F464263

General Info

Members Datasets Scaffolds Average Seq Length
565 254 561 280

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10039728|Ga0157372_100397285
Length 318
Sequence MVNIGSKIFLYIANFLLTKVQGILVDSSPVILFGDIILVTSKRINSFFMDQRIINLYDEYTHKPLTRKDFFHRLTLLTGSSAAAMTVLPLLEVNHSKAVITDQEDLFTEHITYPGSKTEMQAYVARPKEEKKYAAVVVIHENRGLNPHIEDVTRRAAKAGYLAIAPNALSPLGGTPPNEDDARAKFQQLDAAETLQNFIKVFDYLPTRKDCNGKWGCVGFCWGGGMSNDLAVNVPSIKAAVAFYGRQPAHYAGLDERIDAGIPAYEEALKKAGVTYEMYMYDGVNHAFHNDTAPTRYNEAAAKLAWQRTLEFFGKYLK

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
3 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
4 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
178 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
179 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
220 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
221 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
222 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
223 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
224 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
225 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
226 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
227 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
228 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
229 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
230 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
231 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
235 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
236 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
237 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
238 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 1.42
Rhizosphere 89.56
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000159 3300001989 Bacteria 21947
2 JGI24744J21845_10013098 3300002077 Bacteria 1675
3 JGI24751J29686_10000936 3300002459 Bacteria 6506
4 rootH2_10000765 3300003320 Bacteria 17073
5 rootH2_10239466 3300003320 Unclassified 4885
6 rootL2_10001671 3300003322 Bacteria 1909
7 rootL2_10056687 3300003322 Bacteria 2709
8 rootL2_10226502 3300003322 Bacteria 2266
9 rootH1_10000182 3300003323 Bacteria 80743
10 rootH1_10012210 3300003323 Bacteria 61025
11 rootH1_10022147 3300003323 Bacteria 28450
12 rootH1_10223359 3300003323 Bacteria 10891
13 JGI25160J50197_1001166 3300003354 Bacteria 13403
14 Ga0055526_1012431 3300003771 Bacteria 3715
15 Ga0055526_1021069 3300003771 Bacteria 2285
16 Ga0055528_1000386 3300003790 Bacteria 35904
17 Ga0055530_10000288 3300003791 Bacteria 45971
18 Ga0055543_1023274 3300004625 Bacteria 1119
19 Ga0065165_1000128 3300005262 Bacteria 129513
20 Ga0065714_10136230 3300005288 Unclassified 1207
21 Ga0065704_10143114 3300005289 Bacteria 1498
22 Ga0065704_10181513 3300005289 Bacteria 1235
23 Ga0065712_10005930 3300005290 Bacteria 2893
24 Ga0065712_10029848 3300005290 Bacteria 1308
25 Ga0065712_10091269 3300005290 Bacteria 2381
26 Ga0065715_10006774 3300005293 Bacteria 5012
27 Ga0065707_10163385 3300005295 Bacteria 1543
28 Ga0070676_10022242 3300005328 Bacteria 3555
29 Ga0070676_10027899 3300005328 Bacteria 3205
30 Ga0070683_100004517 3300005329 Bacteria 11484
31 Ga0070683_100005266 3300005329 Bacteria 10769
32 Ga0070683_100061124 3300005329 Bacteria 3502
33 Ga0070683_100540581 3300005329 Bacteria 1114
34 Ga0070690_100002669 3300005330 Bacteria 9615
35 Ga0070670_100021078 3300005331 Bacteria 5605
36 Ga0070670_100032461 3300005331 Unclassified 4497
37 Ga0070670_100071052 3300005331 Bacteria 2988
38 Ga0070670_100109034 3300005331 Unclassified 2386
39 Ga0070670_100169445 3300005331 Bacteria 1894
40 Ga0070670_100273902 3300005331 Unclassified 1473
41 Ga0070677_10064205 3300005333 Unclassified 1524
42 Ga0068869_100003315 3300005334 Bacteria 9838
43 Ga0068869_100012995 3300005334 Bacteria 5523
44 Ga0068869_100073250 3300005334 Unclassified 2539
45 Ga0068869_100367830 3300005334 Unclassified 1176
46 Ga0070682_100000071 3300005337 Bacteria 94177
47 Ga0070682_100014036 3300005337 Bacteria 4623
48 Ga0068868_100050751 3300005338 Bacteria 3259
49 Ga0068868_100226283 3300005338 Bacteria 1567
50 Ga0070689_100039954 3300005340 Bacteria 3595
51 Ga0070689_100050116 3300005340 Bacteria 3225
52 Ga0070689_100119277 3300005340 Bacteria 2106
53 Ga0070689_100147074 3300005340 Bacteria 1898
54 Ga0070689_100341301 3300005340 Bacteria 1254
55 Ga0070689_100359812 3300005340 Bacteria 1222
56 Ga0070687_100012664 3300005343 Bacteria 3731
57 Ga0070687_100034606 3300005343 Bacteria 2502
58 Ga0070687_100210338 3300005343 Bacteria 1184
59 Ga0070661_100001842 3300005344 Bacteria 14679
60 Ga0070661_100055124 3300005344 Bacteria 2911
61 Ga0070661_100095277 3300005344 Bacteria 2207
62 Ga0070661_100166552 3300005344 Bacteria 1672
63 Ga0070668_100013579 3300005347 Bacteria 6081
64 Ga0070668_100023447 3300005347 Bacteria 4668
65 Ga0070668_100075376 3300005347 Bacteria 2634
66 Ga0070668_100485840 3300005347 Unclassified 1067
67 Ga0070669_100004598 3300005353 Bacteria 9963
68 Ga0070669_100006248 3300005353 Bacteria 8599
69 Ga0070669_100016206 3300005353 Bacteria 5316
70 Ga0070669_100107375 3300005353 Bacteria 2114
71 Ga0070675_100057949 3300005354 Unclassified 3194
72 Ga0070675_100060652 3300005354 Bacteria 3123
73 Ga0070675_100067164 3300005354 Bacteria 2967
74 Ga0070675_100090576 3300005354 Unclassified 2562
75 Ga0070675_100198177 3300005354 Bacteria 1742
76 Ga0070675_100346560 3300005354 Bacteria 1317
77 Ga0070675_100391277 3300005354 Bacteria 1239
78 Ga0070671_100028095 3300005355 Bacteria 4632
79 Ga0070671_100031511 3300005355 Bacteria 4380
80 Ga0070671_100421795 3300005355 Unclassified 1143
81 Ga0070674_100079579 3300005356 Bacteria 2338
82 Ga0070674_100088227 3300005356 Bacteria 2232
83 Ga0070674_100619902 3300005356 Bacteria 916
84 Ga0070673_100006447 3300005364 Bacteria 7626
85 Ga0070673_100035453 3300005364 Bacteria 3783
86 Ga0070673_100088019 3300005364 Bacteria 2532
87 Ga0070688_100006235 3300005365 Bacteria 6353
88 Ga0070688_100008980 3300005365 Bacteria 5446
89 Ga0070688_100058533 3300005365 Bacteria 2426
90 Ga0070688_100067000 3300005365 Bacteria 2286
91 Ga0070659_100001036 3300005366 Bacteria 20329
92 Ga0070667_100007255 3300005367 Bacteria 9210
93 Ga0070667_100018176 3300005367 Bacteria 5829
94 Ga0070667_100065043 3300005367 Bacteria 3096
95 Ga0070701_10081610 3300005438 Unclassified 1752
96 Ga0070700_100159277 3300005441 Unclassified 1552
97 Ga0070694_100312488 3300005444 Unclassified 1207
98 Ga0070663_100064497 3300005455 Bacteria 2647
99 Ga0070678_100000605 3300005456 Bacteria 17659
100 Ga0070678_100004247 3300005456 Bacteria 8097
101 Ga0070678_100025666 3300005456 Bacteria 3970
102 Ga0070662_100001598 3300005457 Bacteria 13989
103 Ga0070662_100035436 3300005457 Bacteria 3524
104 Ga0070662_100048197 3300005457 Bacteria 3069
105 Ga0068867_100002197 3300005459 Bacteria 13683
106 Ga0068867_100044771 3300005459 Bacteria 3243
107 Ga0068867_100138934 3300005459 Bacteria 1897
108 Ga0068867_100403858 3300005459 Bacteria 1153
109 Ga0070685_10023053 3300005466 Bacteria 3404
110 Ga0070685_10036827 3300005466 Bacteria 2767
111 Ga0070685_10069038 3300005466 Bacteria 2089
112 Ga0070698_100004820 3300005471 Bacteria 14803
113 Ga0070698_100011741 3300005471 Bacteria 9291
114 Ga0070698_100047989 3300005471 Bacteria 4364
115 Ga0070699_100172788 3300005518 Bacteria 1915
116 Ga0070679_100457867 3300005530 Bacteria 1220
117 Ga0070684_100000751 3300005535 Bacteria 22449
118 Ga0070684_100023672 3300005535 Bacteria 5141
119 Ga0070684_100027594 3300005535 Bacteria 4794
120 Ga0068853_100000824 3300005539 Bacteria 21660
121 Ga0068853_100443448 3300005539 Bacteria 1220
122 Ga0070672_100037484 3300005543 Bacteria 3699
123 Ga0070672_100050030 3300005543 Bacteria 3254
124 Ga0070672_100075795 3300005543 Unclassified 2686
125 Ga0070672_100341250 3300005543 Unclassified 1276
126 Ga0070686_100008083 3300005544 Bacteria 5877
127 Ga0070686_100160100 3300005544 Bacteria 1585
128 Ga0068855_100003486 3300005563 Bacteria 19264
129 Ga0070664_100000795 3300005564 Bacteria 24308
130 Ga0070664_100003189 3300005564 Bacteria 13252
131 Ga0070664_100049953 3300005564 Bacteria 3538
132 Ga0070664_100056929 3300005564 Bacteria 3322
133 Ga0070664_100090318 3300005564 Bacteria 2651
134 Ga0070664_100263360 3300005564 Bacteria 1551
135 Ga0070664_100310782 3300005564 Bacteria 1426
136 Ga0070664_100315694 3300005564 Unclassified 1415
137 Ga0070664_100623281 3300005564 Bacteria 1001
138 Ga0068857_100000427 3300005577 Bacteria 29758
139 Ga0068857_100016335 3300005577 Bacteria 6504
140 Ga0068857_100123490 3300005577 Unclassified 2332
141 Ga0068857_100349571 3300005577 Bacteria 1369
142 Ga0068854_100042619 3300005578 Bacteria 3213
143 Ga0068856_100023291 3300005614 Bacteria 6022
144 Ga0070702_100105147 3300005615 Bacteria 1739
145 Ga0070702_100246088 3300005615 Bacteria 1209
146 Ga0068859_100008036 3300005617 Bacteria 10695
147 Ga0068859_100011172 3300005617 Bacteria 9029
148 Ga0068859_100013292 3300005617 Bacteria 8260
149 Ga0068859_100067711 3300005617 Bacteria 3605
150 Ga0068859_100140661 3300005617 Bacteria 2487
151 Ga0068859_100295014 3300005617 Bacteria 1714
152 Ga0068864_100002506 3300005618 Bacteria 15183
153 Ga0068864_100035708 3300005618 Bacteria 4233
154 Ga0068864_100035901 3300005618 Bacteria 4221
155 Ga0068864_100045359 3300005618 Bacteria 3771
156 Ga0068864_100092269 3300005618 Bacteria 2673
157 Ga0068864_100173872 3300005618 Bacteria 1965
158 Ga0068864_100190829 3300005618 Bacteria 1878
159 Ga0068864_100208300 3300005618 Bacteria 1799
160 Ga0068866_10002055 3300005718 Bacteria 8375
161 Ga0068861_100001969 3300005719 Bacteria 13238
162 Ga0068861_100003918 3300005719 Bacteria 9949
163 Ga0068861_100296089 3300005719 Bacteria 1399
164 Ga0068851_10040997 3300005834 Unclassified 2328
165 Ga0068851_10054649 3300005834 Bacteria 2034
166 Ga0068870_10022457 3300005840 Bacteria 3100
167 Ga0068863_100052396 3300005841 Bacteria 3868
168 Ga0068863_100086953 3300005841 Bacteria 2962
169 Ga0068863_100293834 3300005841 Bacteria 1575
170 Ga0068858_100211258 3300005842 Bacteria 1836
171 Ga0068860_100009767 3300005843 Bacteria 9528
172 Ga0068860_100014617 3300005843 Bacteria 7682
173 Ga0068860_100122392 3300005843 Bacteria 2492
174 Ga0068862_100038932 3300005844 Bacteria 4036
175 Ga0081539_10000037 3300005985 Bacteria 296160
176 Ga0075366_10083788 3300006195 Bacteria 1906
177 Ga0075366_10096144 3300006195 Bacteria 1776
178 Ga0097621_100000018 3300006237 Bacteria 88867
179 Ga0097621_100004248 3300006237 Bacteria 9955
180 Ga0097621_100033777 3300006237 Bacteria 4076
181 Ga0097621_100067523 3300006237 Bacteria 2947
182 Ga0097621_100124037 3300006237 Bacteria 2193
183 Ga0097621_100582184 3300006237 Bacteria 1021
184 Ga0068871_100000275 3300006358 Bacteria 35449
185 Ga0068871_100007679 3300006358 Bacteria 7714
186 Ga0068871_100027759 3300006358 Bacteria 4430
187 Ga0068871_100214188 3300006358 Unclassified 1667
188 Ga0075428_100055539 3300006844 Bacteria 4338
189 Ga0075428_100162262 3300006844 Unclassified 2425
190 Ga0075428_100185116 3300006844 Unclassified 2253
191 Ga0075428_100200864 3300006844 Unclassified 2155
192 Ga0075428_100250948 3300006844 Unclassified 1907
193 Ga0075430_100028152 3300006846 Bacteria 4774
194 Ga0075430_100060426 3300006846 Unclassified 3185
195 Ga0075431_100349547 3300006847 Unclassified 1486
196 Ga0075429_100014661 3300006880 Bacteria 6796
197 Ga0075429_100048668 3300006880 Unclassified 3686
198 Ga0068865_100016855 3300006881 Bacteria 4686
199 Ga0068865_100037263 3300006881 Bacteria 3282
200 Ga0068865_100053649 3300006881 Bacteria 2798
201 Ga0097620_100008036 3300006931 Bacteria 10695
202 Ga0097620_100011171 3300006931 Bacteria 9029
203 Ga0097620_100013292 3300006931 Bacteria 8260
204 Ga0097620_100067715 3300006931 Bacteria 3605
205 Ga0097620_100140672 3300006931 Bacteria 2487
206 Ga0097620_100295015 3300006931 Bacteria 1714
207 Ga0105240_10205259 3300009093 Bacteria 2307
208 Ga0111539_10007214 3300009094 Bacteria 14247
209 Ga0105247_10060412 3300009101 Bacteria 2349
210 Ga0105247_10172069 3300009101 Bacteria 1440
211 Ga0105241_10041140 3300009174 Bacteria 3491
212 Ga0105241_10113448 3300009174 Bacteria 2173
213 Ga0105242_10018943 3300009176 Bacteria 5390
214 Ga0105242_10020429 3300009176 Bacteria 5194
215 Ga0105237_10218912 3300009545 Bacteria 1904
216 Ga0105249_10016454 3300009553 Bacteria 6563
217 Ga0105249_10017633 3300009553 Bacteria 6340
218 Ga0105249_10027713 3300009553 Bacteria 5112
219 Ga0105249_10084961 3300009553 Bacteria 2948
220 Ga0105249_10133806 3300009553 Unclassified 2370
221 Ga0105249_10199080 3300009553 Bacteria 1959
222 Ga0105239_10358987 3300010375 Unclassified 1645
223 Ga0105246_10035012 3300011119 Bacteria 3352
224 Ga0105246_10063280 3300011119 Bacteria 2580
225 Ga0157373_10020309 3300013100 Bacteria 4830
226 Ga0157371_10027496 3300013102 Unclassified 4126
227 Ga0157371_10036290 3300013102 Bacteria 3530
228 Ga0157374_10006447 3300013296 Bacteria 9963
229 Ga0157374_10090983 3300013296 Bacteria 2909
230 Ga0157374_10291522 3300013296 Bacteria 1613
231 Ga0157374_10305013 3300013296 Bacteria 1576
232 Ga0157374_10651703 3300013296 Bacteria 1065
233 Ga0157378_10050289 3300013297 Bacteria 3709
234 Ga0157378_10780075 3300013297 Bacteria 980
235 Ga0163162_10000773 3300013306 Bacteria 29793
236 Ga0163162_10026074 3300013306 Bacteria 5777
237 Ga0163162_10044947 3300013306 Bacteria 4424
238 Ga0163162_10046870 3300013306 Bacteria 4333
239 Ga0163162_10065340 3300013306 Bacteria 3685
240 Ga0163162_10182982 3300013306 Bacteria 2222
241 Ga0163162_10200216 3300013306 Bacteria 2126
242 Ga0157372_10024136 3300013307 Bacteria 6600
243 Ga0157372_10039728 3300013307 Bacteria 5194
244 Ga0157372_10107483 3300013307 Unclassified 3192
245 Ga0157372_11085852 3300013307 Bacteria 926
246 Ga0157375_10004547 3300013308 Bacteria 12053
247 Ga0157375_10015493 3300013308 Bacteria 6825
248 Ga0157375_10027205 3300013308 Bacteria 5343
249 Ga0157375_10034613 3300013308 Bacteria 4813
250 Ga0157375_10043634 3300013308 Bacteria 4350
251 Ga0157375_10098616 3300013308 Bacteria 2999
252 Ga0163163_10004390 3300014325 Bacteria 12017
253 Ga0163163_10008393 3300014325 Bacteria 9173
254 Ga0163163_10013527 3300014325 Bacteria 7478
255 Ga0163163_10017383 3300014325 Bacteria 6706
256 Ga0163163_10260562 3300014325 Bacteria 1785
257 Ga0157380_10001574 3300014326 Bacteria 15001
258 Ga0157380_10030785 3300014326 Bacteria 4112
259 Ga0157380_10181235 3300014326 Unclassified 1851
260 Ga0157380_10245730 3300014326 Bacteria 1616
261 Ga0157380_10273561 3300014326 Bacteria 1541
262 Ga0157377_10006393 3300014745 Bacteria 5616
263 Ga0157379_10036805 3300014968 Bacteria 4363
264 Ga0157379_10120109 3300014968 Bacteria 2364
265 Ga0157379_10147483 3300014968 Bacteria 2122
266 Ga0157376_10000076 3300014969 Bacteria 75313
267 Ga0157376_10031239 3300014969 Bacteria 4262
268 Ga0157376_10150062 3300014969 Bacteria 2101
269 Ga0157376_10260921 3300014969 Bacteria 1623
270 Ga0163161_10004225 3300017792 Bacteria 10024
271 Ga0163161_10056431 3300017792 Bacteria 2852
272 Ga0163161_10183401 3300017792 Bacteria 1606
273 Ga0163161_10538263 3300017792 Unclassified 956
274 Ga0209673_1000085 3300025273 Bacteria 215647
275 Ga0209564_1004980 3300025295 Bacteria 7825
276 Ga0209564_1051159 3300025295 Bacteria 1005
277 Ga0209758_1007701 3300025297 Bacteria 7236
278 Ga0209758_1008347 3300025297 Bacteria 6738
279 Ga0209050_1000524 3300025298 Bacteria 63793
280 Ga0209050_1025451 3300025298 Bacteria 2010
281 Ga0207426_1001174 3300025302 Bacteria 23427
282 Ga0209257_1001638 3300025304 Bacteria 25639
283 Ga0207697_10163801 3300025315 Unclassified 971
284 Ga0207682_10027154 3300025893 Bacteria 2278
285 Ga0207688_10101964 3300025901 Bacteria 1658
286 Ga0207680_10093424 3300025903 Bacteria 1919
287 Ga0207647_10022491 3300025904 Bacteria 4185
288 Ga0207645_10000571 3300025907 Bacteria 30525
289 Ga0207645_10017668 3300025907 Bacteria 4703
290 Ga0207645_10062396 3300025907 Bacteria 2381
291 Ga0207643_10002295 3300025908 Bacteria 10408
292 Ga0207643_10024798 3300025908 Bacteria 3310
293 Ga0207695_10450956 3300025913 Unclassified 1169
294 Ga0207660_10085782 3300025917 Bacteria 2323
295 Ga0207662_10024771 3300025918 Unclassified 3454
296 Ga0207662_10028786 3300025918 Bacteria 3214
297 Ga0207662_10044295 3300025918 Bacteria 2627
298 Ga0207657_10089554 3300025919 Bacteria 2570
299 Ga0207649_10000985 3300025920 Bacteria 17629
300 Ga0207649_10008325 3300025920 Bacteria 5652
301 Ga0207649_10031430 3300025920 Bacteria 3155
302 Ga0207649_10148435 3300025920 Bacteria 1612
303 Ga0207652_10457929 3300025921 Unclassified 1150
304 Ga0207681_10005990 3300025923 Bacteria 7457
305 Ga0207681_10041752 3300025923 Bacteria 3060
306 Ga0207681_10053369 3300025923 Bacteria 2744
307 Ga0207681_10083174 3300025923 Bacteria 2265
308 Ga0207681_10132417 3300025923 Unclassified 1845
309 Ga0207681_10336371 3300025923 Bacteria 1205
310 Ga0207650_10001737 3300025925 Bacteria 15479
311 Ga0207650_10101248 3300025925 Bacteria 2218
312 Ga0207650_10149351 3300025925 Bacteria 1843
313 Ga0207650_10151343 3300025925 Unclassified 1831
314 Ga0207650_10562466 3300025925 Bacteria 957
315 Ga0207659_10016941 3300025926 Bacteria 4753
316 Ga0207659_10041876 3300025926 Bacteria 3209
317 Ga0207659_10053756 3300025926 Unclassified 2873
318 Ga0207659_10249544 3300025926 Bacteria 1439
319 Ga0207659_10386894 3300025926 Bacteria 1167
320 Ga0207644_10012160 3300025931 Bacteria 5712
321 Ga0207644_10192806 3300025931 Bacteria 1603
322 Ga0207644_10404836 3300025931 Bacteria 1116
323 Ga0207706_10001247 3300025933 Bacteria 25629
324 Ga0207706_10012699 3300025933 Bacteria 7668
325 Ga0207706_10012901 3300025933 Bacteria 7605
326 Ga0207706_10042849 3300025933 Bacteria 4011
327 Ga0207686_10002769 3300025934 Bacteria 9490
328 Ga0207686_10070861 3300025934 Bacteria 2241
329 Ga0207686_10443346 3300025934 Unclassified 997
330 Ga0207670_10002792 3300025936 Bacteria 9205
331 Ga0207670_10056846 3300025936 Bacteria 2651
332 Ga0207670_10067090 3300025936 Bacteria 2467
333 Ga0207670_10121721 3300025936 Bacteria 1898
334 Ga0207670_10159010 3300025936 Bacteria 1685
335 Ga0207670_10349458 3300025936 Bacteria 1170
336 Ga0207669_10019880 3300025937 Unclassified 3507
337 Ga0207669_10384677 3300025937 Bacteria 1094
338 Ga0207704_10033534 3300025938 Bacteria 2921
339 Ga0207704_10042422 3300025938 Bacteria 2678
340 Ga0207691_10005639 3300025940 Bacteria 12104
341 Ga0207691_10018871 3300025940 Bacteria 6532
342 Ga0207691_10034746 3300025940 Bacteria 4685
343 Ga0207691_10075396 3300025940 Bacteria 3041
344 Ga0207691_10100987 3300025940 Unclassified 2574
345 Ga0207691_10428951 3300025940 Unclassified 1126
346 Ga0207689_10000939 3300025942 Bacteria 28012
347 Ga0207689_10001600 3300025942 Bacteria 21433
348 Ga0207689_10003568 3300025942 Bacteria 14223
349 Ga0207689_10128718 3300025942 Bacteria 2083
350 Ga0207689_10346706 3300025942 Unclassified 1234
351 Ga0207689_10610910 3300025942 Unclassified 918
352 Ga0207661_10002365 3300025944 Bacteria 12980
353 Ga0207661_10003998 3300025944 Bacteria 10303
354 Ga0207661_10119435 3300025944 Bacteria 2242
355 Ga0207661_10674800 3300025944 Bacteria 950
356 Ga0207679_10000247 3300025945 Bacteria 41238
357 Ga0207679_10170757 3300025945 Bacteria 1790
358 Ga0207667_10031638 3300025949 Bacteria 5710
359 Ga0207651_10042189 3300025960 Bacteria 3034
360 Ga0207651_10320709 3300025960 Bacteria 1295
361 Ga0207651_10401310 3300025960 Bacteria 1166
362 Ga0207712_10000887 3300025961 Bacteria 21720
363 Ga0207712_10002875 3300025961 Bacteria 11006
364 Ga0207712_10008393 3300025961 Bacteria 6525
365 Ga0207712_10011042 3300025961 Bacteria 5749
366 Ga0207712_10014283 3300025961 Bacteria 5104
367 Ga0207712_10109980 3300025961 Bacteria 2065
368 Ga0207712_10307790 3300025961 Bacteria 1303
369 Ga0207712_10327451 3300025961 Unclassified 1266
370 Ga0207712_10407122 3300025961 Bacteria 1145
371 Ga0207668_10051778 3300025972 Bacteria 2838
372 Ga0207668_10363957 3300025972 Bacteria 1213
373 Ga0207658_10040251 3300025986 Bacteria 3377
374 Ga0207658_10082502 3300025986 Unclassified 2469
375 Ga0207658_10117114 3300025986 Bacteria 2117
376 Ga0207677_10064505 3300026023 Bacteria 2551
377 Ga0207677_10196638 3300026023 Bacteria 1599
378 Ga0207703_10058692 3300026035 Bacteria 3141
379 Ga0207703_10061757 3300026035 Bacteria 3068
380 Ga0207703_10073135 3300026035 Bacteria 2835
381 Ga0207703_10141214 3300026035 Unclassified 2090
382 Ga0207639_10012793 3300026041 Bacteria 5855
383 Ga0207639_10054427 3300026041 Bacteria 3058
384 Ga0207639_10599955 3300026041 Unclassified 1015
385 Ga0207708_10022687 3300026075 Bacteria 4739
386 Ga0207708_10236295 3300026075 Unclassified 1469
387 Ga0207702_10099997 3300026078 Bacteria 2558
388 Ga0207641_10005107 3300026088 Bacteria 11244
389 Ga0207641_10051999 3300026088 Bacteria 3469
390 Ga0207641_10114023 3300026088 Bacteria 2401
391 Ga0207641_10121325 3300026088 Bacteria 2333
392 Ga0207641_10184932 3300026088 Bacteria 1911
393 Ga0207641_10335083 3300026088 Bacteria 1438
394 Ga0207641_10336970 3300026088 Bacteria 1434
395 Ga0207648_10001686 3300026089 Bacteria 24217
396 Ga0207648_10002203 3300026089 Bacteria 21158
397 Ga0207648_10010609 3300026089 Bacteria 8712
398 Ga0207648_10041009 3300026089 Bacteria 4066
399 Ga0207648_10163840 3300026089 Bacteria 1964
400 Ga0207676_10019937 3300026095 Bacteria 4898
401 Ga0207676_10052901 3300026095 Bacteria 3176
402 Ga0207676_10075263 3300026095 Bacteria 2723
403 Ga0207676_10109062 3300026095 Bacteria 2312
404 Ga0207676_10161056 3300026095 Bacteria 1944
405 Ga0207676_10323276 3300026095 Bacteria 1417
406 Ga0207676_10395144 3300026095 Unclassified 1291
407 Ga0207674_10001291 3300026116 Bacteria 32707
408 Ga0207674_10037377 3300026116 Bacteria 5050
409 Ga0207674_10078664 3300026116 Unclassified 3303
410 Ga0207674_10206749 3300026116 Bacteria 1912
411 Ga0207674_10237701 3300026116 Bacteria 1769
412 Ga0207674_10474769 3300026116 Bacteria 1209
413 Ga0207675_100001768 3300026118 Bacteria 21608
414 Ga0207675_100002694 3300026118 Bacteria 17524
415 Ga0207675_100028220 3300026118 Bacteria 5226
416 Ga0207675_100051469 3300026118 Bacteria 3843
417 Ga0207675_100404841 3300026118 Bacteria 1345
418 Ga0207683_10000535 3300026121 Bacteria 35178
419 Ga0207683_10006885 3300026121 Bacteria 9735
420 Ga0207683_10037194 3300026121 Archaea 4238
421 Ga0207683_10038549 3300026121 Bacteria 4166
422 Ga0207683_10500791 3300026121 Bacteria 1122
423 Ga0207698_10101800 3300026142 Bacteria 2383
424 Ga0207698_10112024 3300026142 Bacteria 2289
425 Ga0207698_10412991 3300026142 Bacteria 1293
426 Ga0207428_10011923 3300027907 Bacteria 7652
427 Ga0268266_10177075 3300028379 Bacteria 1939
428 Ga0268265_10071601 3300028380 Bacteria 2701
429 Ga0268264_10013896 3300028381 Bacteria 6618
430 Ga0268264_10019426 3300028381 Bacteria 5553
431 Ga0268264_10185356 3300028381 Bacteria 1893
432 Ga0265327_10080292 3300031251 Bacteria 1613
433 Ga0307513_10254384 3300031456 Bacteria 1550
434 Ga0307509_10078756 3300031507 Bacteria 3413
435 Ga0307509_10225167 3300031507 Bacteria 1683
436 Ga0307509_10345974 3300031507 Unclassified 1212
437 Ga0307408_100000652 3300031548 Bacteria 29132
438 Ga0307408_100058808 3300031548 Bacteria 2796
439 Ga0307408_100089415 3300031548 Bacteria 2321
440 Ga0307508_10008362 3300031616 Bacteria 9562
441 Ga0307413_10100519 3300031824 Bacteria 1910
442 Ga0307518_10118916 3300031838 Unclassified 1873
443 Ga0307410_10225135 3300031852 Unclassified 1445
444 Ga0307406_10180253 3300031901 Bacteria 1537
445 Ga0307407_10025387 3300031903 Bacteria 3122
446 Ga0307407_10170510 3300031903 Bacteria 1433
447 Ga0307412_10007233 3300031911 Bacteria 6297
448 Ga0307412_10149345 3300031911 Bacteria 1722
449 Ga0307416_100000322 3300032002 Bacteria 24686
450 Ga0307416_100140303 3300032002 Bacteria 2195
451 Ga0307414_10040137 3300032004 Bacteria 3159
452 Ga0307415_100002700 3300032126 Bacteria 8864
453 Ga0373924_0007396 3300035410 Unclassified 3965
454 Ga0373927_0145496 3300035695 Bacteria 1551
455 Ga0373933_0083426 3300035724 Unclassified 1963
456 Ga0395905_0046088 3300037471 Unclassified 4088
457 Ga0395905_0411868 3300037471 Unclassified 1247
458 Ga0436365_0181133 3300039437 Unclassified 1121
459 Ga0436365_1052711 3300039437 Bacteria 25242
460 Ga0439439_0087531 3300041406 Unclassified 848
461 Ga0451797_1404866 3300041453 Unclassified 773
462 Ga0439441_001764 3300042001 Unclassified 2916
463 Ga0439441_006465 3300042001 Bacteria 1861
464 Ga0439445_0021053 3300042004 Bacteria 1636
465 Ga0439457_013802 3300042014 Bacteria 1813
466 Ga0450896_011539 3300042133 Bacteria 1245
467 Ga0439434_0002558 3300042435 Bacteria 5296
468 Ga0451577_0004985 3300042876 Bacteria 13768
469 Ga0451577_0537743 3300042876 Bacteria 1061
470 Ga0466961_0113119 3300044693 Bacteria 1707
471 Ga0453684_0107388 3300044712 Unclassified 3399
472 Ga0466957_0000578 3300044842 Bacteria 18516
473 Ga0495638_0062044 3300046460 Unclassified 2308
474 Ga0495582_0203572 3300046473 Bacteria 1131
475 Ga0495630_0184083 3300046517 Bacteria 1593
476 Ga0495668_0003813 3300046616 Bacteria 11034
477 Ga0495625_0439960 3300046660 Bacteria 807
478 Ga0495599_0349178 3300046678 Unclassified 887
479 Ga0495672_0007236 3300047320 Bacteria 8375
480 Ga0495672_0063816 3300047320 Bacteria 2112
481 Ga0495680_0118674 3300047322 Bacteria 1955
482 Ga0495686_0063214 3300047472 Bacteria 2294
483 Ga0495686_0188938 3300047472 Bacteria 1188
484 Ga0496100_0129365 3300048903 Bacteria 1776
485 Ga0496101_0384857 3300048904 Unclassified 1104
486 Ga0496104_0297356 3300048907 Bacteria 1527
487 Ga0496105_0347111 3300048908 Bacteria 1186
488 Ga0496106_0518835 3300048909 Unclassified 957
489 Ga0496110_0125425 3300048913 Bacteria 2316
490 Ga0496114_0054321 3300048917 Bacteria 3340
491 Ga0501298_000444 3300049521 Bacteria 5567
492 Ga0501300_001207 3300049523 Bacteria 3924
493 Ga0501032_0010733 3300049569 Bacteria 6594
494 Ga0501034_0008758 3300049571 Bacteria 10650
495 Ga0501034_0017551 3300049571 Bacteria 7339
496 Ga0501034_0170160 3300049571 Bacteria 2146
497 Ga0501036_0012212 3300049572 Bacteria 7116
498 Ga0501037_0017158 3300049573 Bacteria 5328
499 Ga0501037_0056114 3300049573 Unclassified 2878
500 Ga0501038_0300146 3300049574 Bacteria 1261
501 Ga0501039_0078269 3300049575 Unclassified 2572
502 Ga0501039_0115088 3300049575 Bacteria 2104
503 Ga0501043_0049149 3300049579 Unclassified 3315
504 Ga0501043_0059268 3300049579 Unclassified 3004
505 Ga0501043_0069112 3300049579 Bacteria 2774
506 Ga0501043_0173993 3300049579 Bacteria 1679
507 Ga0501046_0070859 3300049580 Unclassified 2709
508 Ga0501047_0009459 3300049581 Bacteria 9207
509 Ga0501047_0054864 3300049581 Bacteria 3854
510 Ga0501047_0163006 3300049581 Unclassified 2101
511 Ga0501067_0041303 3300049583 Bacteria 2561
512 Ga0501073_0018578 3300049589 Bacteria 5026
513 Ga0501073_0103769 3300049589 Unclassified 1974
514 Ga0501074_0100038 3300049590 Unclassified 2075
515 Ga0501077_0205578 3300049593 Bacteria 1251
516 Ga0501198_000560 3300049649 Bacteria 4648
517 Ga0501201_000453 3300049651 Bacteria 3780
518 Ga0501216_022785 3300049660 Bacteria 1109
519 Ga0501217_006451 3300049661 Unclassified 2493
520 Ga0501223_005125 3300049663 Bacteria 2769
521 Ga0501235_000507 3300049669 Bacteria 7781
522 Ga0501235_034810 3300049669 Bacteria 1143
523 Ga0501243_000292 3300049675 Bacteria 6458
524 Ga0501252_001749 3300049682 Bacteria 2066
525 Ga0501257_002778 3300049686 Bacteria 3703
526 Ga0501259_000215 3300049688 Bacteria 8882
527 Ga0501261_001529 3300049690 Bacteria 2846
528 Ga0501225_0001574 3300049705 Bacteria 7148
529 Ga0501225_0015013 3300049705 Bacteria 2161
530 Ga0501245_001570 3300049708 Bacteria 2976
531 Ga0501079_0136462 3300049741 Unclassified 1910
532 Ga0501083_0003657 3300049744 Bacteria 10792
533 Ga0501232_006801 3300049757 Bacteria 1187
534 Ga0501266_005536 3300049763 Bacteria 1570
535 Ga0501268_003890 3300049765 Bacteria 2075
536 Ga0501270_003227 3300049767 Bacteria 1742
537 Ga0501282_001927 3300049778 Bacteria 2286
538 Ga0501035_0002820 3300049822 Bacteria 16814
539 Ga0501035_0083619 3300049822 Bacteria 2816
540 Ga0501044_0002309 3300049823 Bacteria 21726
541 Ga0501044_0024007 3300049823 Bacteria 6478
542 Ga0501044_0459462 3300049823 Bacteria 1179
543 nmdc:mga0k408_29803_c1 3300050493 Bacteria 3108
544 nmdc:mga09592_260536_c1 3300050508 Unclassified 1504
545 nmdc:mga0qj67_30076_c1 3300050509 Bacteria 4224
546 nmdc:mga06r32_271578_c1 3300050510 Unclassified 1683
547 nmdc:mga08y16_14118_c1 3300050511 Bacteria 8409
548 Ga0495619_0141674 3300053085 Unclassified 1656
549 Ga0500583_0000546 3300053092 Bacteria 11466
550 Ga0500641_0023563 3300053096 Bacteria 2368
551 Ga0500658_0071219 3300053134 Bacteria 1468
552 Ga0500604_0020591 3300053151 Bacteria 1858
553 Ga0500616_0016137 3300053153 Bacteria 4259
554 Ga0500616_0017408 3300053153 Bacteria 4077
555 Ga0500616_0111991 3300053153 Bacteria 1317
556 Ga0500622_0000015 3300053156 Bacteria 346227
557 Ga0500622_0000022 3300053156 Bacteria 267246
558 Ga0500622_0004874 3300053156 Bacteria 8215
559 Ga0500622_0073683 3300053156 Bacteria 1722
560 Ga0500611_000076 3300053727 Bacteria 38269
561 Ga0501084_0389316 3300054114 Unclassified 1178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0439960 Ga0495625_0439960_27_755 242
2 3300041453 Ga0451797_1404866 Ga0451797_1404866_25_756 243
3 3300025940 Ga0207691_10018871 Ga0207691_100188712 247
4 3300041406 Ga0439439_0087531 Ga0439439_0087531_73_822 249
5 3300025940 Ga0207691_10428951 Ga0207691_104289511 250
6 3300026088 Ga0207641_10336970 Ga0207641_103369702 252
7 3300049579 Ga0501043_0173993 Ga0501043_0173993_95_856 253
8 3300049823 Ga0501044_0459462 Ga0501044_0459462_384_1145 253
9 3300013296 Ga0157374_10291522 Ga0157374_102915221 261
10 3300014325 Ga0163163_10013527 Ga0163163_1001352710 261
11 3300032004 Ga0307414_10040137 Ga0307414_100401372 267
12 3300049661 Ga0501217_006451 Ga0501217_006451_1111_1956 267
13 3300005564 Ga0070664_100090318 Ga0070664_1000903182 269
14 3300005329 Ga0070683_100004517 Ga0070683_1000045176 270
15 3300005329 Ga0070683_100005266 Ga0070683_1000052666 270
16 3300005330 Ga0070690_100002669 Ga0070690_1000026699 270
17 3300005334 Ga0068869_100367830 Ga0068869_1003678302 270
18 3300005337 Ga0070682_100014036 Ga0070682_1000140362 270
19 3300005340 Ga0070689_100359812 Ga0070689_1003598122 270
20 3300005344 Ga0070661_100001842 Ga0070661_10000184214 270
21 3300005344 Ga0070661_100055124 Ga0070661_1000551243 270
22 3300005354 Ga0070675_100060652 Ga0070675_1000606522 270
23 3300005354 Ga0070675_100067164 Ga0070675_1000671641 270
24 3300005365 Ga0070688_100058533 Ga0070688_1000585332 270
25 3300005366 Ga0070659_100001036 Ga0070659_1000010364 270
26 3300005456 Ga0070678_100004247 Ga0070678_1000042473 270
27 3300005457 Ga0070662_100001598 Ga0070662_10000159813 270
28 3300005459 Ga0068867_100044771 Ga0068867_1000447711 270
29 3300005466 Ga0070685_10069038 Ga0070685_100690382 270
30 3300005535 Ga0070684_100000751 Ga0070684_1000007512 270
31 3300005535 Ga0070684_100023672 Ga0070684_1000236726 270
32 3300005539 Ga0068853_100000824 Ga0068853_10000082421 270
33 3300005544 Ga0070686_100008083 Ga0070686_1000080834 270
34 3300005564 Ga0070664_100000795 Ga0070664_10000079511 270
35 3300005564 Ga0070664_100003189 Ga0070664_10000318911 270
36 3300005564 Ga0070664_100315694 Ga0070664_1003156942 270
37 3300005577 Ga0068857_100000427 Ga0068857_10000042712 270
38 3300005577 Ga0068857_100349571 Ga0068857_1003495712 270
39 3300005615 Ga0070702_100105147 Ga0070702_1001051471 270
40 3300005618 Ga0068864_100035901 Ga0068864_1000359013 270
41 3300006237 Ga0097621_100033777 Ga0097621_1000337773 270
42 3300006358 Ga0068871_100027759 Ga0068871_1000277594 270
43 3300013100 Ga0157373_10020309 Ga0157373_100203092 270
44 3300013296 Ga0157374_10006447 Ga0157374_100064476 270
45 3300013296 Ga0157374_10090983 Ga0157374_100909832 270
46 3300013306 Ga0163162_10182982 Ga0163162_101829822 270
47 3300013307 Ga0157372_10039728 Ga0157372_100397285 270
48 3300013308 Ga0157375_10027205 Ga0157375_100272055 270
49 3300013308 Ga0157375_10043634 Ga0157375_100436344 270
50 3300014325 Ga0163163_10008393 Ga0163163_100083934 270
51 3300014969 Ga0157376_10031239 Ga0157376_100312394 270
52 3300017792 Ga0163161_10056431 Ga0163161_100564312 270
53 3300025919 Ga0207657_10089554 Ga0207657_100895542 270
54 3300025920 Ga0207649_10000985 Ga0207649_1000098514 270
55 3300025920 Ga0207649_10031430 Ga0207649_100314302 270
56 3300025926 Ga0207659_10041876 Ga0207659_100418765 270
57 3300025931 Ga0207644_10192806 Ga0207644_101928062 270
58 3300025933 Ga0207706_10001247 Ga0207706_1000124720 270
59 3300025933 Ga0207706_10042849 Ga0207706_100428495 270
60 3300025934 Ga0207686_10443346 Ga0207686_104433462 270
61 3300025936 Ga0207670_10067090 Ga0207670_100670902 270
62 3300025940 Ga0207691_10034746 Ga0207691_100347462 270
63 3300025942 Ga0207689_10003568 Ga0207689_100035688 270
64 3300025942 Ga0207689_10610910 Ga0207689_106109101 270
65 3300025944 Ga0207661_10002365 Ga0207661_100023658 270
66 3300025944 Ga0207661_10003998 Ga0207661_100039987 270
67 3300025945 Ga0207679_10000247 Ga0207679_1000024720 270
68 3300025945 Ga0207679_10170757 Ga0207679_101707572 270
69 3300025960 Ga0207651_10320709 Ga0207651_103207092 270
70 3300025960 Ga0207651_10401310 Ga0207651_104013102 270
71 3300026023 Ga0207677_10064505 Ga0207677_100645053 270
72 3300026035 Ga0207703_10141214 Ga0207703_101412143 270
73 3300026041 Ga0207639_10054427 Ga0207639_100544273 270
74 3300026089 Ga0207648_10010609 Ga0207648_100106094 270
75 3300026095 Ga0207676_10019937 Ga0207676_100199371 270
76 3300026095 Ga0207676_10395144 Ga0207676_103951442 270
77 3300026116 Ga0207674_10001291 Ga0207674_1000129120 270
78 3300026116 Ga0207674_10037377 Ga0207674_100373773 270
79 3300026121 Ga0207683_10006885 Ga0207683_100068858 270
80 3300026142 Ga0207698_10101800 Ga0207698_101018002 270
81 3300048904 Ga0496101_0384857 Ga0496101_0384857_74_925 270
82 3300048907 Ga0496104_0297356 Ga0496104_0297356_632_1480 270
83 3300048909 Ga0496106_0518835 Ga0496106_0518835_35_943 270
84 3300054114 Ga0501084_0389316 Ga0501084_0389316_50_862 270
85 3300005355 Ga0070671_100421795 Ga0070671_1004217952 271
86 3300005618 Ga0068864_100035708 Ga0068864_1000357083 271
87 3300005841 Ga0068863_100293834 Ga0068863_1002938342 271
88 3300014325 Ga0163163_10260562 Ga0163163_102605622 271
89 3300014326 Ga0157380_10181235 Ga0157380_101812352 271
90 3300014968 Ga0157379_10036805 Ga0157379_100368052 271
91 3300025903 Ga0207680_10093424 Ga0207680_100934242 271
92 3300025925 Ga0207650_10562466 Ga0207650_105624661 271
93 3300025936 Ga0207670_10002792 Ga0207670_100027922 271
94 3300025986 Ga0207658_10082502 Ga0207658_100825023 271
95 3300026035 Ga0207703_10058692 Ga0207703_100586922 271
96 3300026088 Ga0207641_10114023 Ga0207641_101140232 271
97 3300026095 Ga0207676_10323276 Ga0207676_103232762 271
98 3300028381 Ga0268264_10185356 Ga0268264_101853563 271
99 3300031903 Ga0307407_10170510 Ga0307407_101705102 271
100 3300042001 Ga0439441_001764 Ga0439441_001764_1023_1877 271
101 3300042876 Ga0451577_0537743 Ga0451577_0537743_67_918 271
102 3300048913 Ga0496110_0125425 Ga0496110_0125425_801_1652 271
103 3300049686 Ga0501257_002778 Ga0501257_002778_440_1285 271
104 3300049763 Ga0501266_005536 Ga0501266_005536_124_969 271
105 3300049765 Ga0501268_003890 Ga0501268_003890_338_1183 271
106 3300049767 Ga0501270_003227 Ga0501270_003227_729_1574 271
107 3300005290 Ga0065712_10091269 Ga0065712_100912692 272
108 3300005340 Ga0070689_100341301 Ga0070689_1003413012 272
109 3300005343 Ga0070687_100034606 Ga0070687_1000346062 272
110 3300005365 Ga0070688_100067000 Ga0070688_1000670002 272
111 3300005466 Ga0070685_10036827 Ga0070685_100368272 272
112 3300005471 Ga0070698_100004820 Ga0070698_1000048209 272
113 3300005518 Ga0070699_100172788 Ga0070699_1001727882 272
114 3300005544 Ga0070686_100160100 Ga0070686_1001601002 272
115 3300005617 Ga0068859_100295014 Ga0068859_1002950141 272
116 3300005618 Ga0068864_100208300 Ga0068864_1002083002 272
117 3300005842 Ga0068858_100211258 Ga0068858_1002112582 272
118 3300006844 Ga0075428_100162262 Ga0075428_1001622624 272
119 3300006931 Ga0097620_100295015 Ga0097620_1002950151 272
120 3300009101 Ga0105247_10060412 Ga0105247_100604122 272
121 3300009553 Ga0105249_10027713 Ga0105249_100277134 272
122 3300014968 Ga0157379_10120109 Ga0157379_101201093 272
123 3300017792 Ga0163161_10183401 Ga0163161_101834012 272
124 3300025918 Ga0207662_10028786 Ga0207662_100287862 272
125 3300025961 Ga0207712_10002875 Ga0207712_100028754 272
126 3300026035 Ga0207703_10061757 Ga0207703_100617574 272
127 3300026095 Ga0207676_10052901 Ga0207676_100529012 272
128 3300026118 Ga0207675_100028220 Ga0207675_1000282203 272
129 3300031616 Ga0307508_10008362 Ga0307508_100083625 272
130 3300044693 Ga0466961_0113119 Ga0466961_0113119_509_1366 272
131 3300047320 Ga0495672_0063816 Ga0495672_0063816_679_1578 272
132 3300049669 Ga0501235_034810 Ga0501235_034810_75_929 272
133 3300005289 Ga0065704_10143114 Ga0065704_101431142 273
134 3300005295 Ga0065707_10163385 Ga0065707_101633852 273
135 3300005331 Ga0070670_100273902 Ga0070670_1002739022 273
136 3300005471 Ga0070698_100011741 Ga0070698_1000117417 273
137 3300005615 Ga0070702_100246088 Ga0070702_1002460881 273
138 3300005618 Ga0068864_100045359 Ga0068864_1000453592 273
139 3300006237 Ga0097621_100067523 Ga0097621_1000675232 273
140 3300006844 Ga0075428_100185116 Ga0075428_1001851163 273
141 3300009176 Ga0105242_10020429 Ga0105242_100204293 273
142 3300025934 Ga0207686_10002769 Ga0207686_100027692 273
143 3300025961 Ga0207712_10000887 Ga0207712_100008878 273
144 3300026088 Ga0207641_10005107 Ga0207641_100051078 273
145 3300026088 Ga0207641_10335083 Ga0207641_103350832 273
146 3300026095 Ga0207676_10161056 Ga0207676_101610562 273
147 3300005337 Ga0070682_100000071 Ga0070682_10000007131 274
148 3300005614 Ga0068856_100023291 Ga0068856_1000232916 274
149 3300037471 Ga0395905_0411868 Ga0395905_0411868_180_1031 274
150 3300046616 Ga0495668_0003813 Ga0495668_0003813_47_904 274
151 3300005355 Ga0070671_100028095 Ga0070671_1000280954 275
152 3300005456 Ga0070678_100025666 Ga0070678_1000256663 275
153 3300005841 Ga0068863_100052396 Ga0068863_1000523962 275
154 3300006237 Ga0097621_100000018 Ga0097621_10000001869 275
155 3300006358 Ga0068871_100000275 Ga0068871_1000002752 275
156 3300009101 Ga0105247_10172069 Ga0105247_101720692 275
157 3300009174 Ga0105241_10041140 Ga0105241_100411403 275
158 3300014969 Ga0157376_10000076 Ga0157376_1000007642 275
159 3300017792 Ga0163161_10004225 Ga0163161_100042255 275
160 3300026089 Ga0207648_10163840 Ga0207648_101638402 275
161 3300026121 Ga0207683_10038549 Ga0207683_100385493 275
162 3300042133 Ga0450896_011539 Ga0450896_011539_172_1023 275
163 3300042435 Ga0439434_0002558 Ga0439434_0002558_1353_2204 275
164 3300042876 Ga0451577_0004985 Ga0451577_0004985_4482_5336 275
165 3300031507 Ga0307509_10078756 Ga0307509_100787562 276
166 3300047320 Ga0495672_0007236 Ga0495672_0007236_2478_3329 276
167 3300005843 Ga0068860_100009767 Ga0068860_1000097677 277
168 3300013306 Ga0163162_10000773 Ga0163162_100007739 277
169 3300028381 Ga0268264_10013896 Ga0268264_100138967 277
170 3300005331 Ga0070670_100032461 Ga0070670_1000324614 278
171 3300005340 Ga0070689_100039954 Ga0070689_1000399544 278
172 3300005343 Ga0070687_100012664 Ga0070687_1000126643 278
173 3300005347 Ga0070668_100013579 Ga0070668_1000135794 278
174 3300005353 Ga0070669_100004598 Ga0070669_10000459810 278
175 3300005354 Ga0070675_100057949 Ga0070675_1000579492 278
176 3300005364 Ga0070673_100006447 Ga0070673_1000064472 278
177 3300005365 Ga0070688_100006235 Ga0070688_1000062355 278
178 3300005438 Ga0070701_10081610 Ga0070701_100816101 278
179 3300005441 Ga0070700_100159277 Ga0070700_1001592772 278
180 3300005444 Ga0070694_100312488 Ga0070694_1003124881 278
181 3300005457 Ga0070662_100035436 Ga0070662_1000354363 278
182 3300005543 Ga0070672_100075795 Ga0070672_1000757952 278
183 3300005577 Ga0068857_100016335 Ga0068857_1000163352 278
184 3300005617 Ga0068859_100013292 Ga0068859_1000132924 278
185 3300005719 Ga0068861_100003918 Ga0068861_1000039184 278
186 3300006844 Ga0075428_100250948 Ga0075428_1002509482 278
187 3300006931 Ga0097620_100013292 Ga0097620_1000132926 278
188 3300009094 Ga0111539_10007214 Ga0111539_100072142 278
189 3300009553 Ga0105249_10133806 Ga0105249_101338062 278
190 3300013308 Ga0157375_10004547 Ga0157375_100045479 278
191 3300014326 Ga0157380_10001574 Ga0157380_1000157413 278
192 3300014745 Ga0157377_10006393 Ga0157377_100063933 278
193 3300025315 Ga0207697_10163801 Ga0207697_101638011 278
194 3300025908 Ga0207643_10024798 Ga0207643_100247983 278
195 3300025918 Ga0207662_10024771 Ga0207662_100247713 278
196 3300025923 Ga0207681_10005990 Ga0207681_100059908 278
197 3300025925 Ga0207650_10151343 Ga0207650_101513432 278
198 3300025926 Ga0207659_10053756 Ga0207659_100537562 278
199 3300025933 Ga0207706_10012699 Ga0207706_100126996 278
200 3300025936 Ga0207670_10349458 Ga0207670_103494581 278
201 3300025940 Ga0207691_10100987 Ga0207691_101009872 278
202 3300025961 Ga0207712_10407122 Ga0207712_104071221 278
203 3300026075 Ga0207708_10236295 Ga0207708_102362952 278
204 3300026116 Ga0207674_10078664 Ga0207674_100786643 278
205 3300026118 Ga0207675_100001768 Ga0207675_1000017686 278
206 3300027907 Ga0207428_10011923 Ga0207428_100119235 278
207 3300050511 nmdc:mga08y16_14118_c1 nmdc:mga08y16_14118_c1_6783_7634 278
208 iso_pu_bacteria 2840677318 2840678188 280
209 iso_pu_bacteria 2896085136 2896086006 280
210 iso_pu_bacteria 2896109856 2896110537 280
211 3300005834 Ga0068851_10054649 Ga0068851_100546493 281
212 3300037471 Ga0395905_0046088 Ga0395905_0046088_3021_3866 281
213 iso_pu_bacteria 2738541278 2738726230 281
214 3300005328 Ga0070676_10027899 Ga0070676_100278993 282
215 3300005329 Ga0070683_100540581 Ga0070683_1005405811 282
216 3300005334 Ga0068869_100003315 Ga0068869_1000033157 282
217 3300005338 Ga0068868_100050751 Ga0068868_1000507513 282
218 3300005340 Ga0070689_100147074 Ga0070689_1001470742 282
219 3300005344 Ga0070661_100166552 Ga0070661_1001665522 282
220 3300005354 Ga0070675_100198177 Ga0070675_1001981773 282
221 3300005455 Ga0070663_100064497 Ga0070663_1000644973 282
222 3300005457 Ga0070662_100048197 Ga0070662_1000481972 282
223 3300005530 Ga0070679_100457867 Ga0070679_1004578671 282
224 3300005564 Ga0070664_100263360 Ga0070664_1002633602 282
225 3300005564 Ga0070664_100310782 Ga0070664_1003107822 282
226 3300005578 Ga0068854_100042619 Ga0068854_1000426192 282
227 3300005617 Ga0068859_100008036 Ga0068859_10000803610 282
228 3300005985 Ga0081539_10000037 Ga0081539_10000037263 282
229 3300006881 Ga0068865_100053649 Ga0068865_1000536493 282
230 3300006931 Ga0097620_100008036 Ga0097620_10000803610 282
231 3300013307 Ga0157372_10107483 Ga0157372_101074834 282
232 3300014969 Ga0157376_10260921 Ga0157376_102609211 282
233 3300025904 Ga0207647_10022491 Ga0207647_100224912 282
234 3300025907 Ga0207645_10017668 Ga0207645_100176682 282
235 3300025917 Ga0207660_10085782 Ga0207660_100857823 282
236 3300025921 Ga0207652_10457929 Ga0207652_104579292 282
237 3300025926 Ga0207659_10386894 Ga0207659_103868942 282
238 3300025931 Ga0207644_10404836 Ga0207644_104048361 282
239 3300025933 Ga0207706_10012901 Ga0207706_100129012 282
240 3300025936 Ga0207670_10121721 Ga0207670_101217212 282
241 3300025938 Ga0207704_10033534 Ga0207704_100335343 282
242 3300025942 Ga0207689_10001600 Ga0207689_1000160015 282
243 3300025944 Ga0207661_10674800 Ga0207661_106748001 282
244 3300025961 Ga0207712_10014283 Ga0207712_100142832 282
245 3300025972 Ga0207668_10363957 Ga0207668_103639571 282
246 3300026035 Ga0207703_10073135 Ga0207703_100731351 282
247 3300026041 Ga0207639_10599955 Ga0207639_105999551 282
248 3300026116 Ga0207674_10237701 Ga0207674_102377012 282
249 3300026142 Ga0207698_10412991 Ga0207698_104129912 282
250 3300046473 Ga0495582_0203572 Ga0495582_0203572_217_1065 282
251 3300002077 JGI24744J21845_10013098 JGI24744J21845_100130981 283
252 3300002459 JGI24751J29686_10000936 JGI24751J29686_100009365 283
253 3300003322 rootL2_10056687 rootL2_100566873 283
254 3300005288 Ga0065714_10136230 Ga0065714_101362302 283
255 3300005289 Ga0065704_10181513 Ga0065704_101815132 283
256 3300005290 Ga0065712_10005930 Ga0065712_100059303 283
257 3300005290 Ga0065712_10029848 Ga0065712_100298481 283
258 3300005293 Ga0065715_10006774 Ga0065715_100067743 283
259 3300005328 Ga0070676_10022242 Ga0070676_100222423 283
260 3300005329 Ga0070683_100061124 Ga0070683_1000611246 283
261 3300005331 Ga0070670_100021078 Ga0070670_1000210782 283
262 3300005331 Ga0070670_100071052 Ga0070670_1000710523 283
263 3300005331 Ga0070670_100169445 Ga0070670_1001694452 283
264 3300005334 Ga0068869_100012995 Ga0068869_1000129955 283
265 3300005334 Ga0068869_100073250 Ga0068869_1000732502 283
266 3300005338 Ga0068868_100226283 Ga0068868_1002262832 283
267 3300005340 Ga0070689_100050116 Ga0070689_1000501163 283
268 3300005340 Ga0070689_100119277 Ga0070689_1001192771 283
269 3300005343 Ga0070687_100210338 Ga0070687_1002103382 283
270 3300005344 Ga0070661_100095277 Ga0070661_1000952771 283
271 3300005347 Ga0070668_100023447 Ga0070668_1000234473 283
272 3300005347 Ga0070668_100075376 Ga0070668_1000753762 283
273 3300005347 Ga0070668_100485840 Ga0070668_1004858401 283
274 3300005353 Ga0070669_100006248 Ga0070669_1000062483 283
275 3300005353 Ga0070669_100016206 Ga0070669_1000162065 283
276 3300005353 Ga0070669_100107375 Ga0070669_1001073752 283
277 3300005354 Ga0070675_100090576 Ga0070675_1000905763 283
278 3300005354 Ga0070675_100346560 Ga0070675_1003465601 283
279 3300005355 Ga0070671_100031511 Ga0070671_1000315117 283
280 3300005356 Ga0070674_100079579 Ga0070674_1000795792 283
281 3300005356 Ga0070674_100088227 Ga0070674_1000882273 283
282 3300005364 Ga0070673_100035453 Ga0070673_1000354533 283
283 3300005364 Ga0070673_100088019 Ga0070673_1000880192 283
284 3300005365 Ga0070688_100008980 Ga0070688_1000089805 283
285 3300005367 Ga0070667_100007255 Ga0070667_1000072557 283
286 3300005367 Ga0070667_100018176 Ga0070667_1000181765 283
287 3300005367 Ga0070667_100065043 Ga0070667_1000650432 283
288 3300005456 Ga0070678_100000605 Ga0070678_1000006053 283
289 3300005459 Ga0068867_100002197 Ga0068867_1000021977 283
290 3300005459 Ga0068867_100138934 Ga0068867_1001389342 283
291 3300005459 Ga0068867_100403858 Ga0068867_1004038581 283
292 3300005466 Ga0070685_10023053 Ga0070685_100230532 283
293 3300005471 Ga0070698_100047989 Ga0070698_1000479894 283
294 3300005535 Ga0070684_100027594 Ga0070684_1000275948 283
295 3300005539 Ga0068853_100443448 Ga0068853_1004434481 283
296 3300005543 Ga0070672_100037484 Ga0070672_1000374843 283
297 3300005543 Ga0070672_100050030 Ga0070672_1000500301 283
298 3300005543 Ga0070672_100341250 Ga0070672_1003412502 283
299 3300005564 Ga0070664_100049953 Ga0070664_1000499536 283
300 3300005564 Ga0070664_100056929 Ga0070664_1000569292 283
301 3300005564 Ga0070664_100623281 Ga0070664_1006232811 283
302 3300005577 Ga0068857_100123490 Ga0068857_1001234903 283
303 3300005617 Ga0068859_100011172 Ga0068859_1000111726 283
304 3300005617 Ga0068859_100067711 Ga0068859_1000677114 283
305 3300005617 Ga0068859_100140661 Ga0068859_1001406612 283
306 3300005618 Ga0068864_100002506 Ga0068864_1000025068 283
307 3300005618 Ga0068864_100092269 Ga0068864_1000922693 283
308 3300005618 Ga0068864_100190829 Ga0068864_1001908292 283
309 3300005718 Ga0068866_10002055 Ga0068866_100020552 283
310 3300005719 Ga0068861_100001969 Ga0068861_1000019695 283
311 3300005719 Ga0068861_100296089 Ga0068861_1002960893 283
312 3300005840 Ga0068870_10022457 Ga0068870_100224572 283
313 3300005841 Ga0068863_100086953 Ga0068863_1000869533 283
314 3300005843 Ga0068860_100014617 Ga0068860_1000146175 283
315 3300005843 Ga0068860_100122392 Ga0068860_1001223921 283
316 3300005844 Ga0068862_100038932 Ga0068862_1000389322 283
317 3300006195 Ga0075366_10083788 Ga0075366_100837882 283
318 3300006195 Ga0075366_10096144 Ga0075366_100961441 283
319 3300006237 Ga0097621_100004248 Ga0097621_1000042487 283
320 3300006237 Ga0097621_100582184 Ga0097621_1005821841 283
321 3300006358 Ga0068871_100007679 Ga0068871_1000076793 283
322 3300006844 Ga0075428_100055539 Ga0075428_1000555392 283
323 3300006844 Ga0075428_100200864 Ga0075428_1002008642 283
324 3300006846 Ga0075430_100028152 Ga0075430_1000281524 283
325 3300006846 Ga0075430_100060426 Ga0075430_1000604263 283
326 3300006847 Ga0075431_100349547 Ga0075431_1003495472 283
327 3300006880 Ga0075429_100014661 Ga0075429_1000146615 283
328 3300006880 Ga0075429_100048668 Ga0075429_1000486682 283
329 3300006881 Ga0068865_100016855 Ga0068865_1000168555 283
330 3300006881 Ga0068865_100037263 Ga0068865_1000372634 283
331 3300006931 Ga0097620_100011171 Ga0097620_1000111716 283
332 3300006931 Ga0097620_100067715 Ga0097620_1000677152 283
333 3300006931 Ga0097620_100140672 Ga0097620_1001406722 283
334 3300009176 Ga0105242_10018943 Ga0105242_100189432 283
335 3300009553 Ga0105249_10016454 Ga0105249_100164541 283
336 3300009553 Ga0105249_10017633 Ga0105249_100176334 283
337 3300009553 Ga0105249_10084961 Ga0105249_100849612 283
338 3300009553 Ga0105249_10199080 Ga0105249_101990802 283
339 3300010375 Ga0105239_10358987 Ga0105239_103589872 283
340 3300011119 Ga0105246_10035012 Ga0105246_100350123 283
341 3300011119 Ga0105246_10063280 Ga0105246_100632802 283
342 3300013102 Ga0157371_10027496 Ga0157371_100274962 283
343 3300013102 Ga0157371_10036290 Ga0157371_100362902 283
344 3300013296 Ga0157374_10651703 Ga0157374_106517031 283
345 3300013297 Ga0157378_10050289 Ga0157378_100502892 283
346 3300013297 Ga0157378_10780075 Ga0157378_107800751 283
347 3300013306 Ga0163162_10026074 Ga0163162_100260743 283
348 3300013306 Ga0163162_10044947 Ga0163162_100449473 283
349 3300013306 Ga0163162_10046870 Ga0163162_100468703 283
350 3300013306 Ga0163162_10200216 Ga0163162_102002162 283
351 3300013308 Ga0157375_10015493 Ga0157375_100154934 283
352 3300013308 Ga0157375_10034613 Ga0157375_100346132 283
353 3300013308 Ga0157375_10098616 Ga0157375_100986164 283
354 3300014325 Ga0163163_10004390 Ga0163163_100043907 283
355 3300014325 Ga0163163_10017383 Ga0163163_100173831 283
356 3300014326 Ga0157380_10030785 Ga0157380_100307854 283
357 3300014326 Ga0157380_10245730 Ga0157380_102457302 283
358 3300014968 Ga0157379_10147483 Ga0157379_101474832 283
359 3300014969 Ga0157376_10150062 Ga0157376_101500622 283
360 3300025893 Ga0207682_10027154 Ga0207682_100271542 283
361 3300025901 Ga0207688_10101964 Ga0207688_101019642 283
362 3300025907 Ga0207645_10000571 Ga0207645_100005717 283
363 3300025907 Ga0207645_10062396 Ga0207645_100623962 283
364 3300025908 Ga0207643_10002295 Ga0207643_100022952 283
365 3300025918 Ga0207662_10044295 Ga0207662_100442952 283
366 3300025920 Ga0207649_10008325 Ga0207649_100083252 283
367 3300025920 Ga0207649_10148435 Ga0207649_101484352 283
368 3300025923 Ga0207681_10041752 Ga0207681_100417523 283
369 3300025923 Ga0207681_10053369 Ga0207681_100533692 283
370 3300025923 Ga0207681_10083174 Ga0207681_100831742 283
371 3300025923 Ga0207681_10132417 Ga0207681_101324172 283
372 3300025923 Ga0207681_10336371 Ga0207681_103363711 283
373 3300025925 Ga0207650_10001737 Ga0207650_1000173715 283
374 3300025926 Ga0207659_10016941 Ga0207659_100169414 283
375 3300025926 Ga0207659_10249544 Ga0207659_102495441 283
376 3300025931 Ga0207644_10012160 Ga0207644_100121603 283
377 3300025934 Ga0207686_10070861 Ga0207686_100708613 283
378 3300025936 Ga0207670_10056846 Ga0207670_100568462 283
379 3300025936 Ga0207670_10159010 Ga0207670_101590102 283
380 3300025937 Ga0207669_10019880 Ga0207669_100198803 283
381 3300025938 Ga0207704_10042422 Ga0207704_100424223 283
382 3300025940 Ga0207691_10005639 Ga0207691_100056396 283
383 3300025942 Ga0207689_10000939 Ga0207689_1000093913 283
384 3300025942 Ga0207689_10128718 Ga0207689_101287182 283
385 3300025942 Ga0207689_10346706 Ga0207689_103467062 283
386 3300025944 Ga0207661_10119435 Ga0207661_101194352 283
387 3300025960 Ga0207651_10042189 Ga0207651_100421892 283
388 3300025961 Ga0207712_10008393 Ga0207712_100083931 283
389 3300025961 Ga0207712_10011042 Ga0207712_100110425 283
390 3300025961 Ga0207712_10109980 Ga0207712_101099803 283
391 3300025961 Ga0207712_10307790 Ga0207712_103077902 283
392 3300025961 Ga0207712_10327451 Ga0207712_103274512 283
393 3300025972 Ga0207668_10051778 Ga0207668_100517783 283
394 3300025986 Ga0207658_10040251 Ga0207658_100402512 283
395 3300025986 Ga0207658_10117114 Ga0207658_101171142 283
396 3300026023 Ga0207677_10196638 Ga0207677_101966381 283
397 3300026041 Ga0207639_10012793 Ga0207639_100127935 283
398 3300026075 Ga0207708_10022687 Ga0207708_100226872 283
399 3300026088 Ga0207641_10051999 Ga0207641_100519993 283
400 3300026088 Ga0207641_10121325 Ga0207641_101213253 283
401 3300026088 Ga0207641_10184932 Ga0207641_101849322 283
402 3300026089 Ga0207648_10001686 Ga0207648_100016865 283
403 3300026089 Ga0207648_10002203 Ga0207648_1000220314 283
404 3300026089 Ga0207648_10041009 Ga0207648_100410092 283
405 3300026095 Ga0207676_10075263 Ga0207676_100752632 283
406 3300026095 Ga0207676_10109062 Ga0207676_101090623 283
407 3300026116 Ga0207674_10206749 Ga0207674_102067492 283
408 3300026116 Ga0207674_10474769 Ga0207674_104747691 283
409 3300026118 Ga0207675_100002694 Ga0207675_1000026946 283
410 3300026118 Ga0207675_100051469 Ga0207675_1000514692 283
411 3300026118 Ga0207675_100404841 Ga0207675_1004048412 283
412 3300026121 Ga0207683_10000535 Ga0207683_1000053511 283
413 3300026121 Ga0207683_10037194 Ga0207683_100371944 283
414 3300026142 Ga0207698_10112024 Ga0207698_101120241 283
415 3300028379 Ga0268266_10177075 Ga0268266_101770752 283
416 3300028380 Ga0268265_10071601 Ga0268265_100716012 283
417 3300028381 Ga0268264_10019426 Ga0268264_100194262 283
418 3300031456 Ga0307513_10254384 Ga0307513_102543842 283
419 3300031507 Ga0307509_10345974 Ga0307509_103459742 283
420 3300031548 Ga0307408_100089415 Ga0307408_1000894152 283
421 3300031838 Ga0307518_10118916 Ga0307518_101189162 283
422 3300031901 Ga0307406_10180253 Ga0307406_101802531 283
423 3300031911 Ga0307412_10149345 Ga0307412_101493452 283
424 3300032002 Ga0307416_100140303 Ga0307416_1001403033 283
425 3300035410 Ga0373924_0007396 Ga0373924_0007396_244_1095 283
426 3300035724 Ga0373933_0083426 Ga0373933_0083426_208_1059 283
427 3300039437 Ga0436365_0181133 Ga0436365_0181133_259_1110 283
428 3300042001 Ga0439441_006465 Ga0439441_006465_190_1044 283
429 3300044712 Ga0453684_0107388 Ga0453684_0107388_1983_2834 283
430 3300046460 Ga0495638_0062044 Ga0495638_0062044_164_1015 283
431 3300046517 Ga0495630_0184083 Ga0495630_0184083_648_1499 283
432 3300046678 Ga0495599_0349178 Ga0495599_0349178_14_865 283
433 3300047322 Ga0495680_0118674 Ga0495680_0118674_506_1357 283
434 3300047472 Ga0495686_0063214 Ga0495686_0063214_1164_2015 283
435 3300047472 Ga0495686_0188938 Ga0495686_0188938_231_1082 283
436 3300048903 Ga0496100_0129365 Ga0496100_0129365_32_883 283
437 3300048908 Ga0496105_0347111 Ga0496105_0347111_89_940 283
438 3300048917 Ga0496114_0054321 Ga0496114_0054321_2164_3015 283
439 3300049521 Ga0501298_000444 Ga0501298_000444_3474_4328 283
440 3300049569 Ga0501032_0010733 Ga0501032_0010733_3217_4068 283
441 3300049571 Ga0501034_0008758 Ga0501034_0008758_6052_6903 283
442 3300049572 Ga0501036_0012212 Ga0501036_0012212_4264_5115 283
443 3300049573 Ga0501037_0056114 Ga0501037_0056114_1496_2347 283
444 3300049575 Ga0501039_0078269 Ga0501039_0078269_1245_2096 283
445 3300049579 Ga0501043_0049149 Ga0501043_0049149_1714_2565 283
446 3300049580 Ga0501046_0070859 Ga0501046_0070859_1239_2090 283
447 3300049581 Ga0501047_0009459 Ga0501047_0009459_6051_6902 283
448 3300049581 Ga0501047_0163006 Ga0501047_0163006_653_1504 283
449 3300049583 Ga0501067_0041303 Ga0501067_0041303_1398_2249 283
450 3300049589 Ga0501073_0018578 Ga0501073_0018578_428_1279 283
451 3300049589 Ga0501073_0103769 Ga0501073_0103769_89_940 283
452 3300049590 Ga0501074_0100038 Ga0501074_0100038_797_1648 283
453 3300049649 Ga0501198_000560 Ga0501198_000560_379_1233 283
454 3300049651 Ga0501201_000453 Ga0501201_000453_1428_2282 283
455 3300049660 Ga0501216_022785 Ga0501216_022785_104_958 283
456 3300049663 Ga0501223_005125 Ga0501223_005125_1179_2111 283
457 3300049669 Ga0501235_000507 Ga0501235_000507_1904_2758 283
458 3300049675 Ga0501243_000292 Ga0501243_000292_3456_4388 283
459 3300049682 Ga0501252_001749 Ga0501252_001749_892_1746 283
460 3300049688 Ga0501259_000215 Ga0501259_000215_4402_5334 283
461 3300049690 Ga0501261_001529 Ga0501261_001529_1579_2511 283
462 3300049705 Ga0501225_0015013 Ga0501225_0015013_10_861 283
463 3300049708 Ga0501245_001570 Ga0501245_001570_1197_2129 283
464 3300049741 Ga0501079_0136462 Ga0501079_0136462_815_1666 283
465 3300049744 Ga0501083_0003657 Ga0501083_0003657_2856_3707 283
466 3300049757 Ga0501232_006801 Ga0501232_006801_274_1128 283
467 3300049822 Ga0501035_0002820 Ga0501035_0002820_4794_5645 283
468 3300049823 Ga0501044_0002309 Ga0501044_0002309_1099_1950 283
469 3300050493 nmdc:mga0k408_29803_c1 nmdc:mga0k408_29803_c1_1448_2299 283
470 3300050508 nmdc:mga09592_260536_c1 nmdc:mga09592_260536_c1_205_1059 283
471 3300050509 nmdc:mga0qj67_30076_c1 nmdc:mga0qj67_30076_c1_3077_3931 283
472 3300050510 nmdc:mga06r32_271578_c1 nmdc:mga06r32_271578_c1_265_1119 283
473 3300053085 Ga0495619_0141674 Ga0495619_0141674_142_993 283
474 3300053096 Ga0500641_0023563 Ga0500641_0023563_492_1343 283
475 3300053153 Ga0500616_0016137 Ga0500616_0016137_3335_4186 283
476 3300053153 Ga0500616_0111991 Ga0500616_0111991_237_1088 283
477 3300053727 Ga0500611_000076 Ga0500611_000076_15640_16491 283
478 3300005333 Ga0070677_10064205 Ga0070677_100642052 284
479 3300005356 Ga0070674_100619902 Ga0070674_1006199021 284
480 3300017792 Ga0163161_10538263 Ga0163161_105382631 284
481 3300025937 Ga0207669_10384677 Ga0207669_103846771 284
482 3300042004 Ga0439445_0021053 Ga0439445_0021053_176_1030 284
483 3300049571 Ga0501034_0170160 Ga0501034_0170160_174_1028 284
484 3300001989 JGI24739J22299_10000159 JGI24739J22299_1000015912 285
485 3300003320 rootH2_10000765 rootH2_1000076518 285
486 3300003320 rootH2_10239466 rootH2_102394662 285
487 3300003322 rootL2_10001671 rootL2_100016713 285
488 3300003322 rootL2_10226502 rootL2_102265021 285
489 3300003323 rootH1_10000182 rootH1_100001828 285
490 3300003323 rootH1_10012210 rootH1_1001221030 285
491 3300003323 rootH1_10022147 rootH1_100221474 285
492 3300003323 rootH1_10223359 rootH1_1022335913 285
493 3300003354 JGI25160J50197_1001166 JGI25160J50197_10011665 285
494 3300003771 Ga0055526_1012431 Ga0055526_10124312 285
495 3300003771 Ga0055526_1021069 Ga0055526_10210691 285
496 3300003790 Ga0055528_1000386 Ga0055528_100038618 285
497 3300003791 Ga0055530_10000288 Ga0055530_1000028830 285
498 3300004625 Ga0055543_1023274 Ga0055543_10232741 285
499 3300005262 Ga0065165_1000128 Ga0065165_100012829 285
500 3300005331 Ga0070670_100109034 Ga0070670_1001090342 285
501 3300005354 Ga0070675_100391277 Ga0070675_1003912771 285
502 3300005563 Ga0068855_100003486 Ga0068855_10000348623 285
503 3300005618 Ga0068864_100173872 Ga0068864_1001738722 285
504 3300005834 Ga0068851_10040997 Ga0068851_100409972 285
505 3300006237 Ga0097621_100124037 Ga0097621_1001240373 285
506 3300006358 Ga0068871_100214188 Ga0068871_1002141882 285
507 3300009093 Ga0105240_10205259 Ga0105240_102052592 285
508 3300009174 Ga0105241_10113448 Ga0105241_101134482 285
509 3300009545 Ga0105237_10218912 Ga0105237_102189122 285
510 3300013296 Ga0157374_10305013 Ga0157374_103050131 285
511 3300013306 Ga0163162_10065340 Ga0163162_100653402 285
512 3300013307 Ga0157372_10024136 Ga0157372_100241364 285
513 3300013307 Ga0157372_11085852 Ga0157372_110858521 285
514 3300014326 Ga0157380_10273561 Ga0157380_102735611 285
515 3300025273 Ga0209673_1000085 Ga0209673_1000085103 285
516 3300025295 Ga0209564_1004980 Ga0209564_10049802 285
517 3300025295 Ga0209564_1051159 Ga0209564_10511591 285
518 3300025297 Ga0209758_1007701 Ga0209758_10077012 285
519 3300025297 Ga0209758_1008347 Ga0209758_10083476 285
520 3300025298 Ga0209050_1000524 Ga0209050_100052433 285
521 3300025298 Ga0209050_1025451 Ga0209050_10254512 285
522 3300025302 Ga0207426_1001174 Ga0207426_100117416 285
523 3300025304 Ga0209257_1001638 Ga0209257_100163817 285
524 3300025913 Ga0207695_10450956 Ga0207695_104509562 285
525 3300025925 Ga0207650_10101248 Ga0207650_101012481 285
526 3300025925 Ga0207650_10149351 Ga0207650_101493511 285
527 3300025940 Ga0207691_10075396 Ga0207691_100753963 285
528 3300025949 Ga0207667_10031638 Ga0207667_100316383 285
529 3300026078 Ga0207702_10099997 Ga0207702_100999972 285
530 3300026121 Ga0207683_10500791 Ga0207683_105007911 285
531 3300031251 Ga0265327_10080292 Ga0265327_100802922 285
532 3300031507 Ga0307509_10225167 Ga0307509_102251673 285
533 3300031548 Ga0307408_100000652 Ga0307408_10000065220 285
534 3300031548 Ga0307408_100058808 Ga0307408_1000588082 285
535 3300031824 Ga0307413_10100519 Ga0307413_101005193 285
536 3300031852 Ga0307410_10225135 Ga0307410_102251352 285
537 3300031903 Ga0307407_10025387 Ga0307407_100253873 285
538 3300031911 Ga0307412_10007233 Ga0307412_100072335 285
539 3300032002 Ga0307416_100000322 Ga0307416_10000032211 285
540 3300032126 Ga0307415_100002700 Ga0307415_1000027005 285
541 3300035695 Ga0373927_0145496 Ga0373927_0145496_587_1444 285
542 3300039437 Ga0436365_1052711 Ga0436365_1052711_20425_21282 285
543 3300042014 Ga0439457_013802 Ga0439457_013802_862_1719 285
544 3300044842 Ga0466957_0000578 Ga0466957_0000578_7549_8406 285
545 3300049523 Ga0501300_001207 Ga0501300_001207_207_1064 285
546 3300049571 Ga0501034_0017551 Ga0501034_0017551_377_1234 285
547 3300049573 Ga0501037_0017158 Ga0501037_0017158_4170_5027 285
548 3300049574 Ga0501038_0300146 Ga0501038_0300146_360_1217 285
549 3300049575 Ga0501039_0115088 Ga0501039_0115088_1170_2027 285
550 3300049579 Ga0501043_0059268 Ga0501043_0059268_2053_2910 285
551 3300049579 Ga0501043_0069112 Ga0501043_0069112_1555_2412 285
552 3300049581 Ga0501047_0054864 Ga0501047_0054864_2863_3720 285
553 3300049593 Ga0501077_0205578 Ga0501077_0205578_108_1028 285
554 3300049705 Ga0501225_0001574 Ga0501225_0001574_1723_2580 285
555 3300049778 Ga0501282_001927 Ga0501282_001927_1168_2064 285
556 3300049822 Ga0501035_0083619 Ga0501035_0083619_1426_2283 285
557 3300049823 Ga0501044_0024007 Ga0501044_0024007_1524_2381 285
558 3300053092 Ga0500583_0000546 Ga0500583_0000546_8828_9736 285
559 3300053134 Ga0500658_0071219 Ga0500658_0071219_171_1085 285
560 3300053151 Ga0500604_0020591 Ga0500604_0020591_596_1453 285
561 3300053153 Ga0500616_0017408 Ga0500616_0017408_193_1053 285
562 3300053156 Ga0500622_0000015 Ga0500622_0000015_78832_79689 285
563 3300053156 Ga0500622_0000022 Ga0500622_0000022_183299_184156 285
564 3300053156 Ga0500622_0004874 Ga0500622_0004874_7036_7896 285
565 3300053156 Ga0500622_0073683 Ga0500622_0073683_735_1643 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

120

317

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9643 50 284
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9485 50 284
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8971 60 285
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8945 60 281
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.8937 58 285
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9602 50 284 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9522 50 284 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9191 60 284 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9166 76 284 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9131 58 285 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3C1TI09-F1-model_v4 Carboxymethylenebutenolidase 1.004 175 283 GO:0016787
AF-A0A1I1KUD9-F1-model_v4 Dienelactone hydrolase family protein 1.001 154 283 GO:0016787
AF-A0A3N5H463-F1-model_v4 Dienelactone hydrolase family protein 0.9974 180 283 GO:0016787
AF-A0A6N3QHR6-F1-model_v4 Putative enzyme 0.9972 170 285 GO:0016787
AF-A0A4R2BIH8-F1-model_v4 Dienelactone hydrolase family protein 0.9964 181 283 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.34 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map