nmdc:mga0a205_502482_c1 nmdc:mga0a205_502482_c1_58_510 148
305 3300050515 nmdc:mga0a205_82683_c1 nmdc:mga0a205_82683_c1_763_1209 148
306 3300050515 nmdc:mga0a205_93337_c1 nmdc:mga0a205_93337_c1_1371_1817 148
307 3300054114 Ga0501084_0006950 Ga0501084_0006950_6783_7235 148
308 3300054114 Ga0501084_0007066 Ga0501084_0007066_7032_7484 148
309 3300054114 Ga0501084_0327088 Ga0501084_0327088_820_1275 148
310 3300054114 Ga0501084_0546665 Ga0501084_0546665_193_645 148
311 3300060353 Ga0501082_0000188 Ga0501082_0000188_5078_5530 148
312 3300060353 Ga0501082_0010140 Ga0501082_0010140_6616_7068 148
313 3300060353 Ga0501082_0405966 Ga0501082_0405966_372_821 148
314 3300060353 Ga0501082_0745271 Ga0501082_0745271_24_479 148
315 3300061734 Ga0530510_0000009 Ga0530510_0000009_108464_108916 148
316 3300061734 Ga0530510_0001586 Ga0530510_0001586_4592_5044 148
317 3300061734 Ga0530510_0184346 Ga0530510_0184346_965_1420 148
318 3300003203 JGI25406J46586_10011476 JGI25406J46586_100114763 149
319 3300005295 Ga0065707_10950482 Ga0065707_109504821 149
320 3300005334 Ga0068869_100124928 Ga0068869_1001249282 149
321 3300005336 Ga0070680_100095382 Ga0070680_1000953822 149
322 3300005340 Ga0070689_100449718 Ga0070689_1004497181 149
323 3300005353 Ga0070669_100005950 Ga0070669_1000059502 149
324 3300005406 Ga0070703_10037795 Ga0070703_100377952 149
325 3300005440 Ga0070705_100057908 Ga0070705_1000579082 149
326 3300005444 Ga0070694_100112158 Ga0070694_1001121582 149
327 3300005444 Ga0070694_100461327 Ga0070694_1004613271 149
328 3300005444 Ga0070694_100545747 Ga0070694_1005457472 149
329 3300005445 Ga0070708_100020777 Ga0070708_1000207779 149
330 3300005445 Ga0070708_100039779 Ga0070708_1000397792 149
331 3300005459 Ga0068867_100191411 Ga0068867_1001914112 149
332 3300005459 Ga0068867_100600312 Ga0068867_1006003122 149
333 3300005467 Ga0070706_100021203 Ga0070706_1000212033 149
334 3300005467 Ga0070706_101467962 Ga0070706_1014679621 149
335 3300005468 Ga0070707_100014834 Ga0070707_1000148343 149
336 3300005468 Ga0070707_100029393 Ga0070707_1000293932 149
337 3300005471 Ga0070698_100025496 Ga0070698_1000254964 149
338 3300005518 Ga0070699_100002285 Ga0070699_1000022859 149
339 3300005518 Ga0070699_100082247 Ga0070699_1000822474 149
340 3300005518 Ga0070699_100470084 Ga0070699_1004700842 149
341 3300005530 Ga0070679_101454517 Ga0070679_1014545171 149
342 3300005536 Ga0070697_100069126 Ga0070697_1000691261 149
343 3300005536 Ga0070697_100188543 Ga0070697_1001885432 149
344 3300005536 Ga0070697_100218437 Ga0070697_1002184371 149
345 3300005536 Ga0070697_100546257 Ga0070697_1005462572 149
346 3300005536 Ga0070697_100580170 Ga0070697_1005801702 149
347 3300005543 Ga0070672_100194656 Ga0070672_1001946563 149
348 3300005545 Ga0070695_100252443 Ga0070695_1002524432 149
349 3300005546 Ga0070696_100038253 Ga0070696_1000382533 149
350 3300005546 Ga0070696_100081549 Ga0070696_1000815491 149
351 3300005546 Ga0070696_100119851 Ga0070696_1001198513 149
352 3300005549 Ga0070704_100036960 Ga0070704_1000369604 149
353 3300005615 Ga0070702_100185812 Ga0070702_1001858123 149
354 3300005617 Ga0068859_100152031 Ga0068859_1001520312 149
355 3300005985 Ga0081539_10000050 Ga0081539_10000050230 149
356 3300006173 Ga0070716_100841335 Ga0070716_1008413351 149
357 3300006844 Ga0075428_100005208 Ga0075428_10000520817 149
358 3300006844 Ga0075428_101372856 Ga0075428_1013728561 149
359 3300006846 Ga0075430_100004693 Ga0075430_1000046934 149
360 3300006846 Ga0075430_100004785 Ga0075430_10000478514 149
361 3300006846 Ga0075430_100958208 Ga0075430_1009582082 149
362 3300006847 Ga0075431_100009950 Ga0075431_1000099507 149
363 3300006847 Ga0075431_100010715 Ga0075431_1000107159 149
364 3300006847 Ga0075431_100027525 Ga0075431_1000275256 149
365 3300006847 Ga0075431_100057286 Ga0075431_1000572865 149
366 3300006847 Ga0075431_100565103 Ga0075431_1005651032 149
367 3300006847 Ga0075431_101193928 Ga0075431_1011939282 149
368 3300006847 Ga0075431_101307432 Ga0075431_1013074322 149
369 3300006852 Ga0075433_10002763 Ga0075433_1000276314 149
370 3300006852 Ga0075433_10045911 Ga0075433_100459113 149
371 3300006852 Ga0075433_10664086 Ga0075433_106640861 149
372 3300006871 Ga0075434_100040122 Ga0075434_1000401223 149
373 3300006871 Ga0075434_100243610 Ga0075434_1002436102 149
374 3300006880 Ga0075429_100020653 Ga0075429_1000206536 149
375 3300006880 Ga0075429_100028520 Ga0075429_1000285205 149
376 3300006880 Ga0075429_100221375 Ga0075429_1002213752 149
377 3300006914 Ga0075436_100002041 Ga0075436_1000020413 149
378 3300006914 Ga0075436_100088382 Ga0075436_1000883823 149
379 3300006931 Ga0097620_100152029 Ga0097620_1001520292 149
380 3300007076 Ga0075435_100902703 Ga0075435_1009027032 149
381 3300007076 Ga0075435_101100218 Ga0075435_1011002182 149
382 3300007265 Ga0099794_10012252 Ga0099794_100122521 149
383 3300007265 Ga0099794_10113318 Ga0099794_101133182 149
384 3300009094 Ga0111539_10051679 Ga0111539_100516792 149
385 3300009098 Ga0105245_11257363 Ga0105245_112573631 149
386 3300009147 Ga0114129_10035830 Ga0114129_100358308 149
387 3300009147 Ga0114129_10083755 Ga0114129_100837555 149
388 3300009147 Ga0114129_10189942 Ga0114129_101899422 149
389 3300009147 Ga0114129_10419391 Ga0114129_104193913 149
390 3300009147 Ga0114129_10676717 Ga0114129_106767172 149
391 3300009148 Ga0105243_10694874 Ga0105243_106948742 149
392 3300009174 Ga0105241_10022916 Ga0105241_100229161 149
393 3300009174 Ga0105241_11331113 Ga0105241_113311132 149
394 3300009176 Ga0105242_10666252 Ga0105242_106662522 149
395 3300009176 Ga0105242_11334827 Ga0105242_113348272 149
396 3300013297 Ga0157378_10233843 Ga0157378_102338433 149
397 3300013306 Ga0163162_10308119 Ga0163162_103081192 149
398 3300014326 Ga0157380_11381956 Ga0157380_113819562 149
399 3300025903 Ga0207680_10180534 Ga0207680_101805342 149
400 3300025910 Ga0207684_10000470 Ga0207684_1000047031 149
401 3300025910 Ga0207684_10060504 Ga0207684_100605044 149
402 3300025917 Ga0207660_10088314 Ga0207660_100883143 149
403 3300025921 Ga0207652_10358859 Ga0207652_103588592 149
404 3300025922 Ga0207646_10003035 Ga0207646_1000303515 149
405 3300025922 Ga0207646_10007481 Ga0207646_100074816 149
406 3300025923 Ga0207681_10022683 Ga0207681_100226832 149
407 3300025939 Ga0207665_10849422 Ga0207665_108494221 149
408 3300025940 Ga0207691_10084093 Ga0207691_100840934 149
409 3300025942 Ga0207689_10156024 Ga0207689_101560242 149
410 3300026075 Ga0207708_10195028 Ga0207708_101950283 149
411 3300026088 Ga0207641_10401740 Ga0207641_104017402 149
412 3300027907 Ga0207428_10466607 Ga0207428_104666071 149
413 3300031548 Ga0307408_100027799 Ga0307408_1000277993 149
414 3300031548 Ga0307408_100045999 Ga0307408_1000459993 149
415 3300031731 Ga0307405_11398203 Ga0307405_113982032 149
416 3300031824 Ga0307413_10801973 Ga0307413_108019731 149
417 3300031903 Ga0307407_10953814 Ga0307407_109538141 149
418 3300031911 Ga0307412_10675033 Ga0307412_106750332 149
419 3300031995 Ga0307409_100111716 Ga0307409_1001117161 149
420 3300031995 Ga0307409_101253961 Ga0307409_1012539612 149
421 3300032002 Ga0307416_100223532 Ga0307416_1002235322 149
422 3300032002 Ga0307416_100323112 Ga0307416_1003231122 149
423 3300032002 Ga0307416_100708968 Ga0307416_1007089682 149
424 3300032002 Ga0307416_101148428 Ga0307416_1011484282 149
425 3300032005 Ga0307411_10147036 Ga0307411_101470362 149
426 3300032005 Ga0307411_10314593 Ga0307411_103145932 149
427 3300032005 Ga0307411_10859609 Ga0307411_108596092 149
428 3300032005 Ga0307411_11588582 Ga0307411_115885822 149
429 3300032126 Ga0307415_101178762 Ga0307415_1011787621 149
430 3300034816 Ga0373930_0009660 Ga0373930_0009660_258_713 149
431 3300035691 Ga0373931_0031620 Ga0373931_0031620_1850_2305 149
432 3300038996 Ga0242420_058256 Ga0242420_058256_59_508 149
433 3300041413 Ga0439465_0240722 Ga0439465_0240722_79_528 149
434 3300042436 Ga0439435_0137412 Ga0439435_0137412_281_736 149
435 3300045051 Ga0451576_0415225 Ga0451576_0415225_463_912 149
436 3300045051 Ga0451576_0577775 Ga0451576_0577775_403_858 149
437 3300045051 Ga0451576_0830622 Ga0451576_0830622_74_529 149
438 3300046455 Ga0495603_0067839 Ga0495603_0067839_195_650 149
439 3300046684 Ga0495669_0045570 Ga0495669_0045570_832_1287 149
440 3300046684 Ga0495669_0059250 Ga0495669_0059250_386_841 149
441 3300047445 Ga0495677_0334411 Ga0495677_0334411_106_561 149
442 3300048905 Ga0496102_0013333 Ga0496102_0013333_1381_1836 149
443 3300048906 Ga0496103_0301905 Ga0496103_0301905_532_987 149
444 3300048909 Ga0496106_0049337 Ga0496106_0049337_141_596 149
445 3300048910 Ga0496107_1074509 Ga0496107_1074509_48_500 149
446 3300049513 Ga0501290_050710 Ga0501290_050710_149_601 149
447 3300049568 Ga0501031_0051217 Ga0501031_0051217_401_850 149
448 3300049568 Ga0501031_0319504 Ga0501031_0319504_395_844 149
449 3300049568 Ga0501031_0946563 Ga0501031_0946563_61_513 149
450 3300049570 Ga0501033_0030310 Ga0501033_0030310_791_1249 149
451 3300049572 Ga0501036_0068992 Ga0501036_0068992_735_1193 149
452 3300049572 Ga0501036_0663994 Ga0501036_0663994_312_761 149
453 3300049572 Ga0501036_0865849 Ga0501036_0865849_46_495 149
454 3300049574 Ga0501038_0302115 Ga0501038_0302115_267_716 149
455 3300049575 Ga0501039_0536785 Ga0501039_0536785_95_550 149
456 3300049575 Ga0501039_0943369 Ga0501039_0943369_19_471 149
457 3300049575 Ga0501039_1521354 Ga0501039_1521354_50_499 149
458 3300049576 Ga0501040_0234280 Ga0501040_0234280_289_747 149
459 3300049576 Ga0501040_0579458 Ga0501040_0579458_122_571 149
460 3300049577 Ga0501041_0009811 Ga0501041_0009811_3614_4072 149
461 3300049577 Ga0501041_0597143 Ga0501041_0597143_60_509 149
462 3300049578 Ga0501042_0297474 Ga0501042_0297474_222_671 149
463 3300049578 Ga0501042_0470226 Ga0501042_0470226_196_651 149
464 3300049578 Ga0501042_0531645 Ga0501042_0531645_273_722 149
465 3300049578 Ga0501042_0720658 Ga0501042_0720658_32_490 149
466 3300049580 Ga0501046_0074595 Ga0501046_0074595_1936_2385 149
467 3300049582 Ga0501048_0351021 Ga0501048_0351021_582_1037 149
468 3300049584 Ga0501068_0131351 Ga0501068_0131351_75_524 149
469 3300049584 Ga0501068_0181678 Ga0501068_0181678_788_1237 149
470 3300049584 Ga0501068_0287645 Ga0501068_0287645_458_916 149
471 3300049585 Ga0501069_0082293 Ga0501069_0082293_209_658 149
472 3300049586 Ga0501070_0598515 Ga0501070_0598515_72_527 149
473 3300049587 Ga0501071_0093429 Ga0501071_0093429_1458_1907 149
474 3300049587 Ga0501071_0202557 Ga0501071_0202557_895_1353 149
475 3300049587 Ga0501071_0847625 Ga0501071_0847625_198_647 149
476 3300049588 Ga0501072_0042242 Ga0501072_0042242_2034_2489 149
477 3300049588 Ga0501072_0042399 Ga0501072_0042399_71_520 149
478 3300049588 Ga0501072_0113326 Ga0501072_0113326_1008_1457 149
479 3300049588 Ga0501072_0120548 Ga0501072_0120548_620_1078 149
480 3300049588 Ga0501072_0160302 Ga0501072_0160302_1176_1631 149
481 3300049590 Ga0501074_0225950 Ga0501074_0225950_751_1200 149
482 3300049590 Ga0501074_0553614 Ga0501074_0553614_91_540 149
483 3300049591 Ga0501075_0024052 Ga0501075_0024052_1678_2127 149
484 3300049591 Ga0501075_0069110 Ga0501075_0069110_17_475 149
485 3300049592 Ga0501076_0018794 Ga0501076_0018794_2933_3391 149
486 3300049592 Ga0501076_0094387 Ga0501076_0094387_728_1186 149
487 3300049592 Ga0501076_0145325 Ga0501076_0145325_268_717 149
488 3300049592 Ga0501076_0235153 Ga0501076_0235153_922_1371 149
489 3300049592 Ga0501076_1328568 Ga0501076_1328568_40_492 149
490 3300049593 Ga0501077_0003941 Ga0501077_0003941_3917_4375 149
491 3300049593 Ga0501077_0006907 Ga0501077_0006907_33_482 149
492 3300049593 Ga0501077_0759320 Ga0501077_0759320_14_463 149
493 3300049593 Ga0501077_0995369 Ga0501077_0995369_62_520 149
494 3300049741 Ga0501079_0019221 Ga0501079_0019221_3254_3703 149
495 3300049741 Ga0501079_0028931 Ga0501079_0028931_1662_2120 149
496 3300049741 Ga0501079_0113955 Ga0501079_0113955_1247_1696 149
497 3300049741 Ga0501079_0783285 Ga0501079_0783285_109_588 149
498 3300049741 Ga0501079_0933678 Ga0501079_0933678_214_672 149
499 3300049742 Ga0501080_0090128 Ga0501080_0090128_460_918 149
500 3300049742 Ga0501080_0203492 Ga0501080_0203492_739_1188 149
501 3300049742 Ga0501080_0437932 Ga0501080_0437932_681_1136 149
502 3300049743 Ga0501081_0040956 Ga0501081_0040956_2385_2834 149
503 3300049743 Ga0501081_0063315 Ga0501081_0063315_293_742 149
504 3300049743 Ga0501081_0142308 Ga0501081_0142308_867_1316 149
505 3300049743 Ga0501081_0617043 Ga0501081_0617043_179_634 149
506 3300049824 Ga0501045_0022447 Ga0501045_0022447_855_1313 149
507 3300049824 Ga0501045_0023174 Ga0501045_0023174_429_884 149
508 3300049824 Ga0501045_0035326 Ga0501045_0035326_2689_3138 149
509 3300049824 Ga0501045_0476180 Ga0501045_0476180_397_855 149
510 3300050507 nmdc:mga05p37_128134_c1 nmdc:mga05p37_128134_c1_2018_2467 149
511 3300050507 nmdc:mga05p37_13715_c1 nmdc:mga05p37_13715_c1_567_1016 149
512 3300050507 nmdc:mga05p37_27212_c1 nmdc:mga05p37_27212_c1_462_911 149
513 3300050507 nmdc:mga05p37_286475_c1 nmdc:mga05p37_286475_c1_417_869 149
514 3300050507 nmdc:mga05p37_677505_c1 nmdc:mga05p37_677505_c1_342_797 149
515 3300050507 nmdc:mga05p37_68561_c1 nmdc:mga05p37_68561_c1_2929_3384 149
516 3300050508 nmdc:mga09592_1890_c1 nmdc:mga09592_1890_c1_9581_10030 149
517 3300050508 nmdc:mga09592_80660_c1 nmdc:mga09592_80660_c1_2186_2635 149
518 3300050508 nmdc:mga09592_920400_c1 nmdc:mga09592_920400_c1_235_684 149
519 3300050509 nmdc:mga0qj67_21498_c1 nmdc:mga0qj67_21498_c1_3765_4220 149
520 3300050509 nmdc:mga0qj67_40703_c1 nmdc:mga0qj67_40703_c1_814_1263 149
521 3300050509 nmdc:mga0qj67_80194_c1 nmdc:mga0qj67_80194_c1_1946_2395 149
522 3300050510 nmdc:mga06r32_167915_c1 nmdc:mga06r32_167915_c1_321_776 149
523 3300050510 nmdc:mga06r32_227554_c1 nmdc:mga06r32_227554_c1_1363_1812 149
524 3300050510 nmdc:mga06r32_509994_c1 nmdc:mga06r32_509994_c1_354_821 149
525 3300050510 nmdc:mga06r32_553713_c1 nmdc:mga06r32_553713_c1_83_538 149
526 3300050510 nmdc:mga06r32_55846_c1 nmdc:mga06r32_55846_c1_2525_2974 149
527 3300050510 nmdc:mga06r32_633_c1 nmdc:mga06r32_633_c1_16175_16624 149
528 3300050510 nmdc:mga06r32_888387_c1 nmdc:mga06r32_888387_c1_197_649 149
529 3300050511 nmdc:mga08y16_101694_c1 nmdc:mga08y16_101694_c1_1993_2442 149
530 3300050512 nmdc:mga0n895_1237607_c1 nmdc:mga0n895_1237607_c1_89_538 149
531 3300050512 nmdc:mga0n895_13810_c1 nmdc:mga0n895_13810_c1_6278_6727 149
532 3300050512 nmdc:mga0n895_16412_c1 nmdc:mga0n895_16412_c1_1612_2064 149
533 3300050512 nmdc:mga0n895_24907_c1 nmdc:mga0n895_24907_c1_3352_3801 149
534 3300050512 nmdc:mga0n895_54276_c1 nmdc:mga0n895_54276_c1_1964_2467 149
535 3300050512 nmdc:mga0n895_656650_c1 nmdc:mga0n895_656650_c1_23_472 149
536 3300050513 nmdc:mga0rr50_1290977_c1 nmdc:mga0rr50_1290977_c1_34_483 149
537 3300050513 nmdc:mga0rr50_5513_c1 nmdc:mga0rr50_5513_c1_5112_5561 149
538 3300050513 nmdc:mga0rr50_573797_c1 nmdc:mga0rr50_573797_c1_410_859 149
539 3300050514 nmdc:mga08x19_512_c1 nmdc:mga08x19_512_c1_2825_3274 149
540 3300050514 nmdc:mga08x19_8498_c1 nmdc:mga08x19_8498_c1_2488_2943 149
541 3300050515 nmdc:mga0a205_1138127_c1 nmdc:mga0a205_1138127_c1_10_462 149
542 3300050515 nmdc:mga0a205_3306_c1 nmdc:mga0a205_3306_c1_2233_2682 149
543 3300050515 nmdc:mga0a205_407953_c1 nmdc:mga0a205_407953_c1_106_555 149
544 3300050515 nmdc:mga0a205_44577_c1 nmdc:mga0a205_44577_c1_976_1428 149
545 3300050515 nmdc:mga0a205_51055_c1 nmdc:mga0a205_51055_c1_1358_1807 149
546 3300050515 nmdc:mga0a205_52236_c1 nmdc:mga0a205_52236_c1_2376_2879 149
547 3300054114 Ga0501084_0003769 Ga0501084_0003769_9665_10114 149
548 3300054114 Ga0501084_0110318 Ga0501084_0110318_574_1032 149
549 3300054114 Ga0501084_0241084 Ga0501084_0241084_658_1107 149
550 3300054114 Ga0501084_0282243 Ga0501084_0282243_166_615 149
551 3300054114 Ga0501084_0550415 Ga0501084_0550415_162_611 149
552 3300054114 Ga0501084_0676552 Ga0501084_0676552_333_785 149
553 3300054114 Ga0501084_0765404 Ga0501084_0765404_139_597 149
554 3300060353 Ga0501082_0005447 Ga0501082_0005447_3146_3604 149
555 3300060353 Ga0501082_0122615 Ga0501082_0122615_1499_1948 149
556 3300060353 Ga0501082_0330266 Ga0501082_0330266_329_784 149
557 3300060353 Ga0501082_1476715 Ga0501082_1476715_129_578 149
558 3300061734 Ga0530510_0003012 Ga0530510_0003012_4434_4886 149
559 3300061734 Ga0530510_0006678 Ga0530510_0006678_2667_3125 149
560 3300061734 Ga0530510_0134525 Ga0530510_0134525_1057_1536 149
561 3300061734 Ga0530510_0145198 Ga0530510_0145198_398_847 149
562 3300061734 Ga0530510_0170169 Ga0530510_0170169_493_948 149
563 3300061734 Ga0530510_0422532 Ga0530510_0422532_81_530 149
564 3300061734 Ga0530510_0568804 Ga0530510_0568804_123_572 149
565 3300061734 Ga0530510_0654705 Ga0530510_0654705_31_480 149
566 3300061734 Ga0530510_0807026 Ga0530510_0807026_71_520 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

10

127

0.94

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

12

138

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fzx-assembly1.cif.gz_A-2 crystal structure of a putative exported protein with ymcc-like fold (bf2203) from bacteroides fragilis nctc 9343 at 2.22 a resolution 0.8743 101 145
2ooi-assembly1.cif.gz_B the crystal structure of gene product sa0254 from staphylocococcus aureus subsp. aureus n315 0.8474 119 142
3e29-assembly1.cif.gz_D x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a. 0.8359 83 144
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.8343 5 148
1q6w-assembly2.cif.gz_C x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius 0.8307 5 148
ID Description Score Start End Superfamily
af_O01913_702_992_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8693 101 143 3.90.190.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8533 1 148 3.10.129.10
4o3vA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.8499 101 145 3.10.450.230
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8455 84 145 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8429 1 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A355PPI8-F1-model_v4 Dehydratase 0.9518 79 148
AF-A0A4Q3NL72-F1-model_v4 deleted 0.9132 81 149
AF-A0A2V7FEZ8-F1-model_v4 Acyl dehydratase 0.908 2 149
AF-A0A535WQ02-F1-model_v4 MaoC-like domain-containing protein 0.9063 4 149
AF-A0A3C0W9P1-F1-model_v4 MaoC-like domain-containing protein 0.905 51 145

Feature Viewer

pLDDT pTM Quality
86.46 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map