F464306

General Info

Members Datasets Scaffolds Average Seq Length
565 315 1130 282

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0083607|Ga0496104_0083607_1834_2838
Length 334
Sequence VHLSNVHKREPFRHHSYLSDIAEGVIVGLGTIGYKSPCRRPLPAESRRQATMSTPCIISVAITGSLPRKKDNPAVPITVAEQVESTQAAYEAGATLVHLHVRNDDETPTSSADRFALVLDGIRRHCPGMITQVSTGGRSGAGRERGGMLHLRPDMASLASGSVNFPTRVYDNAPDLVDWLAAEMKTYGIKPEIEAFDLSMIFQAVALQNAGKIEGPLHIQFVMGIKNAMPVDREVFEFYVRTLARLAPDATWTGAGIGKEQLTLAKWSLELGGHCRTGLEDNVRLDRDTLAPSNAALVKQVVDLCDAYGRKPATVDQARRMLRLPAAASAAIAA

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
213 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
291 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
297 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
298 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
299 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
300 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
307 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
308 2841760612 Bosea sp. Tri-49 Isolate Nodule
309 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
310 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
311 2844104063 Bosea sp. Tri-39 Isolate Nodule
312 2851182111 Bosea sp. Tri-44 Isolate Nodule
313 2851246043 Bosea sp. Tri-54 Isolate Nodule
314 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
315 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0.18
Isolates 1.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.85
Nodule 1.24
Rhizoplane 5.49
Rhizosphere 79.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0083607 3300048907 Bacteria 3044
2 JGI25156J39149_1000311 3300002705 Bacteria 32300
3 JGI25154J39366_1000106 3300002738 Bacteria 74019
4 JGI25157J39369_1000154 3300002741 Bacteria 57286
5 rootH2_10173660 3300003320 Bacteria 1838
6 rootL2_10090136 3300003322 Bacteria 6947
7 Ga0055539_1000160 3300003752 Bacteria 63531
8 Ga0055539_1000225 3300003752 Bacteria 39822
9 Ga0055539_1001756 3300003752 Bacteria 3757
10 Ga0055533_1000057 3300003756 Bacteria 194035
11 Ga0055533_1000162 3300003756 Bacteria 63221
12 Ga0055525_1000742 3300003759 Bacteria 11118
13 Ga0055525_1001997 3300003759 Bacteria 2525
14 Ga0055535_1000403 3300003761 Bacteria 40654
15 Ga0055529_1000195 3300003763 Bacteria 82315
16 Ga0055540_1016831 3300003792 Bacteria 2061
17 Ga0065715_10015785 3300005293 Bacteria 2946
18 Ga0065715_10179905 3300005293 Bacteria 1480
19 Ga0070658_10068421 3300005327 Bacteria 2903
20 Ga0070676_10009234 3300005328 Bacteria 5329
21 Ga0070690_100012120 3300005330 Bacteria 5067
22 Ga0070670_100003704 3300005331 Bacteria 12733
23 Ga0070677_10037987 3300005333 Bacteria 1881
24 Ga0070677_10092098 3300005333 Bacteria 1320
25 Ga0068869_100000109 3300005334 Bacteria 39248
26 Ga0068869_100015492 3300005334 Bacteria 5116
27 Ga0070666_10010714 3300005335 Bacteria 5739
28 Ga0070680_100021847 3300005336 Bacteria 5090
29 Ga0070680_100030153 3300005336 Bacteria 4356
30 Ga0070682_100103763 3300005337 Bacteria 1882
31 Ga0068868_100000895 3300005338 Bacteria 20275
32 Ga0068868_100000928 3300005338 Bacteria 19961
33 Ga0070660_100095700 3300005339 Bacteria 2347
34 Ga0070660_100103841 3300005339 Bacteria 2254
35 Ga0070660_100108164 3300005339 Bacteria 2210
36 Ga0070689_100119435 3300005340 Bacteria 2104
37 Ga0070689_100132011 3300005340 Bacteria 2003
38 Ga0070687_100031817 3300005343 Bacteria 2591
39 Ga0070661_100042895 3300005344 Bacteria 3303
40 Ga0070668_100053233 3300005347 Bacteria 3121
41 Ga0070669_100010114 3300005353 Bacteria 6710
42 Ga0070675_100000621 3300005354 Bacteria 24557
43 Ga0070675_100000772 3300005354 Bacteria 22339
44 Ga0070675_100297851 3300005354 Bacteria 1420
45 Ga0070675_100305697 3300005354 Bacteria 1402
46 Ga0070671_100003449 3300005355 Bacteria 12337
47 Ga0070671_100013805 3300005355 Bacteria 6517
48 Ga0070671_100071208 3300005355 Bacteria 2902
49 Ga0070671_100246827 3300005355 Bacteria 1516
50 Ga0070674_100116401 3300005356 Bacteria 1972
51 Ga0070673_100003994 3300005364 Bacteria 9279
52 Ga0070673_100005018 3300005364 Bacteria 8443
53 Ga0070673_100013145 3300005364 Bacteria 5715
54 Ga0070673_100031638 3300005364 Bacteria 3974
55 Ga0070673_100033582 3300005364 Bacteria 3876
56 Ga0070673_100294269 3300005364 Bacteria 1428
57 Ga0070688_100066698 3300005365 Bacteria 2291
58 Ga0070659_100028582 3300005366 Bacteria 4307
59 Ga0070659_100130809 3300005366 Bacteria 2038
60 Ga0070667_100007507 3300005367 Bacteria 9043
61 Ga0070667_100007951 3300005367 Bacteria 8794
62 Ga0070667_100096220 3300005367 Bacteria 2553
63 Ga0070709_10087125 3300005434 Bacteria 2051
64 Ga0070709_10167986 3300005434 Bacteria 1530
65 Ga0070710_10109408 3300005437 Bacteria 1658
66 Ga0070701_10039972 3300005438 Bacteria 2382
67 Ga0070694_100131437 3300005444 Bacteria 1809
68 Ga0070708_100000792 3300005445 Bacteria 23848
69 Ga0070708_100181632 3300005445 Bacteria 1967
70 Ga0070663_100016243 3300005455 Bacteria 4828
71 Ga0070678_100001367 3300005456 Bacteria 12969
72 Ga0070678_100079775 3300005456 Bacteria 2477
73 Ga0070678_100181710 3300005456 Bacteria 1722
74 Ga0070678_100233023 3300005456 Bacteria 1536
75 Ga0070678_100588179 3300005456 Bacteria 992
76 Ga0070662_100092592 3300005457 Bacteria 2272
77 Ga0070681_10024332 3300005458 Bacteria 6096
78 Ga0070681_10163496 3300005458 Bacteria 2149
79 Ga0068867_100000173 3300005459 Bacteria 42222
80 Ga0068867_100134532 3300005459 Bacteria 1925
81 Ga0070706_100036115 3300005467 Bacteria 4563
82 Ga0070706_100135153 3300005467 Bacteria 2302
83 Ga0070707_100022247 3300005468 Bacteria 5993
84 Ga0070698_100004224 3300005471 Bacteria 15788
85 Ga0070699_100119425 3300005518 Bacteria 2317
86 Ga0070699_100211630 3300005518 Bacteria 1726
87 Ga0070679_100043960 3300005530 Bacteria 4449
88 Ga0070679_100150594 3300005530 Bacteria 2303
89 Ga0070679_100165833 3300005530 Bacteria 2182
90 Ga0070684_100038905 3300005535 Bacteria 4089
91 Ga0070684_100088653 3300005535 Bacteria 2749
92 Ga0070684_100212651 3300005535 Bacteria 1763
93 Ga0070697_100001293 3300005536 Bacteria 18848
94 Ga0070697_100025923 3300005536 Bacteria 4676
95 Ga0068853_100124987 3300005539 Bacteria 2297
96 Ga0070672_100002181 3300005543 Bacteria 12354
97 Ga0070672_100036428 3300005543 Bacteria 3748
98 Ga0070672_100186778 3300005543 Bacteria 1729
99 Ga0070672_100242748 3300005543 Bacteria 1515
100 Ga0070672_100245883 3300005543 Bacteria 1506
101 Ga0070695_100040823 3300005545 Bacteria 2939
102 Ga0070696_100020343 3300005546 Bacteria 4499
103 Ga0070696_100034390 3300005546 Bacteria 3486
104 Ga0070665_100221407 3300005548 Bacteria 1893
105 Ga0070665_100604307 3300005548 Bacteria 1110
106 Ga0070704_100080446 3300005549 Bacteria 2397
107 Ga0068855_100069406 3300005563 Bacteria 4101
108 Ga0068855_100261110 3300005563 Bacteria 1929
109 Ga0068855_100481674 3300005563 Bacteria 1350
110 Ga0070664_100056555 3300005564 Bacteria 3333
111 Ga0070664_100073495 3300005564 Bacteria 2934
112 Ga0070664_100338662 3300005564 Bacteria 1366
113 Ga0068857_100000535 3300005577 Bacteria 27494
114 Ga0068857_100240468 3300005577 Bacteria 1657
115 Ga0068854_100017410 3300005578 Bacteria 4809
116 Ga0068854_100145110 3300005578 Bacteria 1825
117 Ga0068856_100060320 3300005614 Bacteria 3748
118 Ga0068856_100239092 3300005614 Bacteria 1831
119 Ga0068856_100319800 3300005614 Bacteria 1569
120 Ga0068852_100008925 3300005616 Bacteria 7419
121 Ga0068852_100008965 3300005616 Bacteria 7404
122 Ga0068852_100014330 3300005616 Bacteria 6098
123 Ga0068852_100040955 3300005616 Bacteria 3912
124 Ga0068852_100156966 3300005616 Bacteria 2120
125 Ga0068852_100167883 3300005616 Bacteria 2055
126 Ga0068864_100000270 3300005618 Bacteria 46170
127 Ga0068864_100011737 3300005618 Bacteria 7234
128 Ga0068864_100050935 3300005618 Bacteria 3565
129 Ga0068864_100207009 3300005618 Bacteria 1805
130 Ga0068861_100000126 3300005719 Bacteria 39277
131 Ga0068861_100020024 3300005719 Bacteria 4785
132 Ga0068851_10001780 3300005834 Bacteria 9416
133 Ga0068851_10009236 3300005834 Bacteria 4578
134 Ga0068851_10127036 3300005834 Bacteria 1376
135 Ga0068870_10098942 3300005840 Bacteria 1644
136 Ga0068863_100000679 3300005841 Bacteria 34412
137 Ga0068863_100017039 3300005841 Bacteria 6967
138 Ga0068863_100029599 3300005841 Bacteria 5227
139 Ga0068858_100000225 3300005842 Bacteria 61439
140 Ga0068858_100037949 3300005842 Bacteria 4468
141 Ga0068858_100051088 3300005842 Bacteria 3825
142 Ga0068858_100070448 3300005842 Bacteria 3241
143 Ga0068860_100159881 3300005843 Bacteria 2172
144 Ga0068860_100178038 3300005843 Bacteria 2055
145 Ga0070717_10302604 3300006028 Bacteria 1422
146 Ga0075432_10042829 3300006058 Bacteria 1585
147 Ga0070712_100046963 3300006175 Bacteria 2987
148 Ga0070712_100529448 3300006175 Bacteria 991
149 Ga0075362_10047968 3300006177 Bacteria 1904
150 Ga0075366_10021113 3300006195 Bacteria 3785
151 Ga0075366_10085137 3300006195 Bacteria 1891
152 Ga0097621_100007479 3300006237 Bacteria 7817
153 Ga0097621_100018660 3300006237 Bacteria 5305
154 Ga0097621_100232208 3300006237 Bacteria 1611
155 Ga0097621_100491172 3300006237 Bacteria 1111
156 Ga0068871_100017117 3300006358 Bacteria 5478
157 Ga0068871_100257403 3300006358 Bacteria 1522
158 Ga0075428_100187619 3300006844 Bacteria 2237
159 Ga0075429_100001373 3300006880 Bacteria 19922
160 Ga0075429_100364263 3300006880 Bacteria 1266
161 Ga0075436_100186372 3300006914 Bacteria 1468
162 Ga0105240_10009098 3300009093 Bacteria 14100
163 Ga0105240_10072124 3300009093 Bacteria 4269
164 Ga0105240_10249229 3300009093 Bacteria 2055
165 Ga0111539_10062157 3300009094 Bacteria 4422
166 Ga0111539_10076171 3300009094 Bacteria 3950
167 Ga0105245_10053534 3300009098 Bacteria 3623
168 Ga0105245_10312067 3300009098 Bacteria 1547
169 Ga0105245_10379076 3300009098 Bacteria 1408
170 Ga0105247_10263280 3300009101 Bacteria 1183
171 Ga0105243_10003378 3300009148 Bacteria 12952
172 Ga0105243_10055379 3300009148 Bacteria 3151
173 Ga0105243_10066230 3300009148 Bacteria 2905
174 Ga0105241_10060509 3300009174 Bacteria 2914
175 Ga0105241_10367377 3300009174 Bacteria 1253
176 Ga0105248_10021381 3300009177 Bacteria 7169
177 Ga0105248_10195565 3300009177 Bacteria 2278
178 Ga0105248_10261411 3300009177 Bacteria 1948
179 Ga0105237_10007804 3300009545 Bacteria 11665
180 Ga0105238_10007894 3300009551 Bacteria 10648
181 Ga0105238_10020922 3300009551 Bacteria 6665
182 Ga0105238_10241298 3300009551 Bacteria 1785
183 Ga0105249_10175756 3300009553 Bacteria 2080
184 Ga0105249_10318965 3300009553 Bacteria 1565
185 Ga0105239_10007587 3300010375 Bacteria 12431
186 Ga0157373_10022952 3300013100 Bacteria 4524
187 Ga0157371_10030321 3300013102 Bacteria 3902
188 Ga0157370_10056791 3300013104 Bacteria 3724
189 Ga0157370_10248948 3300013104 Bacteria 1644
190 Ga0157369_10015547 3300013105 Bacteria 8577
191 Ga0157369_10108438 3300013105 Bacteria 2953
192 Ga0157374_10014947 3300013296 Bacteria 6802
193 Ga0157374_10289789 3300013296 Bacteria 1618
194 Ga0163162_10021486 3300013306 Bacteria 6358
195 Ga0163162_10119197 3300013306 Bacteria 2742
196 Ga0163162_10173866 3300013306 Bacteria 2278
197 Ga0157372_10052852 3300013307 Bacteria 4526
198 Ga0157372_10121126 3300013307 Bacteria 3005
199 Ga0157372_10215611 3300013307 Bacteria 2225
200 Ga0157372_10335640 3300013307 Bacteria 1760
201 Ga0157372_10366810 3300013307 Bacteria 1678
202 Ga0157372_10685733 3300013307 Bacteria 1192
203 Ga0157375_10002512 3300013308 Bacteria 15912
204 Ga0157375_10025212 3300013308 Bacteria 5520
205 Ga0157375_10655519 3300013308 Bacteria 1206
206 Ga0163163_10012952 3300014325 Bacteria 7618
207 Ga0157380_10145965 3300014326 Bacteria 2039
208 Ga0157377_10000039 3300014745 Bacteria 112711
209 Ga0157377_10000876 3300014745 Bacteria 12517
210 Ga0157377_10251077 3300014745 Bacteria 1146
211 Ga0157379_10002398 3300014968 Bacteria 15656
212 Ga0157379_10011386 3300014968 Bacteria 7759
213 Ga0157379_10221458 3300014968 Bacteria 1714
214 Ga0157376_10006732 3300014969 Bacteria 8134
215 Ga0157376_10308455 3300014969 Bacteria 1501
216 Ga0163161_10028696 3300017792 Bacteria 3952
217 Ga0163161_10061502 3300017792 Bacteria 2734
218 Ga0206356_10708359 3300020070 Bacteria 2859
219 Ga0213875_10000396 3300021388 Bacteria 38430
220 Ga0209674_100003 3300025226 Bacteria 2196646
221 Ga0209674_100007 3300025226 Bacteria 1077082
222 Ga0209563_100033 3300025230 Bacteria 457883
223 Ga0209563_100192 3300025230 Bacteria 33961
224 Ga0207427_100663 3300025231 Bacteria 16489
225 Ga0209258_100291 3300025242 Bacteria 82373
226 Ga0209646_1000127 3300025246 Bacteria 131920
227 Ga0209026_1000004 3300025250 Bacteria 949012
228 Ga0209677_100015 3300025253 Bacteria 532137
229 Ga0209677_100085 3300025253 Bacteria 116046
230 Ga0209677_100107 3300025253 Bacteria 89035
231 Ga0209759_1000129 3300025256 Bacteria 131961
232 Ga0209759_1000644 3300025256 Bacteria 32581
233 Ga0209759_1003974 3300025256 Bacteria 5673
234 Ga0209455_1000208 3300025272 Bacteria 83420
235 Ga0209130_1000703 3300025284 Bacteria 29959
236 Ga0209025_1000113 3300025294 Bacteria 218943
237 Ga0207426_1004422 3300025302 Bacteria 6863
238 Ga0209051_1000354 3300025303 Bacteria 68119
239 Ga0209051_1006488 3300025303 Bacteria 6580
240 Ga0209051_1007344 3300025303 Bacteria 6043
241 Ga0209051_1077217 3300025303 Bacteria 975
242 Ga0209257_1015232 3300025304 Bacteria 3220
243 Ga0207697_10000400 3300025315 Bacteria 24424
244 Ga0207656_10027157 3300025321 Bacteria 2339
245 Ga0207656_10032173 3300025321 Bacteria 2177
246 Ga0207656_10122397 3300025321 Bacteria 1212
247 Ga0207682_10003751 3300025893 Bacteria 6529
248 Ga0207682_10041318 3300025893 Bacteria 1881
249 Ga0207688_10000843 3300025901 Bacteria 15416
250 Ga0207688_10034791 3300025901 Bacteria 2790
251 Ga0207680_10000416 3300025903 Bacteria 20261
252 Ga0207699_10012787 3300025906 Bacteria 4275
253 Ga0207699_10191535 3300025906 Bacteria 1380
254 Ga0207645_10002645 3300025907 Bacteria 13947
255 Ga0207645_10009497 3300025907 Bacteria 6723
256 Ga0207643_10000308 3300025908 Bacteria 33738
257 Ga0207705_10236549 3300025909 Bacteria 1390
258 Ga0207684_10060184 3300025910 Bacteria 3226
259 Ga0207695_10012429 3300025913 Bacteria 10223
260 Ga0207695_10154583 3300025913 Bacteria 2230
261 Ga0207695_10194290 3300025913 Bacteria 1946
262 Ga0207671_10070562 3300025914 Bacteria 2605
263 Ga0207671_10172475 3300025914 Bacteria 1680
264 Ga0207663_10442919 3300025916 Bacteria 1001
265 Ga0207660_10028868 3300025917 Bacteria 3800
266 Ga0207660_10103119 3300025917 Bacteria 2134
267 Ga0207660_10150187 3300025917 Bacteria 1789
268 Ga0207657_10011087 3300025919 Bacteria 8957
269 Ga0207657_10111603 3300025919 Bacteria 2257
270 Ga0207649_10005588 3300025920 Bacteria 6800
271 Ga0207652_10032168 3300025921 Bacteria 4407
272 Ga0207652_10189785 3300025921 Bacteria 1848
273 Ga0207652_10206225 3300025921 Bacteria 1769
274 Ga0207646_10286574 3300025922 Bacteria 1488
275 Ga0207681_10010477 3300025923 Bacteria 5675
276 Ga0207681_10018269 3300025923 Bacteria 4416
277 Ga0207681_10503754 3300025923 Bacteria 991
278 Ga0207681_10527702 3300025923 Bacteria 969
279 Ga0207694_10013371 3300025924 Bacteria 6181
280 Ga0207694_10035930 3300025924 Bacteria 3801
281 Ga0207694_10055879 3300025924 Bacteria 3065
282 Ga0207650_10013788 3300025925 Bacteria 5605
283 Ga0207650_10068159 3300025925 Bacteria 2671
284 Ga0207659_10000337 3300025926 Bacteria 28208
285 Ga0207659_10002398 3300025926 Bacteria 11149
286 Ga0207659_10176150 3300025926 Bacteria 1691
287 Ga0207687_10065705 3300025927 Bacteria 2576
288 Ga0207664_10349581 3300025929 Bacteria 1308
289 Ga0207644_10000543 3300025931 Bacteria 24519
290 Ga0207644_10008458 3300025931 Bacteria 6736
291 Ga0207644_10097804 3300025931 Bacteria 2199
292 Ga0207644_10185867 3300025931 Bacteria 1631
293 Ga0207644_10196629 3300025931 Bacteria 1588
294 Ga0207644_10329045 3300025931 Bacteria 1237
295 Ga0207690_10320241 3300025932 Bacteria 1219
296 Ga0207706_10000736 3300025933 Bacteria 34115
297 Ga0207709_10001551 3300025935 Bacteria 15784
298 Ga0207709_10210816 3300025935 Bacteria 1394
299 Ga0207670_10004563 3300025936 Bacteria 7479
300 Ga0207669_10267695 3300025937 Bacteria 1282
301 Ga0207669_10329947 3300025937 Bacteria 1171
302 Ga0207669_10481059 3300025937 Bacteria 990
303 Ga0207704_10020597 3300025938 Bacteria 3493
304 Ga0207665_10124752 3300025939 Bacteria 1822
305 Ga0207665_10130080 3300025939 Bacteria 1786
306 Ga0207691_10012629 3300025940 Bacteria 8093
307 Ga0207691_10019431 3300025940 Bacteria 6428
308 Ga0207691_10039959 3300025940 Bacteria 4338
309 Ga0207691_10169393 3300025940 Bacteria 1913
310 Ga0207691_10326633 3300025940 Bacteria 1315
311 Ga0207711_10002545 3300025941 Bacteria 16235
312 Ga0207711_10010401 3300025941 Bacteria 7725
313 Ga0207711_10034440 3300025941 Bacteria 4289
314 Ga0207689_10000259 3300025942 Bacteria 47474
315 Ga0207689_10231964 3300025942 Bacteria 1525
316 Ga0207661_10264456 3300025944 Bacteria 1533
317 Ga0207661_10475542 3300025944 Bacteria 1140
318 Ga0207679_10015434 3300025945 Bacteria 5048
319 Ga0207679_10038814 3300025945 Bacteria 3397
320 Ga0207667_10044230 3300025949 Bacteria 4720
321 Ga0207667_10253291 3300025949 Bacteria 1801
322 Ga0207667_10437987 3300025949 Bacteria 1329
323 Ga0207651_10001900 3300025960 Bacteria 9800
324 Ga0207651_10008173 3300025960 Bacteria 5634
325 Ga0207651_10008612 3300025960 Bacteria 5521
326 Ga0207651_10033406 3300025960 Bacteria 3318
327 Ga0207651_10034249 3300025960 Bacteria 3287
328 Ga0207651_10407815 3300025960 Bacteria 1157
329 Ga0207712_10047556 3300025961 Bacteria 2979
330 Ga0207668_10015813 3300025972 Bacteria 4697
331 Ga0207668_10035224 3300025972 Bacteria 3330
332 Ga0207668_10527836 3300025972 Bacteria 1019
333 Ga0207640_10008722 3300025981 Bacteria 5642
334 Ga0207640_10070500 3300025981 Bacteria 2351
335 Ga0207658_10005217 3300025986 Bacteria 8942
336 Ga0207658_10005463 3300025986 Bacteria 8720
337 Ga0207677_10009484 3300026023 Bacteria 5479
338 Ga0207677_10160402 3300026023 Bacteria 1746
339 Ga0207703_10000408 3300026035 Bacteria 45772
340 Ga0207703_10007335 3300026035 Bacteria 8764
341 Ga0207639_10032384 3300026041 Bacteria 3848
342 Ga0207639_10052671 3300026041 Bacteria 3102
343 Ga0207639_10087757 3300026041 Bacteria 2480
344 Ga0207639_10635710 3300026041 Bacteria 986
345 Ga0207678_10001523 3300026067 Bacteria 21247
346 Ga0207678_10017009 3300026067 Bacteria 6385
347 Ga0207708_10011626 3300026075 Bacteria 6561
348 Ga0207708_10018886 3300026075 Bacteria 5192
349 Ga0207702_10013866 3300026078 Bacteria 6693
350 Ga0207702_10080501 3300026078 Bacteria 2826
351 Ga0207702_10641315 3300026078 Bacteria 1044
352 Ga0207641_10002065 3300026088 Bacteria 19074
353 Ga0207641_10018194 3300026088 Bacteria 5760
354 Ga0207641_10113029 3300026088 Bacteria 2410
355 Ga0207648_10000836 3300026089 Bacteria 34689
356 Ga0207648_10032579 3300026089 Bacteria 4600
357 Ga0207648_10102067 3300026089 Bacteria 2514
358 Ga0207648_10150681 3300026089 Bacteria 2052
359 Ga0207648_10290061 3300026089 Bacteria 1465
360 Ga0207676_10000269 3300026095 Bacteria 45280
361 Ga0207676_10017196 3300026095 Bacteria 5240
362 Ga0207674_10011320 3300026116 Bacteria 10026
363 Ga0207674_10025521 3300026116 Bacteria 6300
364 Ga0207674_10046976 3300026116 Bacteria 4430
365 Ga0207675_100000240 3300026118 Bacteria 52035
366 Ga0207675_100000307 3300026118 Bacteria 46857
367 Ga0207675_100033253 3300026118 Bacteria 4805
368 Ga0207683_10001051 3300026121 Bacteria 25171
369 Ga0207683_10010704 3300026121 Bacteria 7818
370 Ga0207683_10034200 3300026121 Bacteria 4416
371 Ga0207683_10674684 3300026121 Bacteria 958
372 Ga0207698_10004189 3300026142 Bacteria 8776
373 Ga0207698_10012346 3300026142 Bacteria 5586
374 Ga0207698_10015109 3300026142 Bacteria 5160
375 Ga0207698_10032712 3300026142 Bacteria 3771
376 Ga0207698_10262212 3300026142 Bacteria 1588
377 Ga0209966_1001192 3300027695 Bacteria 4645
378 Ga0209974_10066883 3300027876 Bacteria 1222
379 Ga0207428_10105150 3300027907 Bacteria 2177
380 Ga0268266_10124478 3300028379 Bacteria 2298
381 Ga0268265_10180427 3300028380 Bacteria 1813
382 Ga0268264_10004973 3300028381 Bacteria 11260
383 Ga0268264_10211774 3300028381 Bacteria 1779
384 Ga0268264_10568347 3300028381 Bacteria 1114
385 Ga0307515_10249033 3300028794 Bacteria 1533
386 Ga0307515_10341584 3300028794 Bacteria 1149
387 Ga0307511_10099981 3300030521 Bacteria 1911
388 Ga0265340_10052809 3300031247 Bacteria 1964
389 Ga0265340_10068967 3300031247 Bacteria 1679
390 Ga0307508_10181795 3300031616 Bacteria 1705
391 Ga0316575_10098642 3300031665 Bacteria 1186
392 Ga0265342_10000563 3300031712 Bacteria 39193
393 Ga0307516_10007532 3300031730 Bacteria 12496
394 Ga0307516_10046168 3300031730 Bacteria 4300
395 Ga0307405_10273305 3300031731 Bacteria 1268
396 Ga0373950_0017176 3300034818 Bacteria 1244
397 Ga0373928_0007355 3300035084 Bacteria 2124
398 Ga0373934_0028683 3300035086 Bacteria 2171
399 Ga0373952_0009999 3300035092 Bacteria 1826
400 Ga0373943_0150894 3300035170 Bacteria 1259
401 Ga0373962_0025800 3300035242 Bacteria 1580
402 Ga0373931_0001075 3300035691 Bacteria 11550
403 Ga0373931_0024200 3300035691 Bacteria 3074
404 Ga0373931_0134589 3300035691 Bacteria 1426
405 Ga0373947_0299041 3300035725 Bacteria 1073
406 Ga0373937_0169074 3300036401 Bacteria 2051
407 Ga0316582_0022830 3300036647 Bacteria 3721
408 Ga0395899_0137612 3300037312 Bacteria 1740
409 Ga0395898_0047852 3300037466 Bacteria 4194
410 Ga0395898_0479880 3300037466 Bacteria 1183
411 Ga0395905_0003719 3300037471 Bacteria 16161
412 Ga0395905_0004802 3300037471 Bacteria 13953
413 Ga0395905_0397606 3300037471 Bacteria 1273
414 Ga0436364_0326197 3300037853 Bacteria 29256
415 Ga0395901_0001277 3300038443 Bacteria 26706
416 Ga0395901_0291439 3300038443 Bacteria 1694
417 Ga0436365_0474394 3300039437 Bacteria 1771
418 Ga0436365_1319641 3300039437 Bacteria 3101
419 Ga0436361_0233403 3300039447 Bacteria 2232
420 Ga0436363_0125970 3300039450 Bacteria 1067
421 Ga0436363_0916174 3300039450 Bacteria 2458
422 Ga0451793_1393336 3300041452 Bacteria 1357
423 Ga0439431_0008017 3300041997 Bacteria 2366
424 Ga0439446_0090236 3300042156 Bacteria 959
425 Ga0439435_0001664 3300042436 Bacteria 4183
426 Ga0451577_0023898 3300042876 Bacteria 5568
427 Ga0466965_0004407 3300044683 Bacteria 6258
428 Ga0466965_0018528 3300044683 Bacteria 3338
429 Ga0466966_0000198 3300044684 Bacteria 40082
430 Ga0466961_0013919 3300044693 Bacteria 5154
431 Ga0466961_0022080 3300044693 Bacteria 4095
432 Ga0466971_0007993 3300044719 Bacteria 4610
433 Ga0466960_0171141 3300044901 Bacteria 1172
434 Ga0466959_0004053 3300045049 Bacteria 9746
435 Ga0466958_0005184 3300045836 Bacteria 6977
436 Ga0495590_0017700 3300046457 Bacteria 2560
437 Ga0495638_0062331 3300046460 Bacteria 2302
438 Ga0495650_0034420 3300046471 Bacteria 2243
439 Ga0495650_0066649 3300046471 Bacteria 1424
440 Ga0495580_0007430 3300046472 Bacteria 8809
441 Ga0495639_0027725 3300046475 Bacteria 2507
442 Ga0495583_0000313 3300046506 Bacteria 76539
443 Ga0495606_0001607 3300046507 Bacteria 29481
444 Ga0495606_0002420 3300046507 Bacteria 21749
445 Ga0495666_0001121 3300046526 Bacteria 12831
446 Ga0495652_0087224 3300046529 Bacteria 2560
447 Ga0495665_0010948 3300046531 Bacteria 4908
448 Ga0495621_0008649 3300046539 Bacteria 3062
449 Ga0495645_0035557 3300046543 Bacteria 3631
450 Ga0495645_0065065 3300046543 Bacteria 2638
451 Ga0495656_0067653 3300046615 Bacteria 1577
452 Ga0495668_0032042 3300046616 Bacteria 2960
453 Ga0495625_0003058 3300046660 Bacteria 17143
454 Ga0495625_0145872 3300046660 Bacteria 1593
455 Ga0495647_0012608 3300046681 Bacteria 2914
456 Ga0495613_0062344 3300046689 Bacteria 2729
457 Ga0495671_0109181 3300046692 Bacteria 1351
458 Ga0495671_0222744 3300046692 Bacteria 913
459 Ga0495649_0000665 3300046694 Bacteria 28093
460 Ga0495589_0006421 3300046794 Bacteria 6206
461 Ga0495660_0098529 3300046810 Bacteria 1508
462 Ga0495604_0022128 3300047317 Bacteria 5073
463 Ga0495674_0005976 3300047319 Bacteria 11682
464 Ga0495672_0092323 3300047320 Bacteria 1660
465 Ga0495680_0251895 3300047322 Bacteria 1251
466 Ga0495684_0178225 3300047471 Bacteria 1577
467 Ga0495686_0008173 3300047472 Bacteria 7726
468 Ga0496100_0014887 3300048903 Bacteria 4529
469 Ga0496101_0005191 3300048904 Bacteria 8284
470 Ga0496102_0092453 3300048905 Bacteria 2801
471 Ga0496102_0174432 3300048905 Bacteria 2024
472 Ga0496104_0019792 3300048907 Bacteria 6163
473 Ga0496104_0043666 3300048907 Bacteria 4210
474 Ga0496104_0403361 3300048907 Bacteria 1279
475 Ga0496104_0415562 3300048907 Bacteria 1257
476 Ga0496105_0041143 3300048908 Bacteria 3809
477 Ga0496106_0002032 3300048909 Bacteria 15215
478 Ga0496106_0328841 3300048909 Bacteria 1227
479 Ga0496108_0037222 3300048911 Bacteria 4052
480 Ga0496108_0137771 3300048911 Bacteria 2101
481 Ga0496108_0200687 3300048911 Bacteria 1731
482 Ga0496108_0481468 3300048911 Bacteria 1084
483 Ga0496109_0029093 3300048912 Bacteria 4946
484 Ga0496109_0050006 3300048912 Bacteria 3808
485 Ga0496109_0134724 3300048912 Bacteria 2307
486 Ga0496109_0199019 3300048912 Bacteria 1883
487 Ga0496109_0205192 3300048912 Bacteria 1853
488 Ga0496109_0378471 3300048912 Bacteria 1337
489 Ga0496110_0180362 3300048913 Bacteria 1917
490 Ga0496111_0021723 3300048914 Bacteria 4483
491 Ga0496112_0006765 3300048915 Bacteria 10101
492 Ga0496113_0005959 3300048916 Bacteria 7666
493 Ga0496113_0051933 3300048916 Bacteria 3060
494 Ga0496114_0155714 3300048917 Bacteria 1984
495 Ga0496114_0280894 3300048917 Bacteria 1468
496 Ga0496115_0088063 3300048918 Bacteria 2534
497 Ga0496116_0000661 3300048919 Bacteria 44909
498 Ga0501032_0069187 3300049569 Bacteria 2356
499 Ga0501032_0117455 3300049569 Bacteria 1759
500 Ga0501034_0000050 3300049571 Bacteria 213092
501 Ga0501034_0099037 3300049571 Bacteria 2910
502 Ga0501034_0183409 3300049571 Bacteria 2057
503 Ga0501034_0202619 3300049571 Bacteria 1942
504 Ga0501037_0358596 3300049573 Bacteria 1005
505 Ga0501038_0326870 3300049574 Bacteria 1198
506 Ga0501040_0388808 3300049576 Bacteria 1001
507 Ga0501047_0065468 3300049581 Bacteria 3503
508 Ga0501069_0075263 3300049585 Bacteria 1896
509 Ga0501070_0059320 3300049586 Bacteria 3172
510 Ga0501070_0075709 3300049586 Bacteria 2786
511 Ga0501072_0030966 3300049588 Bacteria 4186
512 Ga0501073_0025850 3300049589 Bacteria 4206
513 Ga0501075_0361675 3300049591 Bacteria 1106
514 Ga0501075_0385526 3300049591 Bacteria 1068
515 Ga0501076_0446362 3300049592 Bacteria 1065
516 Ga0501253_034139 3300049683 Bacteria 989
517 Ga0501080_0189343 3300049742 Bacteria 1891
518 Ga0501083_0062504 3300049744 Bacteria 2484
519 Ga0501083_0100556 3300049744 Bacteria 1907
520 Ga0501265_011634 3300049762 Bacteria 1087
521 Ga0501035_0000581 3300049822 Bacteria 40293
522 Ga0501044_0037037 3300049823 Bacteria 5100
523 Ga0501044_0139004 3300049823 Bacteria 2418
524 Ga0501044_0421721 3300049823 Bacteria 1244
525 nmdc:mga0k408_254020_c1 3300050493 Bacteria 1049
526 nmdc:mga0k408_3317_c1 3300050493 Bacteria 8516
527 nmdc:mga09592_22626_c1 3300050508 Bacteria 5189
528 nmdc:mga0qj67_24381_c1 3300050509 Bacteria 4662
529 nmdc:mga0qj67_531464_c1 3300050509 Bacteria 944
530 nmdc:mga08y16_210847_c1 3300050511 Bacteria 2012
531 nmdc:mga08y16_64948_c1 3300050511 Bacteria 3810
532 nmdc:mga0rr50_181706_c1 3300050513 Bacteria 1720
533 nmdc:mga0rr50_33218_c1 3300050513 Bacteria 3684
534 nmdc:mga08x19_11694_c1 3300050514 Bacteria 5286
535 nmdc:mga08x19_30912_c1 3300050514 Bacteria 3365
536 nmdc:mga0a205_118031_c1 3300050515 Bacteria 2551
537 Ga0500635_0000072 3300053080 Bacteria 66335
538 Ga0500643_008056 3300053087 Bacteria 4175
539 Ga0500644_0000582 3300053088 Bacteria 13971
540 Ga0500651_0155637 3300053093 Bacteria 1370
541 Ga0500641_0072879 3300053096 Bacteria 1448
542 Ga0500595_000010 3300053119 Bacteria 275806
543 Ga0500652_012441 3300053131 Bacteria 2985
544 Ga0500652_104559 3300053131 Bacteria 1184
545 Ga0500559_0058646 3300053136 Bacteria 1712
546 Ga0500561_0019495 3300053137 Bacteria 1572
547 Ga0500564_058969 3300053138 Bacteria 1744
548 Ga0500564_088868 3300053138 Bacteria 1377
549 Ga0500589_084110 3300053147 Bacteria 1415
550 Ga0500616_0000001 3300053153 Bacteria 1986011
551 Ga0500636_0003259 3300053177 Bacteria 9100
552 Ga0500636_0035672 3300053177 Bacteria 2942
553 Ga0500645_000943 3300053730 Bacteria 16547
554 Ga0501082_0224285 3300060353 Bacteria 1635
555 Ga0466962_0007394 3300061719 Bacteria 5269
556 2514054616 2513237166 Bacteria 10373764
557 2644303878 2643221654 Bacteria 5273570
558 2841762679 2841760612 Bacteria 6454112
559 2841916082 2841911363 Bacteria 6173697
560 2841921249 2841917233 Bacteria 6173500
561 2844110313 2844104063 Bacteria 6440972
562 2851187114 2851182111 Bacteria 6047226
563 2851251975 2851246043 Bacteria 6439203
564 2858689851 2858688981 Bacteria 8184122
565 642617404 642555113 Bacteria 8214658
566 Ga0496104_0083607
567 JGI25156J39149_1000311
568 JGI25154J39366_1000106
569 JGI25157J39369_1000154
570 rootH2_10173660
571 rootL2_10090136
572 Ga0055539_1000160
573 Ga0055539_1000225
574 Ga0055539_1001756
575 Ga0055533_1000057
576 Ga0055533_1000162
577 Ga0055525_1000742
578 Ga0055525_1001997
579 Ga0055535_1000403
580 Ga0055529_1000195
581 Ga0055540_1016831
582 Ga0065715_10015785
583 Ga0065715_10179905
584 Ga0070658_10068421
585 Ga0070676_10009234
586 Ga0070690_100012120
587 Ga0070670_100003704
588 Ga0070677_10037987
589 Ga0070677_10092098
590 Ga0068869_100000109
591 Ga0068869_100015492
592 Ga0070666_10010714
593 Ga0070680_100021847
594 Ga0070680_100030153
595 Ga0070682_100103763
596 Ga0068868_100000895
597 Ga0068868_100000928
598 Ga0070660_100095700
599 Ga0070660_100103841
600 Ga0070660_100108164
601 Ga0070689_100119435
602 Ga0070689_100132011
603 Ga0070687_100031817
604 Ga0070661_100042895
605 Ga0070668_100053233
606 Ga0070669_100010114
607 Ga0070675_100000621
608 Ga0070675_100000772
609 Ga0070675_100297851
610 Ga0070675_100305697
611 Ga0070671_100003449
612 Ga0070671_100013805
613 Ga0070671_100071208
614 Ga0070671_100246827
615 Ga0070674_100116401
616 Ga0070673_100003994
617 Ga0070673_100005018
618 Ga0070673_100013145
619 Ga0070673_100031638
620 Ga0070673_100033582
621 Ga0070673_100294269
622 Ga0070688_100066698
623 Ga0070659_100028582
624 Ga0070659_100130809
625 Ga0070667_100007507
626 Ga0070667_100007951
627 Ga0070667_100096220
628 Ga0070709_10087125
629 Ga0070709_10167986
630 Ga0070710_10109408
631 Ga0070701_10039972
632 Ga0070694_100131437
633 Ga0070708_100000792
634 Ga0070708_100181632
635 Ga0070663_100016243
636 Ga0070678_100001367
637 Ga0070678_100079775
638 Ga0070678_100181710
639 Ga0070678_100233023
640 Ga0070678_100588179
641 Ga0070662_100092592
642 Ga0070681_10024332
643 Ga0070681_10163496
644 Ga0068867_100000173
645 Ga0068867_100134532
646 Ga0070706_100036115
647 Ga0070706_100135153
648 Ga0070707_100022247
649 Ga0070698_100004224
650 Ga0070699_100119425
651 Ga0070699_100211630
652 Ga0070679_100043960
653 Ga0070679_100150594
654 Ga0070679_100165833
655 Ga0070684_100038905
656 Ga0070684_100088653
657 Ga0070684_100212651
658 Ga0070697_100001293
659 Ga0070697_100025923
660 Ga0068853_100124987
661 Ga0070672_100002181
662 Ga0070672_100036428
663 Ga0070672_100186778
664 Ga0070672_100242748
665 Ga0070672_100245883
666 Ga0070695_100040823
667 Ga0070696_100020343
668 Ga0070696_100034390
669 Ga0070665_100221407
670 Ga0070665_100604307
671 Ga0070704_100080446
672 Ga0068855_100069406
673 Ga0068855_100261110
674 Ga0068855_100481674
675 Ga0070664_100056555
676 Ga0070664_100073495
677 Ga0070664_100338662
678 Ga0068857_100000535
679 Ga0068857_100240468
680 Ga0068854_100017410
681 Ga0068854_100145110
682 Ga0068856_100060320
683 Ga0068856_100239092
684 Ga0068856_100319800
685 Ga0068852_100008925
686 Ga0068852_100008965
687 Ga0068852_100014330
688 Ga0068852_100040955
689 Ga0068852_100156966
690 Ga0068852_100167883
691 Ga0068864_100000270
692 Ga0068864_100011737
693 Ga0068864_100050935
694 Ga0068864_100207009
695 Ga0068861_100000126
696 Ga0068861_100020024
697 Ga0068851_10001780
698 Ga0068851_10009236
699 Ga0068851_10127036
700 Ga0068870_10098942
701 Ga0068863_100000679
702 Ga0068863_100017039
703 Ga0068863_100029599
704 Ga0068858_100000225
705 Ga0068858_100037949
706 Ga0068858_100051088
707 Ga0068858_100070448
708 Ga0068860_100159881
709 Ga0068860_100178038
710 Ga0070717_10302604
711 Ga0075432_10042829
712 Ga0070712_100046963
713 Ga0070712_100529448
714 Ga0075362_10047968
715 Ga0075366_10021113
716 Ga0075366_10085137
717 Ga0097621_100007479
718 Ga0097621_100018660
719 Ga0097621_100232208
720 Ga0097621_100491172
721 Ga0068871_100017117
722 Ga0068871_100257403
723 Ga0075428_100187619
724 Ga0075429_100001373
725 Ga0075429_100364263
726 Ga0075436_100186372
727 Ga0105240_10009098
728 Ga0105240_10072124
729 Ga0105240_10249229
730 Ga0111539_10062157
731 Ga0111539_10076171
732 Ga0105245_10053534
733 Ga0105245_10312067
734 Ga0105245_10379076
735 Ga0105247_10263280
736 Ga0105243_10003378
737 Ga0105243_10055379
738 Ga0105243_10066230
739 Ga0105241_10060509
740 Ga0105241_10367377
741 Ga0105248_10021381
742 Ga0105248_10195565
743 Ga0105248_10261411
744 Ga0105237_10007804
745 Ga0105238_10007894
746 Ga0105238_10020922
747 Ga0105238_10241298
748 Ga0105249_10175756
749 Ga0105249_10318965
750 Ga0105239_10007587
751 Ga0157373_10022952
752 Ga0157371_10030321
753 Ga0157370_10056791
754 Ga0157370_10248948
755 Ga0157369_10015547
756 Ga0157369_10108438
757 Ga0157374_10014947
758 Ga0157374_10289789
759 Ga0163162_10021486
760 Ga0163162_10119197
761 Ga0163162_10173866
762 Ga0157372_10052852
763 Ga0157372_10121126
764 Ga0157372_10215611
765 Ga0157372_10335640
766 Ga0157372_10366810
767 Ga0157372_10685733
768 Ga0157375_10002512
769 Ga0157375_10025212
770 Ga0157375_10655519
771 Ga0163163_10012952
772 Ga0157380_10145965
773 Ga0157377_10000039
774 Ga0157377_10000876
775 Ga0157377_10251077
776 Ga0157379_10002398
777 Ga0157379_10011386
778 Ga0157379_10221458
779 Ga0157376_10006732
780 Ga0157376_10308455
781 Ga0163161_10028696
782 Ga0163161_10061502
783 Ga0206356_10708359
784 Ga0213875_10000396
785 Ga0209674_100003
786 Ga0209674_100007
787 Ga0209563_100033
788 Ga0209563_100192
789 Ga0207427_100663
790 Ga0209258_100291
791 Ga0209646_1000127
792 Ga0209026_1000004
793 Ga0209677_100015
794 Ga0209677_100085
795 Ga0209677_100107
796 Ga0209759_1000129
797 Ga0209759_1000644
798 Ga0209759_1003974
799 Ga0209455_1000208
800 Ga0209130_1000703
801 Ga0209025_1000113
802 Ga0207426_1004422
803 Ga0209051_1000354
804 Ga0209051_1006488
805 Ga0209051_1007344
806 Ga0209051_1077217
807 Ga0209257_1015232
808 Ga0207697_10000400
809 Ga0207656_10027157
810 Ga0207656_10032173
811 Ga0207656_10122397
812 Ga0207682_10003751
813 Ga0207682_10041318
814 Ga0207688_10000843
815 Ga0207688_10034791
816 Ga0207680_10000416
817 Ga0207699_10012787
818 Ga0207699_10191535
819 Ga0207645_10002645
820 Ga0207645_10009497
821 Ga0207643_10000308
822 Ga0207705_10236549
823 Ga0207684_10060184
824 Ga0207695_10012429
825 Ga0207695_10154583
826 Ga0207695_10194290
827 Ga0207671_10070562
828 Ga0207671_10172475
829 Ga0207663_10442919
830 Ga0207660_10028868
831 Ga0207660_10103119
832 Ga0207660_10150187
833 Ga0207657_10011087
834 Ga0207657_10111603
835 Ga0207649_10005588
836 Ga0207652_10032168
837 Ga0207652_10189785
838 Ga0207652_10206225
839 Ga0207646_10286574
840 Ga0207681_10010477
841 Ga0207681_10018269
842 Ga0207681_10503754
843 Ga0207681_10527702
844 Ga0207694_10013371
845 Ga0207694_10035930
846 Ga0207694_10055879
847 Ga0207650_10013788
848 Ga0207650_10068159
849 Ga0207659_10000337
850 Ga0207659_10002398
851 Ga0207659_10176150
852 Ga0207687_10065705
853 Ga0207664_10349581
854 Ga0207644_10000543
855 Ga0207644_10008458
856 Ga0207644_10097804
857 Ga0207644_10185867
858 Ga0207644_10196629
859 Ga0207644_10329045
860 Ga0207690_10320241
861 Ga0207706_10000736
862 Ga0207709_10001551
863 Ga0207709_10210816
864 Ga0207670_10004563
865 Ga0207669_10267695
866 Ga0207669_10329947
867 Ga0207669_10481059
868 Ga0207704_10020597
869 Ga0207665_10124752
870 Ga0207665_10130080
871 Ga0207691_10012629
872 Ga0207691_10019431
873 Ga0207691_10039959
874 Ga0207691_10169393
875 Ga0207691_10326633
876 Ga0207711_10002545
877 Ga0207711_10010401
878 Ga0207711_10034440
879 Ga0207689_10000259
880 Ga0207689_10231964
881 Ga0207661_10264456
882 Ga0207661_10475542
883 Ga0207679_10015434
884 Ga0207679_10038814
885 Ga0207667_10044230
886 Ga0207667_10253291
887 Ga0207667_10437987
888 Ga0207651_10001900
889 Ga0207651_10008173
890 Ga0207651_10008612
891 Ga0207651_10033406
892 Ga0207651_10034249
893 Ga0207651_10407815
894 Ga0207712_10047556
895 Ga0207668_10015813
896 Ga0207668_10035224
897 Ga0207668_10527836
898 Ga0207640_10008722
899 Ga0207640_10070500
900 Ga0207658_10005217
901 Ga0207658_10005463
902 Ga0207677_10009484
903 Ga0207677_10160402
904 Ga0207703_10000408
905 Ga0207703_10007335
906 Ga0207639_10032384
907 Ga0207639_10052671
908 Ga0207639_10087757
909 Ga0207639_10635710
910 Ga0207678_10001523
911 Ga0207678_10017009
912 Ga0207708_10011626
913 Ga0207708_10018886
914 Ga0207702_10013866
915 Ga0207702_10080501
916 Ga0207702_10641315
917 Ga0207641_10002065
918 Ga0207641_10018194
919 Ga0207641_10113029
920 Ga0207648_10000836
921 Ga0207648_10032579
922 Ga0207648_10102067
923 Ga0207648_10150681
924 Ga0207648_10290061
925 Ga0207676_10000269
926 Ga0207676_10017196
927 Ga0207674_10011320
928 Ga0207674_10025521
929 Ga0207674_10046976
930 Ga0207675_100000240
931 Ga0207675_100000307
932 Ga0207675_100033253
933 Ga0207683_10001051
934 Ga0207683_10010704
935 Ga0207683_10034200
936 Ga0207683_10674684
937 Ga0207698_10004189
938 Ga0207698_10012346
939 Ga0207698_10015109
940 Ga0207698_10032712
941 Ga0207698_10262212
942 Ga0209966_1001192
943 Ga0209974_10066883
944 Ga0207428_10105150
945 Ga0268266_10124478
946 Ga0268265_10180427
947 Ga0268264_10004973
948 Ga0268264_10211774
949 Ga0268264_10568347
950 Ga0307515_10249033
951 Ga0307515_10341584
952 Ga0307511_10099981
953 Ga0265340_10052809
954 Ga0265340_10068967
955 Ga0307508_10181795
956 Ga0316575_10098642
957 Ga0265342_10000563
958 Ga0307516_10007532
959 Ga0307516_10046168
960 Ga0307405_10273305
961 Ga0373950_0017176
962 Ga0373928_0007355
963 Ga0373934_0028683
964 Ga0373952_0009999
965 Ga0373943_0150894
966 Ga0373962_0025800
967 Ga0373931_0001075
968 Ga0373931_0024200
969 Ga0373931_0134589
970 Ga0373947_0299041
971 Ga0373937_0169074
972 Ga0316582_0022830
973 Ga0395899_0137612
974 Ga0395898_0047852
975 Ga0395898_0479880
976 Ga0395905_0003719
977 Ga0395905_0004802
978 Ga0395905_0397606
979 Ga0436364_0326197
980 Ga0395901_0001277
981 Ga0395901_0291439
982 Ga0436365_0474394
983 Ga0436365_1319641
984 Ga0436361_0233403
985 Ga0436363_0125970
986 Ga0436363_0916174
987 Ga0451793_1393336
988 Ga0439431_0008017
989 Ga0439446_0090236
990 Ga0439435_0001664
991 Ga0451577_0023898
992 Ga0466965_0004407
993 Ga0466965_0018528
994 Ga0466966_0000198
995 Ga0466961_0013919
996 Ga0466961_0022080
997 Ga0466971_0007993
998 Ga0466960_0171141
999 Ga0466959_0004053
1000 Ga0466958_0005184
1001 Ga0495590_0017700
1002 Ga0495638_0062331
1003 Ga0495650_0034420
1004 Ga0495650_0066649
1005 Ga0495580_0007430
1006 Ga0495639_0027725
1007 Ga0495583_0000313
1008 Ga0495606_0001607
1009 Ga0495606_0002420
1010 Ga0495666_0001121
1011 Ga0495652_0087224
1012 Ga0495665_0010948
1013 Ga0495621_0008649
1014 Ga0495645_0035557
1015 Ga0495645_0065065
1016 Ga0495656_0067653
1017 Ga0495668_0032042
1018 Ga0495625_0003058
1019 Ga0495625_0145872
1020 Ga0495647_0012608
1021 Ga0495613_0062344
1022 Ga0495671_0109181
1023 Ga0495671_0222744
1024 Ga0495649_0000665
1025 Ga0495589_0006421
1026 Ga0495660_0098529
1027 Ga0495604_0022128
1028 Ga0495674_0005976
1029 Ga0495672_0092323
1030 Ga0495680_0251895
1031 Ga0495684_0178225
1032 Ga0495686_0008173
1033 Ga0496100_0014887
1034 Ga0496101_0005191
1035 Ga0496102_0092453
1036 Ga0496102_0174432
1037 Ga0496104_0019792
1038 Ga0496104_0043666
1039 Ga0496104_0403361
1040 Ga0496104_0415562
1041 Ga0496105_0041143
1042 Ga0496106_0002032
1043 Ga0496106_0328841
1044 Ga0496108_0037222
1045 Ga0496108_0137771
1046 Ga0496108_0200687
1047 Ga0496108_0481468
1048 Ga0496109_0029093
1049 Ga0496109_0050006
1050 Ga0496109_0134724
1051 Ga0496109_0199019
1052 Ga0496109_0205192
1053 Ga0496109_0378471
1054 Ga0496110_0180362
1055 Ga0496111_0021723
1056 Ga0496112_0006765
1057 Ga0496113_0005959
1058 Ga0496113_0051933
1059 Ga0496114_0155714
1060 Ga0496114_0280894
1061 Ga0496115_0088063
1062 Ga0496116_0000661
1063 Ga0501032_0069187
1064 Ga0501032_0117455
1065 Ga0501034_0000050
1066 Ga0501034_0099037
1067 Ga0501034_0183409
1068 Ga0501034_0202619
1069 Ga0501037_0358596
1070 Ga0501038_0326870
1071 Ga0501040_0388808
1072 Ga0501047_0065468
1073 Ga0501069_0075263
1074 Ga0501070_0059320
1075 Ga0501070_0075709
1076 Ga0501072_0030966
1077 Ga0501073_0025850
1078 Ga0501075_0361675
1079 Ga0501075_0385526
1080 Ga0501076_0446362
1081 Ga0501253_034139
1082 Ga0501080_0189343
1083 Ga0501083_0062504
1084 Ga0501083_0100556
1085 Ga0501265_011634
1086 Ga0501035_0000581
1087 Ga0501044_0037037
1088 Ga0501044_0139004
1089 Ga0501044_0421721
1090 nmdc:mga0k408_254020_c1
1091 nmdc:mga0k408_3317_c1
1092 nmdc:mga09592_22626_c1
1093 nmdc:mga0qj67_24381_c1
1094 nmdc:mga0qj67_531464_c1
1095 nmdc:mga08y16_210847_c1
1096 nmdc:mga08y16_64948_c1
1097 nmdc:mga0rr50_181706_c1
1098 nmdc:mga0rr50_33218_c1
1099 nmdc:mga08x19_11694_c1
1100 nmdc:mga08x19_30912_c1
1101 nmdc:mga0a205_118031_c1
1102 Ga0500635_0000072
1103 Ga0500643_008056
1104 Ga0500644_0000582
1105 Ga0500651_0155637
1106 Ga0500641_0072879
1107 Ga0500595_000010
1108 Ga0500652_012441
1109 Ga0500652_104559
1110 Ga0500559_0058646
1111 Ga0500561_0019495
1112 Ga0500564_058969
1113 Ga0500564_088868
1114 Ga0500589_084110
1115 Ga0500616_0000001
1116 Ga0500636_0003259
1117 Ga0500636_0035672
1118 Ga0500645_000943
1119 Ga0501082_0224285
1120 Ga0466962_0007394
1121 2514054616
1122 2644303878
1123 2841762679
1124 2841916082
1125 2841921249
1126 2844110313
1127 2851187114
1128 2851251975
1129 2858689851
1130 642617404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05853

BKACE

beta-keto acid cleavage enzyme

55

324

0.98

PF01220

DHquinase_II

Dehydroquinase class II

1

40

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3no5-assembly3.cif.gz_E crystal structure of a pfam duf849 domain containing protein (reut_a1631) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9901 1 274
3fa5-assembly1.cif.gz_B crystal structure of a duf849 family protein (pden_3495) from paracoccus denitrificans pd1222 at 1.90 a resolution 0.9896 3 274
3chv-assembly1.cif.gz_A-2 crystal structure of a prokaryotic domain of unknown function (duf849) member (spoa0042) from silicibacter pomeroyi dss-3 at 1.45 a resolution 0.9871 1 274
3no5-assembly3.cif.gz_E crystal structure of a pfam duf849 domain containing protein (reut_a1631) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9865 1 274
3chv-assembly1.cif.gz_A-2 crystal structure of a prokaryotic domain of unknown function (duf849) member (spoa0042) from silicibacter pomeroyi dss-3 at 1.45 a resolution 0.9835 1 274
ID Description Score Start End Superfamily
3no5E00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9878 1 270 3.20.20.70
3no5E00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9729 1 270 3.20.20.70
2y7dC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9673 1 274 3.20.20.70
2y7dC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9638 1 274 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9592 1 273 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2N3AT01-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 1.003 3 79 GO:0043720
GO:0046872
AF-A0A0C4YNL2-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9975 2 274 GO:0043720
GO:0046872
AF-A0A848WP47-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9958 1 274 GO:0043720
GO:0046872
AF-A0A651DCL5-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9956 1 274 GO:0043720
GO:0046872
AF-A0A1B6YLQ1-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9952 1 274 GO:0043720
GO:0046872

Map