F464322

General Info

Members Datasets Scaffolds Average Seq Length
565 276 1130 289

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_43110_c1|nmdc:mga00v17_43110_c1_494_1483
Length 329
Sequence MVDVDGARNGAFGRIGERRAAPGEWRRRQGRRPSADPAAYTTRMSTAASAYAKPDVLVSTEWLAGQLDNPSIRVIESNEDTLLYASGHIPGAAHVDWTADLNDQVRRDYITRDGFEALMSRIGATNDTTVVFYGDKNNWWATYAFWVFQLFGHTKAKILNGGRLKWEKEGRELTRDVPTFAPSQYKAPERNDKAIRAFRDDVLKVVQEKGQLVDVRSPDEYSGKRLHMPEYPNEGALRGGHIPGAKSVPWAKAVNPENGTFKSVDELKKLYIDEQGLDPAKPVTAYCRIGERSSHTWFALTYLLGFPNVRNYDGSWTEWGNSVGLPIEK

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
239 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
240 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.32
Nodule 0
Rhizoplane 1.77
Rhizosphere 89.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_43110_c1 3300050491 Bacteria 2716
2 Ga0058863_11641412 3300004799 Bacteria 1281
3 Ga0058861_11647952 3300004800 Bacteria 1306
4 Ga0058862_12625230 3300004803 Bacteria 1710
5 Ga0065712_10085313 3300005290 Bacteria 2704
6 Ga0065715_10011234 3300005293 Bacteria 2500
7 Ga0065715_10091806 3300005293 Bacteria 5539
8 Ga0065715_10172956 3300005293 Bacteria 1533
9 Ga0065707_10255542 3300005295 Bacteria 1112
10 Ga0070676_10005157 3300005328 Bacteria 6937
11 Ga0070676_10088920 3300005328 Bacteria 1888
12 Ga0070676_10232624 3300005328 Bacteria 1222
13 Ga0070683_100021081 3300005329 Bacteria 5812
14 Ga0070690_100004011 3300005330 Bacteria 8145
15 Ga0070690_100234546 3300005330 Bacteria 1292
16 Ga0070690_100291135 3300005330 Bacteria 1168
17 Ga0070670_100016303 3300005331 Bacteria 6381
18 Ga0070670_100063265 3300005331 Bacteria 3175
19 Ga0070670_100118064 3300005331 Bacteria 2287
20 Ga0070666_10055957 3300005335 Bacteria 2663
21 Ga0070666_10133419 3300005335 Bacteria 1727
22 Ga0070682_100217021 3300005337 Bacteria 1359
23 Ga0070660_100157422 3300005339 Bacteria 1829
24 Ga0070689_100157913 3300005340 Bacteria 1832
25 Ga0070689_100200885 3300005340 Bacteria 1628
26 Ga0070689_100258044 3300005340 Bacteria 1440
27 Ga0070687_100070387 3300005343 Bacteria 1876
28 Ga0070669_100000069 3300005353 Bacteria 100095
29 Ga0070669_100325872 3300005353 Bacteria 1241
30 Ga0070671_100008463 3300005355 Bacteria 8244
31 Ga0070674_100009531 3300005356 Bacteria 5815
32 Ga0070674_100102575 3300005356 Bacteria 2087
33 Ga0070673_100007874 3300005364 Bacteria 7060
34 Ga0070673_100056624 3300005364 Bacteria 3094
35 Ga0070673_100237623 3300005364 Bacteria 1583
36 Ga0070709_10000089 3300005434 Bacteria 65260
37 Ga0070710_10026796 3300005437 Bacteria 3067
38 Ga0070701_10016227 3300005438 Bacteria 3457
39 Ga0070705_100148869 3300005440 Bacteria 1550
40 Ga0070700_100005926 3300005441 Bacteria 6494
41 Ga0070694_100044090 3300005444 Bacteria 2984
42 Ga0070708_100342445 3300005445 Bacteria 1409
43 Ga0070678_100441992 3300005456 Bacteria 1138
44 Ga0070678_100459038 3300005456 Bacteria 1117
45 Ga0070662_100067096 3300005457 Bacteria 2634
46 Ga0070662_100107840 3300005457 Bacteria 2117
47 Ga0070681_10315420 3300005458 Bacteria 1473
48 Ga0068867_100055003 3300005459 Bacteria 2941
49 Ga0070685_10002584 3300005466 Bacteria 9275
50 Ga0070685_10008053 3300005466 Bacteria 5401
51 Ga0070707_100230568 3300005468 Bacteria 1802
52 Ga0070707_100345276 3300005468 Bacteria 1446
53 Ga0070698_100003829 3300005471 Bacteria 16539
54 Ga0070699_100000755 3300005518 Bacteria 29940
55 Ga0070684_100303350 3300005535 Bacteria 1466
56 Ga0068853_100545483 3300005539 Bacteria 1098
57 Ga0070686_100022849 3300005544 Bacteria 3730
58 Ga0070693_100179932 3300005547 Bacteria 1361
59 Ga0070665_100000081 3300005548 Bacteria 184646
60 Ga0070665_100069813 3300005548 Bacteria 3521
61 Ga0068855_100370346 3300005563 Bacteria 1575
62 Ga0068854_100172823 3300005578 Bacteria 1682
63 Ga0070702_100031632 3300005615 Bacteria 2898
64 Ga0070702_100043205 3300005615 Bacteria 2538
65 Ga0068852_100145813 3300005616 Bacteria 2196
66 Ga0068852_100385226 3300005616 Bacteria 1376
67 Ga0068859_100008091 3300005617 Bacteria 10660
68 Ga0068859_100115565 3300005617 Bacteria 2748
69 Ga0068859_100627049 3300005617 Bacteria 1168
70 Ga0068866_10055558 3300005718 Bacteria 2034
71 Ga0068861_100159467 3300005719 Bacteria 1859
72 Ga0068858_100044776 3300005842 Bacteria 4101
73 Ga0068860_100146798 3300005843 Bacteria 2270
74 Ga0068862_100063817 3300005844 Bacteria 3169
75 Ga0081539_10008524 3300005985 Bacteria 8896
76 Ga0075365_10028562 3300006038 Bacteria 3558
77 Ga0075365_10032233 3300006038 Bacteria 3366
78 Ga0075365_10164371 3300006038 Bacteria 1548
79 Ga0075365_10259448 3300006038 Bacteria 1222
80 Ga0075368_10006667 3300006042 Bacteria 4048
81 Ga0075368_10043126 3300006042 Bacteria 1777
82 Ga0075363_100044842 3300006048 Bacteria 2344
83 Ga0075363_100071434 3300006048 Bacteria 1886
84 Ga0075364_10003425 3300006051 Bacteria 9015
85 Ga0075364_10019797 3300006051 Bacteria 4228
86 Ga0075364_10101752 3300006051 Bacteria 1913
87 Ga0075364_10154891 3300006051 Bacteria 1545
88 Ga0075362_10001154 3300006177 Bacteria 8252
89 Ga0075367_10004306 3300006178 Bacteria 6920
90 Ga0075367_10007738 3300006178 Bacteria 5525
91 Ga0075367_10038281 3300006178 Bacteria 2791
92 Ga0075366_10000675 3300006195 Bacteria 16115
93 Ga0075366_10016081 3300006195 Bacteria 4296
94 Ga0075366_10031441 3300006195 Bacteria 3123
95 Ga0075366_10037875 3300006195 Bacteria 2848
96 Ga0075366_10140555 3300006195 Bacteria 1459
97 Ga0075366_10237968 3300006195 Bacteria 1110
98 Ga0097621_100055691 3300006237 Bacteria 3230
99 Ga0097621_100250148 3300006237 Bacteria 1552
100 Ga0097621_100498525 3300006237 Bacteria 1103
101 Ga0075370_10014169 3300006353 Bacteria 4248
102 Ga0075428_100024456 3300006844 Bacteria 6684
103 Ga0075428_100102135 3300006844 Bacteria 3127
104 Ga0075428_100124083 3300006844 Bacteria 2811
105 Ga0075430_100003225 3300006846 Bacteria 13669
106 Ga0075430_100012246 3300006846 Bacteria 7298
107 Ga0075431_100001843 3300006847 Bacteria 20065
108 Ga0075431_100003049 3300006847 Bacteria 16210
109 Ga0075431_100047428 3300006847 Bacteria 4429
110 Ga0075431_100076531 3300006847 Bacteria 3453
111 Ga0075431_100320287 3300006847 Bacteria 1564
112 Ga0075431_100351857 3300006847 Bacteria 1481
113 Ga0075433_10003070 3300006852 Bacteria 12830
114 Ga0075433_10033646 3300006852 Bacteria 4396
115 Ga0075434_100022633 3300006871 Bacteria 6119
116 Ga0075434_100039344 3300006871 Bacteria 4685
117 Ga0075434_100125462 3300006871 Bacteria 2584
118 Ga0075429_100002855 3300006880 Bacteria 14619
119 Ga0075429_100008984 3300006880 Bacteria 8680
120 Ga0075429_100089567 3300006880 Bacteria 2682
121 Ga0075429_100193217 3300006880 Bacteria 1783
122 Ga0068865_100044243 3300006881 Bacteria 3047
123 Ga0068865_100060718 3300006881 Bacteria 2648
124 Ga0075436_100000135 3300006914 Bacteria 44199
125 Ga0075436_100052303 3300006914 Bacteria 2819
126 Ga0097620_100008091 3300006931 Bacteria 10660
127 Ga0097620_100115563 3300006931 Bacteria 2748
128 Ga0097620_100627053 3300006931 Bacteria 1168
129 Ga0075435_100005483 3300007076 Bacteria 8867
130 Ga0075435_100038000 3300007076 Bacteria 3838
131 Ga0075435_100462639 3300007076 Bacteria 1094
132 Ga0105240_10041976 3300009093 Bacteria 5833
133 Ga0105240_10398427 3300009093 Bacteria 1551
134 Ga0111539_10062443 3300009094 Bacteria 4410
135 Ga0111539_10120811 3300009094 Bacteria 3070
136 Ga0111539_10175574 3300009094 Bacteria 2503
137 Ga0111539_10286930 3300009094 Bacteria 1915
138 Ga0111539_10393262 3300009094 Bacteria 1615
139 Ga0105245_10046896 3300009098 Bacteria 3862
140 Ga0105247_10017317 3300009101 Bacteria 4325
141 Ga0114129_10009556 3300009147 Bacteria 13830
142 Ga0114129_10047108 3300009147 Bacteria 6059
143 Ga0114129_10050826 3300009147 Bacteria 5821
144 Ga0114129_10051380 3300009147 Bacteria 5787
145 Ga0114129_10289798 3300009147 Bacteria 2185
146 Ga0114129_10343303 3300009147 Bacteria 1980
147 Ga0114129_10614192 3300009147 Bacteria 1407
148 Ga0114129_10662091 3300009147 Bacteria 1346
149 Ga0105243_10037117 3300009148 Bacteria 3785
150 Ga0105241_10039341 3300009174 Bacteria 3567
151 Ga0105242_10034045 3300009176 Bacteria 4083
152 Ga0105242_10241485 3300009176 Bacteria 1624
153 Ga0105248_10103074 3300009177 Bacteria 3216
154 Ga0105248_10338647 3300009177 Bacteria 1694
155 Ga0105238_10252193 3300009551 Bacteria 1743
156 Ga0105249_10080813 3300009553 Bacteria 3021
157 Ga0157370_10302004 3300013104 Bacteria 1478
158 Ga0163162_10733706 3300013306 Bacteria 1108
159 Ga0157372_10224378 3300013307 Bacteria 2178
160 Ga0157375_10460361 3300013308 Bacteria 1437
161 Ga0163163_10000001 3300014325 Bacteria 622185
162 Ga0163163_10178503 3300014325 Bacteria 2171
163 Ga0157380_10156973 3300014326 Bacteria 1973
164 Ga0157380_10289926 3300014326 Bacteria 1502
165 Ga0157379_10180903 3300014968 Bacteria 1905
166 Ga0157379_10204210 3300014968 Bacteria 1787
167 Ga0157376_10078220 3300014969 Bacteria 2832
168 Ga0157376_10649447 3300014969 Bacteria 1055
169 Ga0163161_10117487 3300017792 Bacteria 1995
170 Ga0197907_10591685 3300020069 Bacteria 1042
171 Ga0206356_11660936 3300020070 Bacteria 1012
172 Ga0206349_1272144 3300020075 Bacteria 951
173 Ga0206354_11704705 3300020081 Bacteria 1011
174 Ga0224712_10038403 3300022467 Bacteria 1788
175 Ga0224712_10079333 3300022467 Bacteria 1351
176 Ga0207697_10038645 3300025315 Bacteria 1957
177 Ga0207692_10038203 3300025898 Bacteria 2354
178 Ga0207688_10030528 3300025901 Bacteria 2972
179 Ga0207680_10023687 3300025903 Bacteria 3357
180 Ga0207699_10000070 3300025906 Bacteria 82065
181 Ga0207645_10175011 3300025907 Bacteria 1407
182 Ga0207705_10026939 3300025909 Bacteria 4097
183 Ga0207695_10453787 3300025913 Bacteria 1165
184 Ga0207695_10563064 3300025913 Bacteria 1021
185 Ga0207671_10099409 3300025914 Bacteria 2202
186 Ga0207693_10190451 3300025915 Bacteria 1614
187 Ga0207662_10010695 3300025918 Bacteria 5072
188 Ga0207662_10014419 3300025918 Bacteria 4435
189 Ga0207657_10075438 3300025919 Bacteria 2846
190 Ga0207657_10157877 3300025919 Bacteria 1844
191 Ga0207681_10000034 3300025923 Bacteria 163792
192 Ga0207681_10019275 3300025923 Bacteria 4309
193 Ga0207694_10092456 3300025924 Bacteria 2388
194 Ga0207650_10009463 3300025925 Bacteria 6656
195 Ga0207650_10049128 3300025925 Bacteria 3114
196 Ga0207650_10067481 3300025925 Bacteria 2684
197 Ga0207659_10280755 3300025926 Bacteria 1361
198 Ga0207687_10202278 3300025927 Bacteria 1553
199 Ga0207700_10566290 3300025928 Bacteria 1009
200 Ga0207644_10145831 3300025931 Bacteria 1827
201 Ga0207690_10258788 3300025932 Bacteria 1347
202 Ga0207706_10025987 3300025933 Bacteria 5243
203 Ga0207706_10084495 3300025933 Bacteria 2791
204 Ga0207670_10000637 3300025936 Bacteria 18717
205 Ga0207670_10205363 3300025936 Bacteria 1499
206 Ga0207670_10252963 3300025936 Bacteria 1362
207 Ga0207669_10290829 3300025937 Bacteria 1237
208 Ga0207704_10130174 3300025938 Bacteria 1741
209 Ga0207704_10211632 3300025938 Bacteria 1427
210 Ga0207665_10027497 3300025939 Bacteria 3757
211 Ga0207691_10066408 3300025940 Bacteria 3263
212 Ga0207691_10107865 3300025940 Bacteria 2479
213 Ga0207711_10043333 3300025941 Bacteria 3837
214 Ga0207711_10079269 3300025941 Bacteria 2866
215 Ga0207689_10041289 3300025942 Bacteria 3817
216 Ga0207689_10064438 3300025942 Bacteria 3015
217 Ga0207661_10015216 3300025944 Bacteria 5657
218 Ga0207651_10026818 3300025960 Bacteria 3607
219 Ga0207651_10038914 3300025960 Bacteria 3130
220 Ga0207651_10515508 3300025960 Bacteria 1035
221 Ga0207712_10252438 3300025961 Bacteria 1426
222 Ga0207668_10071346 3300025972 Bacteria 2481
223 Ga0207668_10116738 3300025972 Bacteria 2013
224 Ga0207640_10051859 3300025981 Bacteria 2669
225 Ga0207703_10125459 3300026035 Bacteria 2209
226 Ga0207703_10328806 3300026035 Bacteria 1402
227 Ga0207639_10553599 3300026041 Bacteria 1056
228 Ga0207708_10003944 3300026075 Bacteria 10921
229 Ga0207708_10077110 3300026075 Bacteria 2557
230 Ga0207641_10010871 3300026088 Bacteria 7457
231 Ga0207641_10132749 3300026088 Bacteria 2238
232 Ga0207648_10028011 3300026089 Bacteria 4999
233 Ga0207676_10055221 3300026095 Bacteria 3117
234 Ga0207676_10263886 3300026095 Bacteria 1556
235 Ga0207675_100015970 3300026118 Bacteria 7007
236 Ga0207675_100037238 3300026118 Bacteria 4539
237 Ga0207675_100380738 3300026118 Bacteria 1387
238 Ga0207675_100837906 3300026118 Bacteria 934
239 Ga0207683_10176590 3300026121 Bacteria 1936
240 Ga0210002_1011273 3300027617 Bacteria 1381
241 Ga0209971_1010929 3300027682 Bacteria 2150
242 Ga0209966_1030712 3300027695 Bacteria 1087
243 Ga0209974_10010962 3300027876 Bacteria 3051
244 Ga0268266_10000562 3300028379 Bacteria 51744
245 Ga0268266_10017663 3300028379 Bacteria 6083
246 Ga0268266_10179322 3300028379 Bacteria 1928
247 Ga0268265_10196234 3300028380 Bacteria 1747
248 Ga0268264_10145802 3300028381 Bacteria 2116
249 Ga0268264_10257365 3300028381 Bacteria 1624
250 Ga0268264_10436950 3300028381 Bacteria 1265
251 Ga0265328_10019342 3300031239 Bacteria 2618
252 Ga0265327_10002601 3300031251 Bacteria 18678
253 Ga0307408_100014550 3300031548 Bacteria 5228
254 Ga0307408_100108392 3300031548 Bacteria 2129
255 Ga0307408_100115656 3300031548 Bacteria 2069
256 Ga0307408_100289015 3300031548 Bacteria 1368
257 Ga0307508_10088654 3300031616 Bacteria 2678
258 Ga0265314_10205823 3300031711 Bacteria 1159
259 Ga0316578_10024382 3300031728 Bacteria 3394
260 Ga0307405_10306263 3300031731 Bacteria 1207
261 Ga0307413_10338976 3300031824 Bacteria 1155
262 Ga0307407_10276896 3300031903 Bacteria 1160
263 Ga0307412_10031649 3300031911 Bacteria 3343
264 Ga0307412_10041059 3300031911 Bacteria 2996
265 Ga0307412_10098338 3300031911 Bacteria 2064
266 Ga0307412_10637934 3300031911 Bacteria 907
267 Ga0307409_100073958 3300031995 Bacteria 2721
268 Ga0307409_100227308 3300031995 Bacteria 1689
269 Ga0307416_100017198 3300032002 Bacteria 5050
270 Ga0307416_100052582 3300032002 Bacteria 3262
271 Ga0307416_100056220 3300032002 Bacteria 3174
272 Ga0307416_100136561 3300032002 Bacteria 2220
273 Ga0307416_100189342 3300032002 Bacteria 1938
274 Ga0307416_100493463 3300032002 Bacteria 1287
275 Ga0307416_100526552 3300032002 Bacteria 1251
276 Ga0307414_10322316 3300032004 Bacteria 1316
277 Ga0307411_10026404 3300032005 Bacteria 3497
278 Ga0307411_10031001 3300032005 Bacteria 3284
279 Ga0307411_10129828 3300032005 Bacteria 1840
280 Ga0307411_10161196 3300032005 Bacteria 1680
281 Ga0307415_100202810 3300032126 Bacteria 1575
282 Ga0307415_100274451 3300032126 Bacteria 1383
283 Ga0373934_0012749 3300035086 Bacteria 3174
284 Ga0373952_0016854 3300035092 Bacteria 1492
285 Ga0373953_0090106 3300035117 Bacteria 1282
286 Ga0373953_0172052 3300035117 Bacteria 932
287 Ga0373954_0008708 3300035118 Bacteria 4460
288 Ga0373956_0002180 3300035119 Bacteria 8084
289 Ga0373956_0022379 3300035119 Bacteria 2704
290 Ga0373957_0000222 3300035120 Bacteria 14180
291 Ga0373957_0011087 3300035120 Bacteria 2998
292 Ga0373946_0039768 3300035171 Bacteria 1921
293 Ga0373955_0001027 3300035172 Bacteria 11850
294 Ga0373955_0004581 3300035172 Bacteria 6126
295 Ga0373961_0001431 3300035241 Bacteria 7067
296 Ga0316574_0035303 3300035398 Bacteria 3055
297 Ga0373924_0041251 3300035410 Bacteria 1891
298 Ga0373931_0044617 3300035691 Bacteria 2339
299 Ga0373935_0012363 3300035692 Bacteria 5136
300 Ga0373935_0071747 3300035692 Bacteria 2235
301 Ga0373933_0014518 3300035724 Bacteria 4384
302 Ga0373937_0000327 3300036401 Bacteria 45180
303 Ga0316584_0074936 3300036712 Bacteria 2537
304 Ga0395905_0166617 3300037471 Bacteria 2071
305 Ga0400489_33357 3300039093 Bacteria 3827
306 Ga0439431_0045113 3300041997 Bacteria 1131
307 Ga0439431_0052889 3300041997 Bacteria 1056
308 Ga0439445_0020565 3300042004 Bacteria 1653
309 Ga0439446_0010564 3300042156 Bacteria 2489
310 Ga0439446_0046663 3300042156 Bacteria 1287
311 Ga0450908_004629 3300042184 Bacteria 2648
312 Ga0439435_0002693 3300042436 Bacteria 3575
313 Ga0439435_0028770 3300042436 Bacteria 1496
314 Ga0439464_0060082 3300042439 Bacteria 1112
315 Ga0451577_0043814 3300042876 Bacteria 4007
316 Ga0453683_0047921 3300044673 Bacteria 2680
317 Ga0466963_0101078 3300044694 Bacteria 1974
318 Ga0453684_0418420 3300044712 Bacteria 1497
319 Ga0451576_0008782 3300045051 Bacteria 11821
320 Ga0451576_0009766 3300045051 Bacteria 11092
321 Ga0451576_0296515 3300045051 Bacteria 1690
322 Ga0451576_0430794 3300045051 Bacteria 1384
323 Ga0495592_0003795 3300046454 Bacteria 10907
324 Ga0495592_0081119 3300046454 Bacteria 2346
325 Ga0495638_0003674 3300046460 Bacteria 11950
326 Ga0495651_0016375 3300046462 Bacteria 5741
327 Ga0495651_0074153 3300046462 Bacteria 2582
328 Ga0495653_0236370 3300046463 Bacteria 1220
329 Ga0495608_0054451 3300046511 Bacteria 2644
330 Ga0495618_0000345 3300046514 Bacteria 33320
331 Ga0495628_0031523 3300046516 Bacteria 4287
332 Ga0495652_0116188 3300046529 Bacteria 2143
333 Ga0495586_0145709 3300046535 Bacteria 1331
334 Ga0495667_0157789 3300046559 Bacteria 1460
335 Ga0495667_0161455 3300046559 Bacteria 1441
336 Ga0495634_0030155 3300046642 Bacteria 3748
337 Ga0495657_0013854 3300046675 Bacteria 5934
338 Ga0495599_0096955 3300046678 Bacteria 1838
339 Ga0495600_0193818 3300046809 Bacteria 1306
340 Ga0495600_0362537 3300046809 Bacteria 906
341 Ga0495680_0275472 3300047322 Bacteria 1187
342 Ga0495675_0028411 3300047444 Bacteria 3565
343 Ga0496101_0288780 3300048904 Bacteria 1283
344 Ga0496102_0550772 3300048905 Bacteria 1076
345 Ga0496106_0106447 3300048909 Bacteria 2180
346 Ga0496107_0062113 3300048910 Bacteria 2706
347 Ga0496110_0031543 3300048913 Bacteria 4573
348 Ga0496112_0531556 3300048915 Bacteria 1110
349 Ga0496112_0539582 3300048915 Bacteria 1100
350 Ga0496113_0072006 3300048916 Bacteria 2630
351 Ga0496113_0258867 3300048916 Bacteria 1390
352 Ga0496114_0000025 3300048917 Bacteria 213656
353 Ga0501298_019066 3300049521 Bacteria 1268
354 Ga0501031_0009225 3300049568 Bacteria 6413
355 Ga0501031_0157880 3300049568 Bacteria 1483
356 Ga0501032_0002655 3300049569 Bacteria 13955
357 Ga0501032_0007302 3300049569 Bacteria 8083
358 Ga0501032_0041962 3300049569 Bacteria 3104
359 Ga0501032_0054350 3300049569 Bacteria 2695
360 Ga0501032_0057333 3300049569 Bacteria 2617
361 Ga0501033_0002479 3300049570 Bacteria 15646
362 Ga0501033_0003543 3300049570 Bacteria 12771
363 Ga0501033_0007871 3300049570 Bacteria 8259
364 Ga0501033_0050491 3300049570 Bacteria 3085
365 Ga0501034_0000868 3300049571 Bacteria 44644
366 Ga0501034_0012841 3300049571 Bacteria 8638
367 Ga0501034_0043974 3300049571 Bacteria 4517
368 Ga0501034_0117282 3300049571 Bacteria 2649
369 Ga0501034_0136721 3300049571 Bacteria 2431
370 Ga0501034_0396916 3300049571 Bacteria 1302
371 Ga0501036_0001172 3300049572 Bacteria 19946
372 Ga0501036_0005864 3300049572 Bacteria 9950
373 Ga0501036_0007070 3300049572 Bacteria 9132
374 Ga0501036_0047103 3300049572 Bacteria 3651
375 Ga0501036_0129059 3300049572 Bacteria 2135
376 Ga0501037_0002014 3300049573 Bacteria 14721
377 Ga0501037_0007503 3300049573 Bacteria 7984
378 Ga0501037_0073290 3300049573 Bacteria 2489
379 Ga0501037_0123104 3300049573 Bacteria 1863
380 Ga0501038_0004959 3300049574 Bacteria 12361
381 Ga0501038_0005363 3300049574 Bacteria 11910
382 Ga0501038_0006442 3300049574 Bacteria 10869
383 Ga0501038_0014168 3300049574 Bacteria 7263
384 Ga0501038_0051103 3300049574 Bacteria 3569
385 Ga0501039_0002490 3300049575 Bacteria 13710
386 Ga0501039_0004384 3300049575 Bacteria 10642
387 Ga0501039_0009329 3300049575 Bacteria 7476
388 Ga0501039_0162128 3300049575 Bacteria 1758
389 Ga0501039_0257291 3300049575 Bacteria 1372
390 Ga0501039_0261206 3300049575 Bacteria 1361
391 Ga0501040_0104836 3300049576 Bacteria 1975
392 Ga0501040_0215656 3300049576 Bacteria 1365
393 Ga0501042_0012965 3300049578 Bacteria 5662
394 Ga0501042_0091542 3300049578 Bacteria 2183
395 Ga0501043_0000442 3300049579 Bacteria 37323
396 Ga0501043_0009843 3300049579 Bacteria 7494
397 Ga0501043_0010092 3300049579 Bacteria 7404
398 Ga0501043_0057235 3300049579 Bacteria 3061
399 Ga0501043_0412336 3300049579 Bacteria 1019
400 Ga0501046_0006794 3300049580 Bacteria 10094
401 Ga0501046_0008882 3300049580 Bacteria 8728
402 Ga0501046_0020713 3300049580 Bacteria 5435
403 Ga0501046_0049007 3300049580 Bacteria 3343
404 Ga0501046_0051011 3300049580 Bacteria 3267
405 Ga0501047_0000134 3300049581 Bacteria 89882
406 Ga0501047_0003392 3300049581 Bacteria 15077
407 Ga0501047_0004690 3300049581 Bacteria 12854
408 Ga0501047_0013594 3300049581 Bacteria 7720
409 Ga0501047_0033189 3300049581 Bacteria 4982
410 Ga0501047_0047658 3300049581 Bacteria 4139
411 Ga0501047_0139170 3300049581 Bacteria 2306
412 Ga0501048_0003482 3300049582 Bacteria 11959
413 Ga0501048_0034473 3300049582 Bacteria 3651
414 Ga0501048_0058021 3300049582 Bacteria 2744
415 Ga0501048_0068721 3300049582 Bacteria 2502
416 Ga0501067_0000774 3300049583 Bacteria 17182
417 Ga0501067_0006803 3300049583 Bacteria 6341
418 Ga0501067_0047219 3300049583 Bacteria 2388
419 Ga0501067_0066933 3300049583 Bacteria 1988
420 Ga0501068_0002600 3300049584 Bacteria 9554
421 Ga0501068_0004772 3300049584 Bacteria 7378
422 Ga0501068_0007494 3300049584 Bacteria 6040
423 Ga0501068_0014898 3300049584 Bacteria 4454
424 Ga0501069_0002058 3300049585 Bacteria 10104
425 Ga0501070_0005074 3300049586 Bacteria 11218
426 Ga0501070_0022073 3300049586 Bacteria 5331
427 Ga0501070_0078087 3300049586 Bacteria 2740
428 Ga0501071_0007692 3300049587 Bacteria 7100
429 Ga0501071_0010357 3300049587 Bacteria 6245
430 Ga0501071_0046377 3300049587 Bacteria 3121
431 Ga0501071_0052103 3300049587 Bacteria 2951
432 Ga0501071_0252365 3300049587 Bacteria 1332
433 Ga0501072_0008543 3300049588 Bacteria 7768
434 Ga0501072_0024066 3300049588 Bacteria 4735
435 Ga0501072_0037809 3300049588 Bacteria 3786
436 Ga0501072_0038784 3300049588 Bacteria 3739
437 Ga0501073_0016831 3300049589 Bacteria 5297
438 Ga0501073_0017615 3300049589 Bacteria 5172
439 Ga0501073_0024190 3300049589 Bacteria 4360
440 Ga0501073_0024372 3300049589 Bacteria 4344
441 Ga0501073_0300500 3300049589 Bacteria 1107
442 Ga0501074_0008618 3300049590 Bacteria 7384
443 Ga0501074_0032199 3300049590 Bacteria 3798
444 Ga0501074_0173320 3300049590 Bacteria 1539
445 Ga0501075_0023429 3300049591 Bacteria 4521
446 Ga0501075_0028378 3300049591 Bacteria 4131
447 Ga0501075_0155080 3300049591 Bacteria 1746
448 Ga0501075_0323978 3300049591 Bacteria 1174
449 Ga0501076_0030348 3300049592 Bacteria 4210
450 Ga0501076_0038049 3300049592 Bacteria 3776
451 Ga0501076_0066313 3300049592 Bacteria 2881
452 Ga0501076_0089904 3300049592 Bacteria 2469
453 Ga0501076_0133244 3300049592 Bacteria 2016
454 Ga0501076_0483814 3300049592 Bacteria 1020
455 Ga0501077_0000147 3300049593 Bacteria 38948
456 Ga0501077_0158002 3300049593 Bacteria 1439
457 Ga0501216_013135 3300049660 Bacteria 1369
458 Ga0501221_004453 3300049704 Bacteria 2325
459 Ga0501225_0017724 3300049705 Bacteria 1976
460 Ga0501225_0021701 3300049705 Bacteria 1773
461 Ga0501079_0004794 3300049741 Bacteria 10028
462 Ga0501079_0006110 3300049741 Bacteria 9028
463 Ga0501080_0001786 3300049742 Bacteria 18431
464 Ga0501080_0002203 3300049742 Bacteria 16931
465 Ga0501080_0006020 3300049742 Bacteria 10871
466 Ga0501080_0022799 3300049742 Bacteria 5801
467 Ga0501080_0087125 3300049742 Bacteria 2901
468 Ga0501080_0109328 3300049742 Bacteria 2562
469 Ga0501080_0131912 3300049742 Bacteria 2313
470 Ga0501080_0372933 3300049742 Bacteria 1286
471 Ga0501081_0022184 3300049743 Bacteria 4247
472 Ga0501081_0187276 3300049743 Bacteria 1498
473 Ga0501083_0010805 3300049744 Bacteria 6420
474 Ga0501083_0074261 3300049744 Bacteria 2259
475 Ga0501083_0079992 3300049744 Bacteria 2167
476 Ga0501273_018280 3300049770 Bacteria 932
477 Ga0501035_0001474 3300049822 Bacteria 24086
478 Ga0501035_0016501 3300049822 Bacteria 6810
479 Ga0501035_0023572 3300049822 Bacteria 5646
480 Ga0501035_0217475 3300049822 Bacteria 1632
481 Ga0501035_0243762 3300049822 Bacteria 1528
482 Ga0501044_0009486 3300049823 Bacteria 10596
483 Ga0501044_0009782 3300049823 Bacteria 10429
484 Ga0501044_0011944 3300049823 Bacteria 9412
485 Ga0501044_0068687 3300049823 Bacteria 3609
486 Ga0501045_0004323 3300049824 Bacteria 9797
487 Ga0501045_0097048 3300049824 Bacteria 2180
488 nmdc:mga03n38_37130_c1 3300050490 Bacteria 2099
489 nmdc:mga03n38_62120_c1 3300050490 Bacteria 1703
490 nmdc:mga00v17_91315_c1 3300050491 Bacteria 1913
491 nmdc:mga0yw44_54522_c1 3300050492 Bacteria 2430
492 nmdc:mga0k408_200334_c1 3300050493 Bacteria 1192
493 nmdc:mga0k408_2060_c1 3300050493 Bacteria 10750
494 nmdc:mga0k408_27148_c1 3300050493 Bacteria 3250
495 nmdc:mga06z11_110184_c1 3300050494 Bacteria 1523
496 nmdc:mga06z11_112913_c1 3300050494 Bacteria 1507
497 nmdc:mga06z11_18185_c1 3300050494 Bacteria 3206
498 nmdc:mga06z11_24954_c1 3300050494 Bacteria 2827
499 nmdc:mga06z11_961_c1 3300050494 Bacteria 10490
500 nmdc:mga04h51_57781_c1 3300050495 Bacteria 1321
501 nmdc:mga04h51_67892_c1 3300050495 Bacteria 1238
502 nmdc:mga07m45_134851_c1 3300050496 Bacteria 1429
503 nmdc:mga07m45_28247_c1 3300050496 Bacteria 2615
504 nmdc:mga07m45_8914_c2 3300050496 Bacteria 3574
505 nmdc:mga05p37_131886_c1 3300050507 Bacteria 3066
506 nmdc:mga05p37_168281_c1 3300050507 Bacteria 2674
507 nmdc:mga05p37_333964_c1 3300050507 Bacteria 1789
508 nmdc:mga05p37_39744_c1 3300050507 Bacteria 5776
509 nmdc:mga05p37_514279_c1 3300050507 Bacteria 1371
510 nmdc:mga05p37_69371_c1 3300050507 Bacteria 4336
511 nmdc:mga09592_102453_c1 3300050508 Bacteria 2452
512 nmdc:mga09592_3104_c1 3300050508 Bacteria 13485
513 nmdc:mga09592_406_c1 3300050508 Bacteria 31601
514 nmdc:mga09592_7828_c1 3300050508 Bacteria 8685
515 nmdc:mga0qj67_244854_c1 3300050509 Bacteria 1455
516 nmdc:mga0qj67_38924_c1 3300050509 Bacteria 3732
517 nmdc:mga06r32_236072_c1 3300050510 Bacteria 1816
518 nmdc:mga06r32_308182_c1 3300050510 Bacteria 1569
519 nmdc:mga06r32_39952_c1 3300050510 Bacteria 3572
520 nmdc:mga06r32_447985_c1 3300050510 Bacteria 1271
521 nmdc:mga06r32_6597_c1 3300050510 Bacteria 10426
522 nmdc:mga06r32_6841_c1 3300050510 Bacteria 10246
523 nmdc:mga08y16_164019_c1 3300050511 Bacteria 2308
524 nmdc:mga08y16_178206_c2 3300050511 Bacteria 1371
525 nmdc:mga08y16_426565_c1 3300050511 Bacteria 1355
526 nmdc:mga0n895_130187_c1 3300050512 Bacteria 2541
527 nmdc:mga0n895_3252_c1 3300050512 Bacteria 13023
528 nmdc:mga0n895_41991_c1 3300050512 Bacteria 4448
529 nmdc:mga0n895_79578_c1 3300050512 Bacteria 3264
530 nmdc:mga0n895_98084_c1 3300050512 Bacteria 2937
531 nmdc:mga0rr50_64164_c1 3300050513 Bacteria 2777
532 nmdc:mga08x19_159640_c1 3300050514 Bacteria 1531
533 nmdc:mga08x19_3475_c1 3300050514 Bacteria 9389
534 nmdc:mga0a205_376380_c1 3300050515 Bacteria 1285
535 nmdc:mga0a205_44121_c1 3300050515 Bacteria 4298
536 Ga0495601_0050518 3300053077 Bacteria 2623
537 Ga0495595_0017558 3300053084 Bacteria 3079
538 Ga0500641_0000465 3300053096 Bacteria 14757
539 Ga0500555_001097 3300053103 Bacteria 9000
540 Ga0500568_0009202 3300053139 Bacteria 4710
541 Ga0500616_0000017 3300053153 Bacteria 622969
542 Ga0500616_0001403 3300053153 Bacteria 23216
543 Ga0500645_000233 3300053730 Bacteria 42370
544 Ga0501084_0000937 3300054114 Bacteria 22573
545 Ga0501084_0098629 3300054114 Bacteria 2453
546 Ga0501084_0109461 3300054114 Bacteria 2321
547 Ga0501084_0168000 3300054114 Bacteria 1851
548 Ga0501084_0269959 3300054114 Bacteria 1436
549 Ga0501084_0390611 3300054114 Bacteria 1176
550 Ga0590071_008035 3300059421 Bacteria 2492
551 Ga0590071_026036 3300059421 Bacteria 1387
552 Ga0590075_001291 3300059424 Bacteria 6287
553 Ga0590075_020892 3300059424 Bacteria 1631
554 Ga0590077_001491 3300059426 Bacteria 5438
555 Ga0501082_0000709 3300060353 Bacteria 29299
556 Ga0501082_0008327 3300060353 Bacteria 8946
557 Ga0501082_0010127 3300060353 Bacteria 8116
558 Ga0501082_0010941 3300060353 Bacteria 7809
559 Ga0501082_0021372 3300060353 Bacteria 5582
560 Ga0501082_0091212 3300060353 Bacteria 2631
561 Ga0530510_0010767 3300061734 Bacteria 6418
562 Ga0530510_0025171 3300061734 Bacteria 4255
563 Ga0530510_0097826 3300061734 Bacteria 2146
564 Ga0530510_0146265 3300061734 Bacteria 1743
565 Ga0530510_0163104 3300061734 Bacteria 1649
566 nmdc:mga00v17_43110_c1
567 Ga0058863_11641412
568 Ga0058861_11647952
569 Ga0058862_12625230
570 Ga0065712_10085313
571 Ga0065715_10011234
572 Ga0065715_10091806
573 Ga0065715_10172956
574 Ga0065707_10255542
575 Ga0070676_10005157
576 Ga0070676_10088920
577 Ga0070676_10232624
578 Ga0070683_100021081
579 Ga0070690_100004011
580 Ga0070690_100234546
581 Ga0070690_100291135
582 Ga0070670_100016303
583 Ga0070670_100063265
584 Ga0070670_100118064
585 Ga0070666_10055957
586 Ga0070666_10133419
587 Ga0070682_100217021
588 Ga0070660_100157422
589 Ga0070689_100157913
590 Ga0070689_100200885
591 Ga0070689_100258044
592 Ga0070687_100070387
593 Ga0070669_100000069
594 Ga0070669_100325872
595 Ga0070671_100008463
596 Ga0070674_100009531
597 Ga0070674_100102575
598 Ga0070673_100007874
599 Ga0070673_100056624
600 Ga0070673_100237623
601 Ga0070709_10000089
602 Ga0070710_10026796
603 Ga0070701_10016227
604 Ga0070705_100148869
605 Ga0070700_100005926
606 Ga0070694_100044090
607 Ga0070708_100342445
608 Ga0070678_100441992
609 Ga0070678_100459038
610 Ga0070662_100067096
611 Ga0070662_100107840
612 Ga0070681_10315420
613 Ga0068867_100055003
614 Ga0070685_10002584
615 Ga0070685_10008053
616 Ga0070707_100230568
617 Ga0070707_100345276
618 Ga0070698_100003829
619 Ga0070699_100000755
620 Ga0070684_100303350
621 Ga0068853_100545483
622 Ga0070686_100022849
623 Ga0070693_100179932
624 Ga0070665_100000081
625 Ga0070665_100069813
626 Ga0068855_100370346
627 Ga0068854_100172823
628 Ga0070702_100031632
629 Ga0070702_100043205
630 Ga0068852_100145813
631 Ga0068852_100385226
632 Ga0068859_100008091
633 Ga0068859_100115565
634 Ga0068859_100627049
635 Ga0068866_10055558
636 Ga0068861_100159467
637 Ga0068858_100044776
638 Ga0068860_100146798
639 Ga0068862_100063817
640 Ga0081539_10008524
641 Ga0075365_10028562
642 Ga0075365_10032233
643 Ga0075365_10164371
644 Ga0075365_10259448
645 Ga0075368_10006667
646 Ga0075368_10043126
647 Ga0075363_100044842
648 Ga0075363_100071434
649 Ga0075364_10003425
650 Ga0075364_10019797
651 Ga0075364_10101752
652 Ga0075364_10154891
653 Ga0075362_10001154
654 Ga0075367_10004306
655 Ga0075367_10007738
656 Ga0075367_10038281
657 Ga0075366_10000675
658 Ga0075366_10016081
659 Ga0075366_10031441
660 Ga0075366_10037875
661 Ga0075366_10140555
662 Ga0075366_10237968
663 Ga0097621_100055691
664 Ga0097621_100250148
665 Ga0097621_100498525
666 Ga0075370_10014169
667 Ga0075428_100024456
668 Ga0075428_100102135
669 Ga0075428_100124083
670 Ga0075430_100003225
671 Ga0075430_100012246
672 Ga0075431_100001843
673 Ga0075431_100003049
674 Ga0075431_100047428
675 Ga0075431_100076531
676 Ga0075431_100320287
677 Ga0075431_100351857
678 Ga0075433_10003070
679 Ga0075433_10033646
680 Ga0075434_100022633
681 Ga0075434_100039344
682 Ga0075434_100125462
683 Ga0075429_100002855
684 Ga0075429_100008984
685 Ga0075429_100089567
686 Ga0075429_100193217
687 Ga0068865_100044243
688 Ga0068865_100060718
689 Ga0075436_100000135
690 Ga0075436_100052303
691 Ga0097620_100008091
692 Ga0097620_100115563
693 Ga0097620_100627053
694 Ga0075435_100005483
695 Ga0075435_100038000
696 Ga0075435_100462639
697 Ga0105240_10041976
698 Ga0105240_10398427
699 Ga0111539_10062443
700 Ga0111539_10120811
701 Ga0111539_10175574
702 Ga0111539_10286930
703 Ga0111539_10393262
704 Ga0105245_10046896
705 Ga0105247_10017317
706 Ga0114129_10009556
707 Ga0114129_10047108
708 Ga0114129_10050826
709 Ga0114129_10051380
710 Ga0114129_10289798
711 Ga0114129_10343303
712 Ga0114129_10614192
713 Ga0114129_10662091
714 Ga0105243_10037117
715 Ga0105241_10039341
716 Ga0105242_10034045
717 Ga0105242_10241485
718 Ga0105248_10103074
719 Ga0105248_10338647
720 Ga0105238_10252193
721 Ga0105249_10080813
722 Ga0157370_10302004
723 Ga0163162_10733706
724 Ga0157372_10224378
725 Ga0157375_10460361
726 Ga0163163_10000001
727 Ga0163163_10178503
728 Ga0157380_10156973
729 Ga0157380_10289926
730 Ga0157379_10180903
731 Ga0157379_10204210
732 Ga0157376_10078220
733 Ga0157376_10649447
734 Ga0163161_10117487
735 Ga0197907_10591685
736 Ga0206356_11660936
737 Ga0206349_1272144
738 Ga0206354_11704705
739 Ga0224712_10038403
740 Ga0224712_10079333
741 Ga0207697_10038645
742 Ga0207692_10038203
743 Ga0207688_10030528
744 Ga0207680_10023687
745 Ga0207699_10000070
746 Ga0207645_10175011
747 Ga0207705_10026939
748 Ga0207695_10453787
749 Ga0207695_10563064
750 Ga0207671_10099409
751 Ga0207693_10190451
752 Ga0207662_10010695
753 Ga0207662_10014419
754 Ga0207657_10075438
755 Ga0207657_10157877
756 Ga0207681_10000034
757 Ga0207681_10019275
758 Ga0207694_10092456
759 Ga0207650_10009463
760 Ga0207650_10049128
761 Ga0207650_10067481
762 Ga0207659_10280755
763 Ga0207687_10202278
764 Ga0207700_10566290
765 Ga0207644_10145831
766 Ga0207690_10258788
767 Ga0207706_10025987
768 Ga0207706_10084495
769 Ga0207670_10000637
770 Ga0207670_10205363
771 Ga0207670_10252963
772 Ga0207669_10290829
773 Ga0207704_10130174
774 Ga0207704_10211632
775 Ga0207665_10027497
776 Ga0207691_10066408
777 Ga0207691_10107865
778 Ga0207711_10043333
779 Ga0207711_10079269
780 Ga0207689_10041289
781 Ga0207689_10064438
782 Ga0207661_10015216
783 Ga0207651_10026818
784 Ga0207651_10038914
785 Ga0207651_10515508
786 Ga0207712_10252438
787 Ga0207668_10071346
788 Ga0207668_10116738
789 Ga0207640_10051859
790 Ga0207703_10125459
791 Ga0207703_10328806
792 Ga0207639_10553599
793 Ga0207708_10003944
794 Ga0207708_10077110
795 Ga0207641_10010871
796 Ga0207641_10132749
797 Ga0207648_10028011
798 Ga0207676_10055221
799 Ga0207676_10263886
800 Ga0207675_100015970
801 Ga0207675_100037238
802 Ga0207675_100380738
803 Ga0207675_100837906
804 Ga0207683_10176590
805 Ga0210002_1011273
806 Ga0209971_1010929
807 Ga0209966_1030712
808 Ga0209974_10010962
809 Ga0268266_10000562
810 Ga0268266_10017663
811 Ga0268266_10179322
812 Ga0268265_10196234
813 Ga0268264_10145802
814 Ga0268264_10257365
815 Ga0268264_10436950
816 Ga0265328_10019342
817 Ga0265327_10002601
818 Ga0307408_100014550
819 Ga0307408_100108392
820 Ga0307408_100115656
821 Ga0307408_100289015
822 Ga0307508_10088654
823 Ga0265314_10205823
824 Ga0316578_10024382
825 Ga0307405_10306263
826 Ga0307413_10338976
827 Ga0307407_10276896
828 Ga0307412_10031649
829 Ga0307412_10041059
830 Ga0307412_10098338
831 Ga0307412_10637934
832 Ga0307409_100073958
833 Ga0307409_100227308
834 Ga0307416_100017198
835 Ga0307416_100052582
836 Ga0307416_100056220
837 Ga0307416_100136561
838 Ga0307416_100189342
839 Ga0307416_100493463
840 Ga0307416_100526552
841 Ga0307414_10322316
842 Ga0307411_10026404
843 Ga0307411_10031001
844 Ga0307411_10129828
845 Ga0307411_10161196
846 Ga0307415_100202810
847 Ga0307415_100274451
848 Ga0373934_0012749
849 Ga0373952_0016854
850 Ga0373953_0090106
851 Ga0373953_0172052
852 Ga0373954_0008708
853 Ga0373956_0002180
854 Ga0373956_0022379
855 Ga0373957_0000222
856 Ga0373957_0011087
857 Ga0373946_0039768
858 Ga0373955_0001027
859 Ga0373955_0004581
860 Ga0373961_0001431
861 Ga0316574_0035303
862 Ga0373924_0041251
863 Ga0373931_0044617
864 Ga0373935_0012363
865 Ga0373935_0071747
866 Ga0373933_0014518
867 Ga0373937_0000327
868 Ga0316584_0074936
869 Ga0395905_0166617
870 Ga0400489_33357
871 Ga0439431_0045113
872 Ga0439431_0052889
873 Ga0439445_0020565
874 Ga0439446_0010564
875 Ga0439446_0046663
876 Ga0450908_004629
877 Ga0439435_0002693
878 Ga0439435_0028770
879 Ga0439464_0060082
880 Ga0451577_0043814
881 Ga0453683_0047921
882 Ga0466963_0101078
883 Ga0453684_0418420
884 Ga0451576_0008782
885 Ga0451576_0009766
886 Ga0451576_0296515
887 Ga0451576_0430794
888 Ga0495592_0003795
889 Ga0495592_0081119
890 Ga0495638_0003674
891 Ga0495651_0016375
892 Ga0495651_0074153
893 Ga0495653_0236370
894 Ga0495608_0054451
895 Ga0495618_0000345
896 Ga0495628_0031523
897 Ga0495652_0116188
898 Ga0495586_0145709
899 Ga0495667_0157789
900 Ga0495667_0161455
901 Ga0495634_0030155
902 Ga0495657_0013854
903 Ga0495599_0096955
904 Ga0495600_0193818
905 Ga0495600_0362537
906 Ga0495680_0275472
907 Ga0495675_0028411
908 Ga0496101_0288780
909 Ga0496102_0550772
910 Ga0496106_0106447
911 Ga0496107_0062113
912 Ga0496110_0031543
913 Ga0496112_0531556
914 Ga0496112_0539582
915 Ga0496113_0072006
916 Ga0496113_0258867
917 Ga0496114_0000025
918 Ga0501298_019066
919 Ga0501031_0009225
920 Ga0501031_0157880
921 Ga0501032_0002655
922 Ga0501032_0007302
923 Ga0501032_0041962
924 Ga0501032_0054350
925 Ga0501032_0057333
926 Ga0501033_0002479
927 Ga0501033_0003543
928 Ga0501033_0007871
929 Ga0501033_0050491
930 Ga0501034_0000868
931 Ga0501034_0012841
932 Ga0501034_0043974
933 Ga0501034_0117282
934 Ga0501034_0136721
935 Ga0501034_0396916
936 Ga0501036_0001172
937 Ga0501036_0005864
938 Ga0501036_0007070
939 Ga0501036_0047103
940 Ga0501036_0129059
941 Ga0501037_0002014
942 Ga0501037_0007503
943 Ga0501037_0073290
944 Ga0501037_0123104
945 Ga0501038_0004959
946 Ga0501038_0005363
947 Ga0501038_0006442
948 Ga0501038_0014168
949 Ga0501038_0051103
950 Ga0501039_0002490
951 Ga0501039_0004384
952 Ga0501039_0009329
953 Ga0501039_0162128
954 Ga0501039_0257291
955 Ga0501039_0261206
956 Ga0501040_0104836
957 Ga0501040_0215656
958 Ga0501042_0012965
959 Ga0501042_0091542
960 Ga0501043_0000442
961 Ga0501043_0009843
962 Ga0501043_0010092
963 Ga0501043_0057235
964 Ga0501043_0412336
965 Ga0501046_0006794
966 Ga0501046_0008882
967 Ga0501046_0020713
968 Ga0501046_0049007
969 Ga0501046_0051011
970 Ga0501047_0000134
971 Ga0501047_0003392
972 Ga0501047_0004690
973 Ga0501047_0013594
974 Ga0501047_0033189
975 Ga0501047_0047658
976 Ga0501047_0139170
977 Ga0501048_0003482
978 Ga0501048_0034473
979 Ga0501048_0058021
980 Ga0501048_0068721
981 Ga0501067_0000774
982 Ga0501067_0006803
983 Ga0501067_0047219
984 Ga0501067_0066933
985 Ga0501068_0002600
986 Ga0501068_0004772
987 Ga0501068_0007494
988 Ga0501068_0014898
989 Ga0501069_0002058
990 Ga0501070_0005074
991 Ga0501070_0022073
992 Ga0501070_0078087
993 Ga0501071_0007692
994 Ga0501071_0010357
995 Ga0501071_0046377
996 Ga0501071_0052103
997 Ga0501071_0252365
998 Ga0501072_0008543
999 Ga0501072_0024066
1000 Ga0501072_0037809
1001 Ga0501072_0038784
1002 Ga0501073_0016831
1003 Ga0501073_0017615
1004 Ga0501073_0024190
1005 Ga0501073_0024372
1006 Ga0501073_0300500
1007 Ga0501074_0008618
1008 Ga0501074_0032199
1009 Ga0501074_0173320
1010 Ga0501075_0023429
1011 Ga0501075_0028378
1012 Ga0501075_0155080
1013 Ga0501075_0323978
1014 Ga0501076_0030348
1015 Ga0501076_0038049
1016 Ga0501076_0066313
1017 Ga0501076_0089904
1018 Ga0501076_0133244
1019 Ga0501076_0483814
1020 Ga0501077_0000147
1021 Ga0501077_0158002
1022 Ga0501216_013135
1023 Ga0501221_004453
1024 Ga0501225_0017724
1025 Ga0501225_0021701
1026 Ga0501079_0004794
1027 Ga0501079_0006110
1028 Ga0501080_0001786
1029 Ga0501080_0002203
1030 Ga0501080_0006020
1031 Ga0501080_0022799
1032 Ga0501080_0087125
1033 Ga0501080_0109328
1034 Ga0501080_0131912
1035 Ga0501080_0372933
1036 Ga0501081_0022184
1037 Ga0501081_0187276
1038 Ga0501083_0010805
1039 Ga0501083_0074261
1040 Ga0501083_0079992
1041 Ga0501273_018280
1042 Ga0501035_0001474
1043 Ga0501035_0016501
1044 Ga0501035_0023572
1045 Ga0501035_0217475
1046 Ga0501035_0243762
1047 Ga0501044_0009486
1048 Ga0501044_0009782
1049 Ga0501044_0011944
1050 Ga0501044_0068687
1051 Ga0501045_0004323
1052 Ga0501045_0097048
1053 nmdc:mga03n38_37130_c1
1054 nmdc:mga03n38_62120_c1
1055 nmdc:mga00v17_91315_c1
1056 nmdc:mga0yw44_54522_c1
1057 nmdc:mga0k408_200334_c1
1058 nmdc:mga0k408_2060_c1
1059 nmdc:mga0k408_27148_c1
1060 nmdc:mga06z11_110184_c1
1061 nmdc:mga06z11_112913_c1
1062 nmdc:mga06z11_18185_c1
1063 nmdc:mga06z11_24954_c1
1064 nmdc:mga06z11_961_c1
1065 nmdc:mga04h51_57781_c1
1066 nmdc:mga04h51_67892_c1
1067 nmdc:mga07m45_134851_c1
1068 nmdc:mga07m45_28247_c1
1069 nmdc:mga07m45_8914_c2
1070 nmdc:mga05p37_131886_c1
1071 nmdc:mga05p37_168281_c1
1072 nmdc:mga05p37_333964_c1
1073 nmdc:mga05p37_39744_c1
1074 nmdc:mga05p37_514279_c1
1075 nmdc:mga05p37_69371_c1
1076 nmdc:mga09592_102453_c1
1077 nmdc:mga09592_3104_c1
1078 nmdc:mga09592_406_c1
1079 nmdc:mga09592_7828_c1
1080 nmdc:mga0qj67_244854_c1
1081 nmdc:mga0qj67_38924_c1
1082 nmdc:mga06r32_236072_c1
1083 nmdc:mga06r32_308182_c1
1084 nmdc:mga06r32_39952_c1
1085 nmdc:mga06r32_447985_c1
1086 nmdc:mga06r32_6597_c1
1087 nmdc:mga06r32_6841_c1
1088 nmdc:mga08y16_164019_c1
1089 nmdc:mga08y16_178206_c2
1090 nmdc:mga08y16_426565_c1
1091 nmdc:mga0n895_130187_c1
1092 nmdc:mga0n895_3252_c1
1093 nmdc:mga0n895_41991_c1
1094 nmdc:mga0n895_79578_c1
1095 nmdc:mga0n895_98084_c1
1096 nmdc:mga0rr50_64164_c1
1097 nmdc:mga08x19_159640_c1
1098 nmdc:mga08x19_3475_c1
1099 nmdc:mga0a205_376380_c1
1100 nmdc:mga0a205_44121_c1
1101 Ga0495601_0050518
1102 Ga0495595_0017558
1103 Ga0500641_0000465
1104 Ga0500555_001097
1105 Ga0500568_0009202
1106 Ga0500616_0000017
1107 Ga0500616_0001403
1108 Ga0500645_000233
1109 Ga0501084_0000937
1110 Ga0501084_0098629
1111 Ga0501084_0109461
1112 Ga0501084_0168000
1113 Ga0501084_0269959
1114 Ga0501084_0390611
1115 Ga0590071_008035
1116 Ga0590071_026036
1117 Ga0590075_001291
1118 Ga0590075_020892
1119 Ga0590077_001491
1120 Ga0501082_0000709
1121 Ga0501082_0008327
1122 Ga0501082_0010127
1123 Ga0501082_0010941
1124 Ga0501082_0021372
1125 Ga0501082_0091212
1126 Ga0530510_0010767
1127 Ga0530510_0025171
1128 Ga0530510_0097826
1129 Ga0530510_0146265
1130 Ga0530510_0163104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

59

169

0.83

PF00581

Rhodanese

Rhodanese-like domain

199

322

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aay-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa3 (rv3117) from mycobacterium tuberculosis: orthorhombic form 0.9207 11 290
3aay-assembly2.cif.gz_B crystal structure of probable thiosulfate sulfurtransferase cysa3 (rv3117) from mycobacterium tuberculosis: orthorhombic form 0.9178 11 290
3p3a-assembly1.cif.gz_B crystal structure of a putative thiosulfate sulfurtransferase from mycobacterium thermoresistible 0.9174 3 292
3hwi-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.9168 12 290
3hwi-assembly2.cif.gz_B crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.9157 12 290
ID Description Score Start End Superfamily
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9701 9 150 3.40.250.10
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9634 9 150 3.40.250.10
af_A0A1D6KFY9_106_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9004 15 138 3.40.250.10
af_O17730_1_176_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8868 15 148 3.40.250.10
1h4mX01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8837 15 148 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A6N6S3P9-F1-model_v4 Sulfurtransferase 0.9847 13 147 GO:0016740
AF-A0A536LDQ9-F1-model_v4 Sulfurtransferase 0.9815 13 142 GO:0016740
AF-A0A3B8X7B7-F1-model_v4 Sulfurtransferase 0.9795 15 136 GO:0016740
AF-A0A2V7QP83-F1-model_v4 Sulfurtransferase 0.9791 5 126 GO:0004792
AF-A0A533W2E5-F1-model_v4 Sulfurtransferase 0.9771 7 140 GO:0004792

Map