F464148

General Info

Members Datasets Scaffolds Average Seq Length
564 385 532 240

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100423067|Ga0068854_1004230672
Length 282
Sequence MLLGRASRLIAVLDLQRRMVIAIARPGRSAKLSEARVAVVSGAAQGIGAATARRLASDGHAVALIDLDENACKDGVDAILADGGQATAIGCDVADESAVAAAFETIAAQLGAPTILVNNAGIIRDNLLFKMPVDDFDAVLNVHLRGAFLMSRAAQRFMTGQRFGRIVNLSSVAALGNRGQTNYSAAKAGVQGFTKTLAIELGPFGVTVNAIAPGFIQTDMTAATAERIGVPFEEFIASASEQIPVRRVGQPEDIAHTVSFLVSEGAGFVSGQIIYLAGGPTC

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
4 2643221576 Nocardioides sp. Root614 Isolate Unclassified
5 2643221590 Nocardioides sp. Root682 Isolate Unclassified
6 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
7 2643221604 Nocardioides sp. Root190 Isolate Unclassified
8 2643221617 Nocardioides sp. Root79 Isolate Unclassified
9 2643221620 Nocardioides sp. Root240 Isolate Unclassified
10 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
11 2643221638 Duganella sp. Root336D2 Isolate Unclassified
12 2643221692 Nocardia sp. Root136 Isolate Unclassified
13 2738543010 Bacillus sp. YR335 Isolate Unclassified
14 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
15 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
16 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
17 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
18 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
19 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
20 2857553236 Duganella sp. R-74557 Isolate Unclassified
21 2862574272 Streptomyces sp. AcE210 Isolate Nodule
22 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
23 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
24 2891562705 Microbispora tritici MT50 Isolate Unclassified
25 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
26 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
33 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
41 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
42 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
43 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
225 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
226 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
229 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
232 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
233 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
234 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
345 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
350 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
351 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
352 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
364 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
373 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
374 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
375 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
381 649633069 Micromonospora sp. L5 Isolate Unclassified
382 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
383 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
384 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
385 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 1.6
Isolates 5.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.3
Nodule 0.53
Rhizoplane 4.96
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001712 3300001904 Bacteria 3954
2 JGI24741J21665_1000010 3300001915 Bacteria 44368
3 JGI24740J21852_10008764 3300001979 Bacteria 4013
4 JGI24739J22299_10000064 3300001989 Bacteria 29745
5 JGI24737J22298_10001765 3300001990 Bacteria 7737
6 JGI24743J22301_10011629 3300001991 Bacteria 1589
7 JGI24750J21931_1023946 3300002070 Bacteria 869
8 JGI24738J21930_10033544 3300002075 Bacteria 1046
9 JGI25158J39367_1001766 3300002739 Bacteria 3689
10 JGI25152J39213_1003851 3300002773 Bacteria 4950
11 JGI25150J39212_1005125 3300002774 Bacteria 2829
12 JGI25150J39212_1011438 3300002774 Bacteria 1609
13 JGI25153J46596_10008450 3300003215 Bacteria 4921
14 rootL2_10103237 3300003322 Bacteria 1177
15 JGI25161J50226_1009399 3300003374 Bacteria 1395
16 Ga0055539_1000034 3300003752 Bacteria 223400
17 Ga0055533_1006415 3300003756 Bacteria 1736
18 Ga0055525_1000538 3300003759 Bacteria 18074
19 Ga0055529_1000403 3300003763 Bacteria 45873
20 Ga0055526_1005592 3300003771 Bacteria 7164
21 Ga0055537_1006604 3300003773 Bacteria 2913
22 Ga0055524_1000234 3300003775 Bacteria 58774
23 Ga0055524_1006560 3300003775 Bacteria 5033
24 Ga0055524_1008881 3300003775 Bacteria 4137
25 Ga0055524_1016262 3300003775 Bacteria 2675
26 Ga0055534_1011123 3300003784 Bacteria 1845
27 Ga0055534_1011642 3300003784 Bacteria 1777
28 Ga0055528_1002474 3300003790 Bacteria 9876
29 Ga0055530_10008671 3300003791 Bacteria 4027
30 Ga0055531_10033093 3300003794 Bacteria 1673
31 Ga0070683_100014373 3300005329 Bacteria 6924
32 Ga0070683_100506973 3300005329 Bacteria 1153
33 Ga0070682_100018971 3300005337 Bacteria 4028
34 Ga0068868_100223154 3300005338 Bacteria 1578
35 Ga0070660_100004481 3300005339 Bacteria 9653
36 Ga0070687_100109015 3300005343 Bacteria 1564
37 Ga0070661_100198773 3300005344 Bacteria 1531
38 Ga0070668_100004901 3300005347 Bacteria 9920
39 Ga0070668_100130364 3300005347 Bacteria 2018
40 Ga0070668_100503163 3300005347 Bacteria 1049
41 Ga0070669_100208607 3300005353 Bacteria 1540
42 Ga0070674_100194342 3300005356 Bacteria 1562
43 Ga0070688_100271507 3300005365 Bacteria 1215
44 Ga0070659_100009247 3300005366 Bacteria 7234
45 Ga0070659_100074720 3300005366 Bacteria 2700
46 Ga0070659_100130848 3300005366 Bacteria 2038
47 Ga0070713_100686314 3300005436 Bacteria 977
48 Ga0070701_10047723 3300005438 Bacteria 2206
49 Ga0070711_100061196 3300005439 Bacteria 2620
50 Ga0070700_100022720 3300005441 Bacteria 3663
51 Ga0070708_100031336 3300005445 Bacteria 4601
52 Ga0070708_100058196 3300005445 Bacteria 3443
53 Ga0070708_100113950 3300005445 Bacteria 2487
54 Ga0070681_10325911 3300005458 Bacteria 1446
55 Ga0068867_100240219 3300005459 Bacteria 1469
56 Ga0070685_10039955 3300005466 Bacteria 2668
57 Ga0070706_100004098 3300005467 Bacteria 14173
58 Ga0070706_100016881 3300005467 Bacteria 6743
59 Ga0070706_100507853 3300005467 Bacteria 1121
60 Ga0070707_100003448 3300005468 Bacteria 14946
61 Ga0070707_100166915 3300005468 Bacteria 2145
62 Ga0070698_100077837 3300005471 Bacteria 3315
63 Ga0070698_100089243 3300005471 Bacteria 3067
64 Ga0070699_100000298 3300005518 Bacteria 47855
65 Ga0070699_100134048 3300005518 Bacteria 2184
66 Ga0070684_100020890 3300005535 Bacteria 5434
67 Ga0070684_100035439 3300005535 Bacteria 4270
68 Ga0070684_100642438 3300005535 Bacteria 988
69 Ga0070697_100056441 3300005536 Bacteria 3195
70 Ga0068853_100001500 3300005539 Bacteria 16952
71 Ga0068853_100043128 3300005539 Bacteria 3860
72 Ga0070672_100028650 3300005543 Bacteria 4167
73 Ga0068855_100001045 3300005563 Bacteria 34361
74 Ga0068857_100033467 3300005577 Bacteria 4545
75 Ga0068854_100001196 3300005578 Bacteria 15559
76 Ga0068854_100423067 3300005578 Bacteria 1107
77 Ga0068856_100045173 3300005614 Bacteria 4336
78 Ga0070702_100008749 3300005615 Bacteria 4920
79 Ga0070702_100009006 3300005615 Bacteria 4864
80 Ga0068852_100000924 3300005616 Bacteria 19430
81 Ga0068852_100066930 3300005616 Bacteria 3139
82 Ga0068852_100785124 3300005616 Bacteria 966
83 Ga0068864_100096470 3300005618 Bacteria 2617
84 Ga0068866_10004804 3300005718 Bacteria 5545
85 Ga0068866_10029454 3300005718 Bacteria 2626
86 Ga0068861_100067139 3300005719 Bacteria 2767
87 Ga0068851_10007031 3300005834 Bacteria 5161
88 Ga0068870_10004500 3300005840 Bacteria 6002
89 Ga0081538_10016227 3300005981 Bacteria 5724
90 Ga0081538_10054394 3300005981 Bacteria 2368
91 Ga0081538_10086006 3300005981 Bacteria 1648
92 Ga0081540_1088150 3300005983 Bacteria 1373
93 Ga0081539_10005489 3300005985 Bacteria 12888
94 Ga0070717_10016423 3300006028 Bacteria 5738
95 Ga0070717_10092781 3300006028 Bacteria 2551
96 Ga0075365_10006611 3300006038 Bacteria 6399
97 Ga0075365_10012036 3300006038 Bacteria 5117
98 Ga0075368_10004447 3300006042 Bacteria 4753
99 Ga0075363_100039933 3300006048 Bacteria 2472
100 Ga0075364_10015616 3300006051 Bacteria 4712
101 Ga0070712_100015119 3300006175 Bacteria 4963
102 Ga0075362_10002027 3300006177 Bacteria 6670
103 Ga0075362_10128102 3300006177 Bacteria 1205
104 Ga0097621_100256897 3300006237 Bacteria 1532
105 Ga0075370_10135981 3300006353 Bacteria 1436
106 Ga0075428_100000043 3300006844 Bacteria 102004
107 Ga0075428_100101410 3300006844 Bacteria 3138
108 Ga0075428_100184363 3300006844 Bacteria 2258
109 Ga0075428_100214647 3300006844 Bacteria 2079
110 Ga0068865_100025194 3300006881 Bacteria 3909
111 Ga0068865_100171162 3300006881 Bacteria 1665
112 Ga0068865_100439834 3300006881 Bacteria 1076
113 Ga0105251_10001505 3300009011 Bacteria 20012
114 Ga0105244_10001347 3300009036 Bacteria 20009
115 Ga0105250_10002004 3300009092 Bacteria 10550
116 Ga0105240_10029849 3300009093 Bacteria 7096
117 Ga0111539_10231013 3300009094 Bacteria 2154
118 Ga0105245_10036539 3300009098 Bacteria 4364
119 Ga0105245_10042569 3300009098 Bacteria 4053
120 Ga0105245_10371493 3300009098 Bacteria 1422
121 Ga0114129_10140385 3300009147 Bacteria 3312
122 Ga0105243_10033259 3300009148 Bacteria 3987
123 Ga0105243_10084645 3300009148 Bacteria 2597
124 Ga0105241_10000156 3300009174 Bacteria 49491
125 Ga0105237_10068545 3300009545 Bacteria 3541
126 Ga0105238_10000079 3300009551 Bacteria 109619
127 Ga0105238_10007164 3300009551 Bacteria 11153
128 Ga0105238_10037915 3300009551 Bacteria 4898
129 Ga0105238_10322401 3300009551 Bacteria 1531
130 Ga0105238_10606292 3300009551 Bacteria 1103
131 Ga0105249_10061179 3300009553 Bacteria 3455
132 Ga0105249_10117819 3300009553 Bacteria 2519
133 Ga0105239_10034546 3300010375 Bacteria 5552
134 Ga0105239_10050416 3300010375 Bacteria 4566
135 Ga0105239_10151901 3300010375 Bacteria 2584
136 Ga0105239_10399812 3300010375 Bacteria 1555
137 Ga0157369_10002092 3300013105 Bacteria 24134
138 Ga0157369_10272408 3300013105 Bacteria 1764
139 Ga0157378_10023032 3300013297 Bacteria 5483
140 Ga0163162_10077494 3300013306 Bacteria 3388
141 Ga0157372_10087937 3300013307 Bacteria 3527
142 Ga0157372_10259217 3300013307 Bacteria 2019
143 Ga0157375_10041467 3300013308 Bacteria 4445
144 Ga0157375_10273672 3300013308 Bacteria 1851
145 Ga0157380_10019890 3300014326 Bacteria 5010
146 Ga0157380_10323137 3300014326 Bacteria 1431
147 Ga0157377_10399380 3300014745 Bacteria 936
148 Ga0157376_10606287 3300014969 Bacteria 1090
149 Ga0163161_10100949 3300017792 Bacteria 2148
150 Ga0206353_10256792 3300020082 Bacteria 2425
151 Ga0206353_11163641 3300020082 Bacteria 1956
152 Ga0206353_11427395 3300020082 Bacteria 1352
153 Ga0213872_10000263 3300021361 Bacteria 45483
154 Ga0213872_10111713 3300021361 Bacteria 1213
155 Ga0224712_10056235 3300022467 Bacteria 1550
156 Ga0209436_100291 3300025208 Bacteria 23121
157 Ga0209784_100003 3300025224 Bacteria 1379451
158 Ga0209784_100293 3300025224 Bacteria 27186
159 Ga0209566_100002 3300025225 Bacteria 2614868
160 Ga0209674_100008 3300025226 Bacteria 1076909
161 Ga0209563_100004 3300025230 Bacteria 1814108
162 Ga0207425_1000001 3300025245 Bacteria 2525432
163 Ga0207425_1001467 3300025245 Bacteria 9823
164 Ga0207425_1001639 3300025245 Bacteria 9024
165 Ga0209677_100009 3300025253 Bacteria 749530
166 Ga0209129_1000001 3300025258 Bacteria 1452436
167 Ga0209129_1005030 3300025258 Bacteria 4863
168 Ga0209565_1000902 3300025263 Bacteria 16045
169 Ga0209565_1001159 3300025263 Bacteria 12725
170 Ga0209565_1009721 3300025263 Bacteria 2421
171 Ga0209565_1014062 3300025263 Bacteria 1851
172 Ga0209455_1000037 3300025272 Bacteria 464097
173 Ga0209673_1004849 3300025273 Bacteria 7033
174 Ga0209675_1000769 3300025291 Bacteria 21492
175 Ga0209675_1005996 3300025291 Bacteria 4973
176 Ga0209675_1009461 3300025291 Bacteria 3443
177 Ga0209564_1001707 3300025295 Bacteria 20758
178 Ga0209564_1003112 3300025295 Bacteria 11717
179 Ga0209758_1000073 3300025297 Bacteria 276262
180 Ga0209758_1002044 3300025297 Bacteria 21637
181 Ga0209050_1000046 3300025298 Bacteria 386466
182 Ga0209256_1000044 3300025299 Bacteria 337264
183 Ga0209256_1002001 3300025299 Bacteria 18236
184 Ga0209256_1010975 3300025299 Bacteria 3700
185 Ga0207426_1002103 3300025302 Bacteria 13707
186 Ga0207426_1003407 3300025302 Bacteria 8683
187 Ga0209257_1000068 3300025304 Bacteria 341291
188 Ga0207656_10009161 3300025321 Bacteria 3670
189 Ga0207655_1001563 3300025728 Bacteria 20594
190 Ga0207713_1001245 3300025735 Bacteria 21110
191 Ga0207642_10013933 3300025899 Bacteria 2949
192 Ga0207688_10003187 3300025901 Bacteria 8951
193 Ga0207688_10081152 3300025901 Bacteria 1852
194 Ga0207647_10000033 3300025904 Bacteria 100573
195 Ga0207647_10016687 3300025904 Bacteria 5006
196 Ga0207647_10127528 3300025904 Bacteria 1497
197 Ga0207643_10007047 3300025908 Bacteria 6023
198 Ga0207684_10012883 3300025910 Bacteria 7241
199 Ga0207654_10008183 3300025911 Bacteria 5274
200 Ga0207695_10002681 3300025913 Bacteria 25984
201 Ga0207671_10041228 3300025914 Bacteria 3416
202 Ga0207693_10383838 3300025915 Bacteria 1099
203 Ga0207662_10107878 3300025918 Bacteria 1733
204 Ga0207657_10001739 3300025919 Bacteria 23466
205 Ga0207657_10060954 3300025919 Bacteria 3237
206 Ga0207657_10063062 3300025919 Bacteria 3171
207 Ga0207646_10000520 3300025922 Bacteria 51319
208 Ga0207646_10171736 3300025922 Bacteria 1958
209 Ga0207694_10001799 3300025924 Bacteria 17857
210 Ga0207694_10020030 3300025924 Bacteria 5059
211 Ga0207694_10093762 3300025924 Bacteria 2372
212 Ga0207694_10419684 3300025924 Bacteria 1114
213 Ga0207687_10051445 3300025927 Bacteria 2872
214 Ga0207687_10075707 3300025927 Bacteria 2416
215 Ga0207690_10032879 3300025932 Bacteria 3331
216 Ga0207706_10037034 3300025933 Bacteria 4332
217 Ga0207709_10054871 3300025935 Bacteria 2459
218 Ga0207709_10107392 3300025935 Bacteria 1859
219 Ga0207704_10031843 3300025938 Bacteria 2976
220 Ga0207665_10021790 3300025939 Bacteria 4215
221 Ga0207691_10015968 3300025940 Bacteria 7133
222 Ga0207711_10365708 3300025941 Bacteria 1337
223 Ga0207661_10027976 3300025944 Bacteria 4313
224 Ga0207661_10036828 3300025944 Bacteria 3822
225 Ga0207661_10199282 3300025944 Bacteria 1759
226 Ga0207661_10313984 3300025944 Bacteria 1408
227 Ga0207661_10381712 3300025944 Bacteria 1275
228 Ga0207667_10002487 3300025949 Bacteria 22974
229 Ga0207651_10068255 3300025960 Bacteria 2506
230 Ga0207712_10092846 3300025961 Bacteria 2226
231 Ga0207668_10008120 3300025972 Bacteria 6248
232 Ga0207668_10073671 3300025972 Bacteria 2448
233 Ga0207640_10000460 3300025981 Bacteria 24848
234 Ga0207658_10050613 3300025986 Bacteria 3058
235 Ga0207639_10072126 3300026041 Bacteria 2703
236 Ga0207678_10095644 3300026067 Bacteria 2538
237 Ga0207708_10000589 3300026075 Bacteria 28085
238 Ga0207702_10000793 3300026078 Bacteria 33517
239 Ga0207648_10013560 3300026089 Bacteria 7577
240 Ga0207648_10402734 3300026089 Bacteria 1240
241 Ga0207676_10249445 3300026095 Bacteria 1597
242 Ga0207674_10013896 3300026116 Bacteria 8909
243 Ga0207674_10378173 3300026116 Bacteria 1369
244 Ga0207675_100017896 3300026118 Bacteria 6608
245 Ga0207675_100591083 3300026118 Bacteria 1112
246 Ga0207698_10013410 3300026142 Bacteria 5407
247 Ga0207698_10101581 3300026142 Bacteria 2385
248 Ga0207698_10906986 3300026142 Bacteria 889
249 Ga0209282_1000001 3300027666 Bacteria 2450367
250 Ga0207428_10159418 3300027907 Bacteria 1714
251 Ga0207428_10206860 3300027907 Bacteria 1476
252 Ga0268264_10278872 3300028381 Bacteria 1565
253 Ga0265327_10004040 3300031251 Bacteria 13324
254 Ga0307513_10027389 3300031456 Bacteria 6544
255 Ga0307408_100000387 3300031548 Bacteria 40174
256 Ga0307408_100001210 3300031548 Bacteria 19453
257 Ga0307408_100021297 3300031548 Bacteria 4386
258 Ga0307408_100628375 3300031548 Bacteria 957
259 Ga0307405_10011285 3300031731 Bacteria 4673
260 Ga0307405_10153812 3300031731 Bacteria 1621
261 Ga0307405_10463048 3300031731 Bacteria 1008
262 Ga0307413_10253647 3300031824 Bacteria 1307
263 Ga0307413_10532512 3300031824 Bacteria 949
264 Ga0307410_10019242 3300031852 Bacteria 4148
265 Ga0307410_10049971 3300031852 Bacteria 2809
266 Ga0307406_10081331 3300031901 Bacteria 2154
267 Ga0307406_10445333 3300031901 Bacteria 1038
268 Ga0307407_10060291 3300031903 Bacteria 2214
269 Ga0307407_10088370 3300031903 Bacteria 1893
270 Ga0307409_100003060 3300031995 Bacteria 8946
271 Ga0307409_100016843 3300031995 Bacteria 4851
272 Ga0307409_100075207 3300031995 Bacteria 2703
273 Ga0307409_100468805 3300031995 Bacteria 1219
274 Ga0307416_100014685 3300032002 Bacteria 5380
275 Ga0307416_100020341 3300032002 Bacteria 4733
276 Ga0307416_100404222 3300032002 Bacteria 1404
277 Ga0307416_100683726 3300032002 Bacteria 1114
278 Ga0307411_10608273 3300032005 Bacteria 941
279 Ga0307415_100009535 3300032126 Bacteria 5449
280 Ga0307415_100062968 3300032126 Bacteria 2575
281 Ga0316583_10015566 3300032133 Bacteria 2736
282 Ga0373950_0005439 3300034818 Bacteria 1904
283 Ga0373934_0223708 3300035086 Bacteria 776
284 Ga0373940_0009630 3300035088 Bacteria 2250
285 Ga0373953_0011082 3300035117 Bacteria 3153
286 Ga0373954_0062890 3300035118 Bacteria 1754
287 Ga0373956_0006754 3300035119 Bacteria 4602
288 Ga0373943_0147097 3300035170 Bacteria 1274
289 Ga0373946_0010767 3300035171 Bacteria 3396
290 Ga0373955_0024911 3300035172 Bacteria 3065
291 Ga0373955_0210507 3300035172 Bacteria 1159
292 Ga0373955_0300068 3300035172 Bacteria 968
293 Ga0373942_0000328 3300035207 Bacteria 12928
294 Ga0373924_0125566 3300035410 Bacteria 1115
295 Ga0373935_0002124 3300035692 Bacteria 11241
296 Ga0373935_0022512 3300035692 Bacteria 3865
297 Ga0373933_0008466 3300035724 Bacteria 5611
298 Ga0373933_0175706 3300035724 Bacteria 1364
299 Ga0373947_0000003 3300035725 Bacteria 345338
300 Ga0373937_0138239 3300036401 Bacteria 2278
301 Ga0373937_0237763 3300036401 Bacteria 1716
302 Ga0373937_0542575 3300036401 Bacteria 1104
303 Ga0373925_0304351 3300037068 Bacteria 1288
304 Ga0373925_0387683 3300037068 Bacteria 1138
305 Ga0395900_0286281 3300037418 Bacteria 1638
306 Ga0395900_0680420 3300037418 Bacteria 963
307 Ga0395898_0196859 3300037466 Bacteria 1925
308 Ga0395905_0618281 3300037471 Bacteria 985
309 Ga0436364_1208927 3300037853 Bacteria 3598
310 Ga0395901_0049393 3300038443 Bacteria 4371
311 Ga0395901_0248924 3300038443 Bacteria 1852
312 Ga0395901_0850247 3300038443 Bacteria 898
313 Ga0400485_14387 3300038735 Bacteria 23975
314 Ga0400488_33105 3300038741 Bacteria 11860
315 Ga0400486_21500 3300038742 Bacteria 94371
316 Ga0436361_0080172 3300039447 Bacteria 39325
317 Ga0436361_0181426 3300039447 Bacteria 1331
318 Ga0436361_0715182 3300039447 Bacteria 1054
319 Ga0451795_0766239 3300041456 Bacteria 3862
320 Ga0451849_0593111 3300041505 Bacteria 1036
321 Ga0439445_0025124 3300042004 Bacteria 1518
322 Ga0439432_069941 3300042006 Bacteria 1071
323 Ga0439449_0005087 3300042007 Bacteria 5057
324 Ga0439455_0019950 3300042012 Bacteria 1585
325 Ga0450893_0028985 3300042532 Bacteria 981
326 Ga0451577_0010831 3300042876 Bacteria 8668
327 Ga0466969_0009652 3300044656 Bacteria 5115
328 Ga0466969_0010424 3300044656 Bacteria 4926
329 Ga0466969_0070638 3300044656 Bacteria 1679
330 Ga0466969_0086919 3300044656 Bacteria 1485
331 Ga0466972_0047727 3300044658 Bacteria 2070
332 Ga0466965_0048033 3300044683 Bacteria 2114
333 Ga0466966_0001445 3300044684 Bacteria 15254
334 Ga0466966_0096362 3300044684 Bacteria 1832
335 Ga0466961_0064476 3300044693 Bacteria 2328
336 Ga0466961_0122029 3300044693 Bacteria 1635
337 Ga0466963_0388672 3300044694 Bacteria 983
338 Ga0453684_0032889 3300044712 Bacteria 7242
339 Ga0466971_0023125 3300044719 Bacteria 2770
340 Ga0466970_0006879 3300044765 Bacteria 5694
341 Ga0466970_0026432 3300044765 Bacteria 3041
342 Ga0466970_0031436 3300044765 Bacteria 2803
343 Ga0466957_0090956 3300044842 Bacteria 1912
344 Ga0466957_0113013 3300044842 Bacteria 1724
345 Ga0466957_0450243 3300044842 Bacteria 887
346 Ga0466960_0035516 3300044901 Bacteria 2330
347 Ga0466960_0260535 3300044901 Bacteria 966
348 Ga0466959_0062467 3300045049 Bacteria 2706
349 Ga0466959_0069963 3300045049 Bacteria 2542
350 Ga0466958_0011513 3300045836 Bacteria 4982
351 Ga0466958_0077113 3300045836 Bacteria 2046
352 Ga0466958_0087969 3300045836 Bacteria 1919
353 Ga0466967_0135634 3300045976 Bacteria 2289
354 Ga0466967_0144720 3300045976 Bacteria 2216
355 Ga0466967_0313568 3300045976 Bacteria 1511
356 Ga0466967_0488696 3300045976 Bacteria 1207
357 Ga0495627_000007 3300046453 Bacteria 575915
358 Ga0495592_0024366 3300046454 Bacteria 4601
359 Ga0495590_0008695 3300046457 Bacteria 3866
360 Ga0495629_0000012 3300046459 Bacteria 230331
361 Ga0495629_0067480 3300046459 Bacteria 2496
362 Ga0495638_0061151 3300046460 Bacteria 2328
363 Ga0495641_0111554 3300046461 Bacteria 1220
364 Ga0495651_0003407 3300046462 Bacteria 12194
365 Ga0495653_0058177 3300046463 Bacteria 2939
366 Ga0495582_0021655 3300046473 Bacteria 3517
367 Ga0495639_0026775 3300046475 Bacteria 2550
368 Ga0495662_0001123 3300046476 Bacteria 13186
369 Ga0495594_0004998 3300046499 Bacteria 6823
370 Ga0495607_0004150 3300046501 Bacteria 10781
371 Ga0495583_0004868 3300046506 Bacteria 9379
372 Ga0495606_0004181 3300046507 Bacteria 14633
373 Ga0495608_0002781 3300046511 Bacteria 12555
374 Ga0495608_0020655 3300046511 Bacteria 4524
375 Ga0495616_0058898 3300046513 Bacteria 1890
376 Ga0495628_0090078 3300046516 Bacteria 2374
377 Ga0495630_0158389 3300046517 Bacteria 1723
378 Ga0495644_0027912 3300046523 Bacteria 2137
379 Ga0495663_0031250 3300046525 Bacteria 1581
380 Ga0495652_0050203 3300046529 Bacteria 3567
381 Ga0495640_0020229 3300046533 Bacteria 4901
382 Ga0495640_0197073 3300046533 Bacteria 1278
383 Ga0495586_0241308 3300046535 Bacteria 1030
384 Ga0495587_0213049 3300046536 Bacteria 1090
385 Ga0495609_0002949 3300046538 Bacteria 10058
386 Ga0495609_0003102 3300046538 Bacteria 9742
387 Ga0495645_0044434 3300046543 Bacteria 3240
388 Ga0495667_0010954 3300046559 Bacteria 6127
389 Ga0495668_0000173 3300046616 Bacteria 95830
390 Ga0495668_0026989 3300046616 Bacteria 3254
391 Ga0495634_0016004 3300046642 Bacteria 5372
392 Ga0495634_0035279 3300046642 Bacteria 3427
393 Ga0495625_0001016 3300046660 Bacteria 37004
394 Ga0495625_0001679 3300046660 Bacteria 25832
395 Ga0495635_0001451 3300046663 Bacteria 15860
396 Ga0495635_0007651 3300046663 Bacteria 7537
397 Ga0495659_0004469 3300046664 Bacteria 4405
398 Ga0495661_0017969 3300046665 Bacteria 4660
399 Ga0495588_0064304 3300046674 Bacteria 1903
400 Ga0495657_0010506 3300046675 Bacteria 6965
401 Ga0495599_0115489 3300046678 Bacteria 1670
402 Ga0495623_0013784 3300046679 Bacteria 5240
403 Ga0495623_0033174 3300046679 Bacteria 3313
404 Ga0495646_0055862 3300046680 Bacteria 2368
405 Ga0495658_0000057 3300046683 Bacteria 56081
406 Ga0495669_0006988 3300046684 Bacteria 4726
407 Ga0495613_0002697 3300046689 Bacteria 13325
408 Ga0495613_0042904 3300046689 Bacteria 3345
409 Ga0495670_0180051 3300046691 Bacteria 1116
410 Ga0495600_0025215 3300046809 Bacteria 3831
411 Ga0495600_0352495 3300046809 Bacteria 922
412 Ga0495660_0003426 3300046810 Bacteria 9818
413 Ga0495660_0014659 3300046810 Bacteria 4533
414 Ga0495581_0000007 3300047315 Bacteria 67949
415 Ga0495604_0000834 3300047317 Bacteria 25747
416 Ga0495604_0014104 3300047317 Bacteria 6371
417 Ga0495636_0036491 3300047318 Bacteria 2027
418 Ga0495674_0029245 3300047319 Bacteria 5020
419 Ga0495674_0035379 3300047319 Bacteria 4507
420 Ga0495676_0159505 3300047321 Bacteria 1597
421 Ga0495676_0167164 3300047321 Bacteria 1551
422 Ga0495680_0012974 3300047322 Bacteria 7295
423 Ga0495680_0025226 3300047322 Bacteria 4923
424 Ga0495675_0016249 3300047444 Bacteria 4707
425 Ga0495675_0019337 3300047444 Bacteria 4325
426 Ga0495675_0060814 3300047444 Bacteria 2393
427 Ga0495685_070498 3300047447 Bacteria 1171
428 Ga0495685_120163 3300047447 Bacteria 863
429 Ga0495681_0004664 3300047470 Bacteria 9291
430 Ga0495681_0022872 3300047470 Bacteria 3334
431 Ga0495684_0022700 3300047471 Bacteria 4826
432 Ga0495684_0064187 3300047471 Bacteria 2790
433 Ga0495686_0425048 3300047472 Bacteria 709
434 Ga0495602_0036059 3300048088 Bacteria 4606
435 Ga0495614_0048470 3300048089 Bacteria 1821
436 Ga0495626_0000267 3300048091 Bacteria 58992
437 Ga0496101_0131350 3300048904 Bacteria 1902
438 Ga0496101_0213712 3300048904 Bacteria 1495
439 Ga0496102_0011650 3300048905 Bacteria 7588
440 Ga0496103_0006680 3300048906 Bacteria 6884
441 Ga0496104_0054457 3300048907 Bacteria 3781
442 Ga0496104_0140678 3300048907 Bacteria 2318
443 Ga0496104_0457814 3300048907 Bacteria 1187
444 Ga0496105_0025490 3300048908 Bacteria 4814
445 Ga0496105_0119845 3300048908 Bacteria 2170
446 Ga0496107_0187159 3300048910 Bacteria 1538
447 Ga0496107_0385983 3300048910 Bacteria 1042
448 Ga0496108_0350621 3300048911 Bacteria 1288
449 Ga0496108_0628073 3300048911 Bacteria 935
450 Ga0496109_0224892 3300048912 Bacteria 1765
451 Ga0496110_0067955 3300048913 Bacteria 3154
452 Ga0496110_0172103 3300048913 Bacteria 1965
453 Ga0496110_0319209 3300048913 Bacteria 1415
454 Ga0496111_0006048 3300048914 Bacteria 7820
455 Ga0496112_0007764 3300048915 Bacteria 9544
456 Ga0496112_0667391 3300048915 Bacteria 969
457 Ga0496114_0053585 3300048917 Bacteria 3362
458 Ga0496114_0100343 3300048917 Bacteria 2470
459 Ga0496114_0108317 3300048917 Bacteria 2378
460 Ga0496114_0124774 3300048917 Bacteria 2218
461 Ga0496114_0207152 3300048917 Bacteria 1719
462 Ga0496114_0682967 3300048917 Bacteria 901
463 Ga0496115_0386796 3300048918 Bacteria 1137
464 Ga0496117_0024021 3300048920 Bacteria 4837
465 Ga0496118_0014701 3300048921 Bacteria 7313
466 Ga0496120_0002693 3300048923 Bacteria 17433
467 Ga0501306_001055 3300049127 Bacteria 2451
468 Ga0501310_000580 3300049130 Bacteria 3210
469 Ga0495678_000004 3300049459 Bacteria 532920
470 Ga0495678_140658 3300049459 Bacteria 790
471 Ga0495682_0078456 3300049460 Bacteria 1188
472 Ga0501311_001778 3300049527 Bacteria 1956
473 Ga0501315_000655 3300049531 Bacteria 2533
474 Ga0501315_006228 3300049531 Bacteria 1322
475 Ga0501031_0043843 3300049568 Bacteria 2918
476 Ga0501032_0228082 3300049569 Bacteria 1211
477 Ga0501033_0124002 3300049570 Bacteria 1873
478 Ga0501036_0086867 3300049572 Bacteria 2643
479 Ga0501038_0081904 3300049574 Bacteria 2718
480 Ga0501039_0018878 3300049575 Bacteria 5294
481 Ga0501040_0017199 3300049576 Bacteria 4799
482 Ga0501042_0257449 3300049578 Bacteria 1259
483 Ga0501047_0515297 3300049581 Bacteria 1022
484 Ga0501048_0147412 3300049582 Bacteria 1664
485 Ga0501067_0081461 3300049583 Bacteria 1794
486 Ga0501068_0072495 3300049584 Bacteria 2103
487 Ga0501069_0317516 3300049585 Bacteria 915
488 Ga0501070_0029135 3300049586 Bacteria 4630
489 Ga0501071_0006292 3300049587 Bacteria 7704
490 Ga0501072_0039929 3300049588 Bacteria 3684
491 Ga0501075_0031277 3300049591 Bacteria 3949
492 Ga0501076_0055369 3300049592 Bacteria 3145
493 Ga0501077_0047277 3300049593 Bacteria 2734
494 Ga0501216_037931 3300049660 Bacteria 912
495 Ga0501227_002589 3300049665 Bacteria 3970
496 Ga0501238_001798 3300049671 Bacteria 2498
497 Ga0501079_0125998 3300049741 Bacteria 1992
498 Ga0501080_0203794 3300049742 Bacteria 1815
499 Ga0501081_0347039 3300049743 Bacteria 1093
500 Ga0501083_0051045 3300049744 Bacteria 2782
501 Ga0501279_001917 3300049775 Bacteria 2740
502 Ga0501279_017062 3300049775 Bacteria 1015
503 Ga0501035_0024558 3300049822 Bacteria 5527
504 Ga0501044_0345679 3300049823 Bacteria 1408
505 Ga0501045_0035555 3300049824 Bacteria 3617
506 nmdc:mga00v17_7749_c1 3300050491 Bacteria 5753
507 nmdc:mga0yw44_2105_c1 3300050492 Bacteria 8331
508 nmdc:mga0yw44_230237_c1 3300050492 Bacteria 1230
509 nmdc:mga0yw44_42147_c1 3300050492 Bacteria 2721
510 nmdc:mga0yw44_7060_c1 3300050492 Bacteria 5497
511 nmdc:mga06z11_106199_c1 3300050494 Bacteria 1548
512 nmdc:mga07m45_2591_c1 3300050496 Bacteria 7827
513 nmdc:mga09592_270402_c1 3300050508 Bacteria 1474
514 nmdc:mga0qj67_306087_c1 3300050509 Bacteria 1287
515 nmdc:mga06r32_67353_c1 3300050510 Bacteria 3456
516 nmdc:mga08y16_200494_c1 3300050511 Bacteria 2068
517 nmdc:mga08y16_715192_c1 3300050511 Bacteria 1000
518 nmdc:mga0sz30_110914_c1 3300050516 Bacteria 1202
519 Ga0495601_0034528 3300053077 Bacteria 3156
520 Ga0495619_0024511 3300053085 Bacteria 3870
521 Ga0500644_0000050 3300053088 Bacteria 71907
522 Ga0500650_0032643 3300053098 Bacteria 2372
523 Ga0500573_0027068 3300053140 Bacteria 3296
524 Ga0500577_0009374 3300053142 Bacteria 2838
525 Ga0500577_0035092 3300053142 Bacteria 1786
526 Ga0500577_0092583 3300053142 Bacteria 1224
527 Ga0501084_0215614 3300054114 Bacteria 1619
528 Ga0590075_001853 3300059424 Bacteria 5139
529 Ga0590077_006260 3300059426 Bacteria 2440
530 Ga0501082_0093468 3300060353 Bacteria 2598
531 Ga0530510_0016407 3300061734 Bacteria 5242
532 Ga0530510_0239506 3300061734 Bacteria 1350

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003784 Ga0055534_1011123 Ga0055534_10111232 195
2 3300021361 Ga0213872_10111713 Ga0213872_101117132 197
3 3300039447 Ga0436361_0181426 Ga0436361_0181426_226_972 197
4 3300039447 Ga0436361_0715182 Ga0436361_0715182_93_839 197
5 3300046457 Ga0495590_0008695 Ga0495590_0008695_2370_3116 197
6 3300046506 Ga0495583_0004868 Ga0495583_0004868_2870_3616 197
7 3300046660 Ga0495625_0001679 Ga0495625_0001679_9186_9932 197
8 3300046664 Ga0495659_0004469 Ga0495659_0004469_948_1694 197
9 3300046665 Ga0495661_0017969 Ga0495661_0017969_1118_1864 197
10 3300046684 Ga0495669_0006988 Ga0495669_0006988_2320_3066 197
11 3300047318 Ga0495636_0036491 Ga0495636_0036491_462_1208 197
12 3300046453 Ga0495627_000007 Ga0495627_000007_417022_417780 198
13 3300047470 Ga0495681_0022872 Ga0495681_0022872_2346_3092 198
14 3300046538 Ga0495609_0002949 Ga0495609_0002949_3607_4371 199
15 3300046460 Ga0495638_0061151 Ga0495638_0061151_59_805 200
16 3300046501 Ga0495607_0004150 Ga0495607_0004150_5946_6692 200
17 3300046513 Ga0495616_0058898 Ga0495616_0058898_13_759 200
18 3300046525 Ga0495663_0031250 Ga0495663_0031250_525_1271 200
19 3300046538 Ga0495609_0003102 Ga0495609_0003102_5361_6107 200
20 3300046616 Ga0495668_0026989 Ga0495668_0026989_511_1257 200
21 3300046691 Ga0495670_0180051 Ga0495670_0180051_132_878 200
22 3300049459 Ga0495678_140658 Ga0495678_140658_13_759 200
23 3300049460 Ga0495682_0078456 Ga0495682_0078456_147_893 200
24 3300003374 JGI25161J50226_1009399 JGI25161J50226_10093992 202
25 3300046810 Ga0495660_0003426 Ga0495660_0003426_5777_6541 204
26 3300046810 Ga0495660_0014659 Ga0495660_0014659_3317_4081 204
27 3300037471 Ga0395905_0618281 Ga0395905_0618281_22_741 205
28 3300031548 Ga0307408_100001210 Ga0307408_1000012105 206
29 3300049130 Ga0501310_000580 Ga0501310_000580_1919_2665 206
30 3300002739 JGI25158J39367_1001766 JGI25158J39367_10017662 208
31 3300002774 JGI25150J39212_1005125 JGI25150J39212_10051253 208
32 3300003771 Ga0055526_1005592 Ga0055526_10055926 208
33 3300003773 Ga0055537_1006604 Ga0055537_10066042 208
34 3300003775 Ga0055524_1006560 Ga0055524_10065603 208
35 3300003775 Ga0055524_1008881 Ga0055524_10088814 208
36 3300003775 Ga0055524_1016262 Ga0055524_10162621 208
37 3300003784 Ga0055534_1011642 Ga0055534_10116423 208
38 3300003790 Ga0055528_1002474 Ga0055528_10024749 208
39 3300003794 Ga0055531_10033093 Ga0055531_100330932 208
40 3300025208 Ga0209436_100291 Ga0209436_10029132 208
41 3300025245 Ga0207425_1001639 Ga0207425_100163910 208
42 3300025258 Ga0209129_1005030 Ga0209129_10050303 208
43 3300025263 Ga0209565_1000902 Ga0209565_100090217 208
44 3300025263 Ga0209565_1001159 Ga0209565_10011592 208
45 3300025263 Ga0209565_1009721 Ga0209565_10097213 208
46 3300025273 Ga0209673_1004849 Ga0209673_10048493 208
47 3300025291 Ga0209675_1000769 Ga0209675_10007695 208
48 3300025291 Ga0209675_1005996 Ga0209675_10059967 208
49 3300025291 Ga0209675_1009461 Ga0209675_10094614 208
50 3300025295 Ga0209564_1001707 Ga0209564_100170715 208
51 3300025295 Ga0209564_1003112 Ga0209564_100311210 208
52 3300025297 Ga0209758_1002044 Ga0209758_100204425 208
53 3300025298 Ga0209050_1000046 Ga0209050_1000046106 208
54 3300025299 Ga0209256_1002001 Ga0209256_10020013 208
55 3300025299 Ga0209256_1010975 Ga0209256_10109754 208
56 3300025302 Ga0207426_1002103 Ga0207426_10021032 208
57 3300025304 Ga0209257_1000068 Ga0209257_1000068224 208
58 3300031548 Ga0307408_100021297 Ga0307408_1000212974 208
59 3300042532 Ga0450893_0028985 Ga0450893_0028985_164_910 208
60 3300049531 Ga0501315_000655 Ga0501315_000655_144_890 208
61 3300049775 Ga0501279_017062 Ga0501279_017062_186_938 208
62 3300031548 Ga0307408_100628375 Ga0307408_1006283751 209
63 3300032002 Ga0307416_100020341 Ga0307416_1000203414 209
64 3300002773 JGI25152J39213_1003851 JGI25152J39213_10038513 210
65 3300002774 JGI25150J39212_1011438 JGI25150J39212_10114382 210
66 3300003215 JGI25153J46596_10008450 JGI25153J46596_100084503 210
67 3300025245 Ga0207425_1000001 Ga0207425_10000011288 210
68 3300025245 Ga0207425_1001467 Ga0207425_100146710 210
69 3300025258 Ga0209129_1000001 Ga0209129_1000001465 210
70 3300025297 Ga0209758_1000073 Ga0209758_100007314 210
71 3300046523 Ga0495644_0027912 Ga0495644_0027912_863_1627 210
72 3300047470 Ga0495681_0004664 Ga0495681_0004664_4861_5625 210
73 3300049127 Ga0501306_001055 Ga0501306_001055_539_1285 210
74 3300049459 Ga0495678_000004 Ga0495678_000004_367348_368112 210
75 3300049527 Ga0501311_001778 Ga0501311_001778_1114_1860 210
76 3300049531 Ga0501315_006228 Ga0501315_006228_348_1094 210
77 3300049665 Ga0501227_002589 Ga0501227_002589_1525_2271 210
78 3300049775 Ga0501279_001917 Ga0501279_001917_1095_1841 210
79 3300003791 Ga0055530_10008671 Ga0055530_100086715 211
80 3300035086 Ga0373934_0223708 Ga0373934_0223708_72_743 211
81 3300035410 Ga0373924_0125566 Ga0373924_0125566_345_1037 211
82 3300035725 Ga0373947_0000003 Ga0373947_0000003_274961_275782 211
83 3300035171 Ga0373946_0010767 Ga0373946_0010767_933_1754 212
84 3300035692 Ga0373935_0002124 Ga0373935_0002124_903_1724 212
85 3300047472 Ga0495686_0425048 Ga0495686_0425048_46_699 212
86 3300003322 rootL2_10103237 rootL2_101032371 214
87 3300006881 Ga0068865_100171162 Ga0068865_1001711623 214
88 3300027907 Ga0207428_10159418 Ga0207428_101594181 214
89 3300042876 Ga0451577_0010831 Ga0451577_0010831_6517_7263 215
90 3300044712 Ga0453684_0032889 Ga0453684_0032889_5674_6420 215
91 3300003775 Ga0055524_1000234 Ga0055524_100023424 218
92 3300025263 Ga0209565_1014062 Ga0209565_10140623 218
93 3300025299 Ga0209256_1000044 Ga0209256_100004423 218
94 3300006038 Ga0075365_10012036 Ga0075365_100120363 220
95 3300037418 Ga0395900_0286281 Ga0395900_0286281_645_1400 220
96 3300050492 nmdc:mga0yw44_7060_c1 nmdc:mga0yw44_7060_c1_4517_5272 220
97 3300042012 Ga0439455_0019950 Ga0439455_0019950_524_1270 221
98 3300020082 Ga0206353_11427395 Ga0206353_114273952 222
99 3300027907 Ga0207428_10206860 Ga0207428_102068602 222
100 3300050511 nmdc:mga08y16_200494_c1 nmdc:mga08y16_200494_c1_1288_2034 222
101 3300001991 JGI24743J22301_10011629 JGI24743J22301_100116292 223
102 3300002070 JGI24750J21931_1023946 JGI24750J21931_10239461 223
103 3300003763 Ga0055529_1000403 Ga0055529_100040351 223
104 3300005329 Ga0070683_100014373 Ga0070683_1000143736 223
105 3300005338 Ga0068868_100223154 Ga0068868_1002231542 223
106 3300005343 Ga0070687_100109015 Ga0070687_1001090151 223
107 3300005344 Ga0070661_100198773 Ga0070661_1001987731 223
108 3300005347 Ga0070668_100503163 Ga0070668_1005031631 223
109 3300005353 Ga0070669_100208607 Ga0070669_1002086072 223
110 3300005356 Ga0070674_100194342 Ga0070674_1001943421 223
111 3300005366 Ga0070659_100130848 Ga0070659_1001308482 223
112 3300005459 Ga0068867_100240219 Ga0068867_1002402192 223
113 3300005466 Ga0070685_10039955 Ga0070685_100399553 223
114 3300005543 Ga0070672_100028650 Ga0070672_1000286503 223
115 3300005615 Ga0070702_100009006 Ga0070702_1000090062 223
116 3300005616 Ga0068852_100066930 Ga0068852_1000669303 223
117 3300005718 Ga0068866_10004804 Ga0068866_100048045 223
118 3300005719 Ga0068861_100067139 Ga0068861_1000671392 223
119 3300005840 Ga0068870_10004500 Ga0068870_100045006 223
120 3300006237 Ga0097621_100256897 Ga0097621_1002568972 223
121 3300006881 Ga0068865_100025194 Ga0068865_1000251943 223
122 3300009094 Ga0111539_10231013 Ga0111539_102310132 223
123 3300009148 Ga0105243_10084645 Ga0105243_100846451 223
124 3300009553 Ga0105249_10061179 Ga0105249_100611794 223
125 3300010375 Ga0105239_10151901 Ga0105239_101519011 223
126 3300013307 Ga0157372_10259217 Ga0157372_102592172 223
127 3300013308 Ga0157375_10273672 Ga0157375_102736722 223
128 3300014326 Ga0157380_10019890 Ga0157380_100198902 223
129 3300025272 Ga0209455_1000037 Ga0209455_1000037343 223
130 3300025901 Ga0207688_10003187 Ga0207688_100031876 223
131 3300025908 Ga0207643_10007047 Ga0207643_100070476 223
132 3300025918 Ga0207662_10107878 Ga0207662_101078782 223
133 3300025919 Ga0207657_10063062 Ga0207657_100630623 223
134 3300025927 Ga0207687_10075707 Ga0207687_100757072 223
135 3300025932 Ga0207690_10032879 Ga0207690_100328792 223
136 3300025935 Ga0207709_10107392 Ga0207709_101073922 223
137 3300025938 Ga0207704_10031843 Ga0207704_100318434 223
138 3300025944 Ga0207661_10199282 Ga0207661_101992822 223
139 3300025960 Ga0207651_10068255 Ga0207651_100682552 223
140 3300025961 Ga0207712_10092846 Ga0207712_100928461 223
141 3300026075 Ga0207708_10000589 Ga0207708_1000058919 223
142 3300026089 Ga0207648_10013560 Ga0207648_100135607 223
143 3300026118 Ga0207675_100017896 Ga0207675_1000178963 223
144 3300048912 Ga0496109_0224892 Ga0496109_0224892_148_903 223
145 3300048913 Ga0496110_0067955 Ga0496110_0067955_972_1727 223
146 3300048917 Ga0496114_0108317 Ga0496114_0108317_989_1744 223
147 3300061734 Ga0530510_0239506 Ga0530510_0239506_557_1312 223
148 3300005467 Ga0070706_100016881 Ga0070706_1000168812 224
149 3300005468 Ga0070707_100003448 Ga0070707_1000034486 224
150 3300005471 Ga0070698_100077837 Ga0070698_1000778373 224
151 3300005518 Ga0070699_100000298 Ga0070699_10000029841 224
152 3300006844 Ga0075428_100101410 Ga0075428_1001014103 224
153 3300021361 Ga0213872_10000263 Ga0213872_1000026339 224
154 3300025922 Ga0207646_10000520 Ga0207646_100005206 224
155 3300027666 Ga0209282_1000001 Ga0209282_1000001297 224
156 3300039447 Ga0436361_0080172 Ga0436361_0080172_38364_39110 224
157 3300046507 Ga0495606_0004181 Ga0495606_0004181_7483_8244 224
158 3300046616 Ga0495668_0000173 Ga0495668_0000173_50206_50967 224
159 3300046660 Ga0495625_0001016 Ga0495625_0001016_15585_16346 224
160 3300048091 Ga0495626_0000267 Ga0495626_0000267_53470_54231 224
161 3300049671 Ga0501238_001798 Ga0501238_001798_1064_1810 224
162 3300050508 nmdc:mga09592_270402_c1 nmdc:mga09592_270402_c1_88_852 224
163 3300050509 nmdc:mga0qj67_306087_c1 nmdc:mga0qj67_306087_c1_510_1274 224
164 3300026089 Ga0207648_10402734 Ga0207648_104027341 225
165 3300048917 Ga0496114_0100343 Ga0496114_0100343_649_1407 227
166 3300025944 Ga0207661_10036828 Ga0207661_100368285 228
167 3300046454 Ga0495592_0024366 Ga0495592_0024366_2569_3327 228
168 3300046476 Ga0495662_0001123 Ga0495662_0001123_5095_5853 228
169 3300046516 Ga0495628_0090078 Ga0495628_0090078_1114_1872 228
170 3300046517 Ga0495630_0158389 Ga0495630_0158389_864_1622 228
171 3300046529 Ga0495652_0050203 Ga0495652_0050203_369_1127 228
172 3300046533 Ga0495640_0020229 Ga0495640_0020229_3641_4399 228
173 3300046536 Ga0495587_0213049 Ga0495587_0213049_231_989 228
174 3300046642 Ga0495634_0016004 Ga0495634_0016004_1111_1869 228
175 3300046679 Ga0495623_0033174 Ga0495623_0033174_497_1255 228
176 3300046680 Ga0495646_0055862 Ga0495646_0055862_1242_2000 228
177 3300046689 Ga0495613_0042904 Ga0495613_0042904_1778_2536 228
178 3300047317 Ga0495604_0000834 Ga0495604_0000834_9343_10101 228
179 3300047471 Ga0495684_0064187 Ga0495684_0064187_2013_2771 228
180 3300049586 Ga0501070_0029135 Ga0501070_0029135_1316_2071 228
181 3300053077 Ga0495601_0034528 Ga0495601_0034528_1997_2755 228
182 3300053140 Ga0500573_0027068 Ga0500573_0027068_2430_3188 228
183 3300044656 Ga0466969_0086919 Ga0466969_0086919_520_1275 229
184 3300044684 Ga0466966_0096362 Ga0466966_0096362_318_1073 229
185 3300044694 Ga0466963_0388672 Ga0466963_0388672_162_917 229
186 3300044719 Ga0466971_0023125 Ga0466971_0023125_581_1336 229
187 3300045049 Ga0466959_0069963 Ga0466959_0069963_1324_2079 229
188 3300045836 Ga0466958_0087969 Ga0466958_0087969_194_949 229
189 3300053098 Ga0500650_0032643 Ga0500650_0032643_755_1522 229
190 3300053142 Ga0500577_0035092 Ga0500577_0035092_189_956 229
191 3300046809 Ga0495600_0352495 Ga0495600_0352495_52_807 230
192 3300005347 Ga0070668_100130364 Ga0070668_1001303642 231
193 3300005615 Ga0070702_100008749 Ga0070702_1000087492 231
194 3300006881 Ga0068865_100439834 Ga0068865_1004398341 231
195 3300009148 Ga0105243_10033259 Ga0105243_100332591 231
196 3300009551 Ga0105238_10606292 Ga0105238_106062921 231
197 3300009553 Ga0105249_10117819 Ga0105249_101178192 231
198 3300013297 Ga0157378_10023032 Ga0157378_100230321 231
199 3300013308 Ga0157375_10041467 Ga0157375_100414672 231
200 3300014326 Ga0157380_10323137 Ga0157380_103231372 231
201 3300017792 Ga0163161_10100949 Ga0163161_101009491 231
202 3300025899 Ga0207642_10013933 Ga0207642_100139332 231
203 3300025924 Ga0207694_10419684 Ga0207694_104196842 231
204 3300025935 Ga0207709_10054871 Ga0207709_100548711 231
205 3300025972 Ga0207668_10073671 Ga0207668_100736712 231
206 3300026118 Ga0207675_100591083 Ga0207675_1005910831 231
207 3300026142 Ga0207698_10906986 Ga0207698_109069861 231
208 3300048915 Ga0496112_0667391 Ga0496112_0667391_240_938 231
209 3300005616 Ga0068852_100785124 Ga0068852_1007851241 233
210 3300048910 Ga0496107_0385983 Ga0496107_0385983_131_883 233
211 3300005337 Ga0070682_100018971 Ga0070682_1000189714 234
212 3300005365 Ga0070688_100271507 Ga0070688_1002715071 234
213 3300005438 Ga0070701_10047723 Ga0070701_100477233 234
214 3300005441 Ga0070700_100022720 Ga0070700_1000227203 234
215 3300005618 Ga0068864_100096470 Ga0068864_1000964702 234
216 3300025924 Ga0207694_10093762 Ga0207694_100937623 234
217 3300026095 Ga0207676_10249445 Ga0207676_102494452 234
218 3300026142 Ga0207698_10101581 Ga0207698_101015813 234
219 3300048904 Ga0496101_0213712 Ga0496101_0213712_453_1208 234
220 3300048917 Ga0496114_0207152 Ga0496114_0207152_944_1699 234
221 3300006177 Ga0075362_10128102 Ga0075362_101281021 235
222 3300045976 Ga0466967_0488696 Ga0466967_0488696_24_779 235
223 3300048917 Ga0496114_0124774 Ga0496114_0124774_52_810 235
224 3300049585 Ga0501069_0317516 Ga0501069_0317516_67_822 235
225 3300053088 Ga0500644_0000050 Ga0500644_0000050_60417_61151 235
226 3300009098 Ga0105245_10036539 Ga0105245_100365393 236
227 3300020082 Ga0206353_11163641 Ga0206353_111636412 236
228 3300047319 Ga0495674_0035379 Ga0495674_0035379_1449_2222 236
229 3300050511 nmdc:mga08y16_715192_c1 nmdc:mga08y16_715192_c1_12_767 236
230 3300053085 Ga0495619_0024511 Ga0495619_0024511_49_822 236
231 3300048905 Ga0496102_0011650 Ga0496102_0011650_2935_3669 237
232 3300048906 Ga0496103_0006680 Ga0496103_0006680_4446_5180 237
233 3300048907 Ga0496104_0054457 Ga0496104_0054457_510_1268 237
234 3300048915 Ga0496112_0007764 Ga0496112_0007764_8743_9501 237
235 3300005535 Ga0070684_100020890 Ga0070684_1000208905 238
236 3300005539 Ga0068853_100043128 Ga0068853_1000431284 238
237 3300009551 Ga0105238_10037915 Ga0105238_100379154 238
238 3300025940 Ga0207691_10015968 Ga0207691_100159684 238
239 3300025941 Ga0207711_10365708 Ga0207711_103657082 238
240 3300035724 Ga0373933_0175706 Ga0373933_0175706_28_780 238
241 3300036401 Ga0373937_0138239 Ga0373937_0138239_1210_1962 238
242 3300045976 Ga0466967_0135634 Ga0466967_0135634_417_1172 238
243 3300047447 Ga0495685_120163 Ga0495685_120163_54_812 238
244 3300048910 Ga0496107_0187159 Ga0496107_0187159_339_1094 238
245 iso_pu_bacteria 2643221554 2643786923 238
246 iso_pu_bacteria 2643221638 2644215988 238
247 iso_pu_bacteria 2857553236 2857554480 238
248 3300002075 JGI24738J21930_10033544 JGI24738J21930_100335442 239
249 3300032133 Ga0316583_10015566 Ga0316583_100155663 239
250 3300009551 Ga0105238_10000079 Ga0105238_1000007978 240
251 3300025924 Ga0207694_10001799 Ga0207694_100017998 240
252 3300031251 Ga0265327_10004040 Ga0265327_100040404 240
253 3300031901 Ga0307406_10445333 Ga0307406_104453331 240
254 3300048907 Ga0496104_0457814 Ga0496104_0457814_181_951 240
255 3300048918 Ga0496115_0386796 Ga0496115_0386796_287_1057 240
256 3300049581 Ga0501047_0515297 Ga0501047_0515297_106_861 240
257 iso_pu_bacteria 2885270888 2885271109 240
258 3300001915 JGI24741J21665_1000010 JGI24741J21665_100001024 241
259 3300003752 Ga0055539_1000034 Ga0055539_1000034141 241
260 3300003756 Ga0055533_1006415 Ga0055533_10064151 241
261 3300003759 Ga0055525_1000538 Ga0055525_100053816 241
262 3300006844 Ga0075428_100000043 Ga0075428_10000004391 241
263 3300025224 Ga0209784_100003 Ga0209784_100003442 241
264 3300025224 Ga0209784_100293 Ga0209784_10029322 241
265 3300025225 Ga0209566_100002 Ga0209566_1000021485 241
266 3300025226 Ga0209674_100008 Ga0209674_100008704 241
267 3300025230 Ga0209563_100004 Ga0209563_100004898 241
268 3300025253 Ga0209677_100009 Ga0209677_100009734 241
269 3300025904 Ga0207647_10127528 Ga0207647_101275283 241
270 3300031824 Ga0307413_10253647 Ga0307413_102536472 241
271 3300044901 Ga0466960_0260535 Ga0466960_0260535_36_803 241
272 3300046459 Ga0495629_0000012 Ga0495629_0000012_211067_211813 241
273 3300046473 Ga0495582_0021655 Ga0495582_0021655_466_1212 241
274 3300046475 Ga0495639_0026775 Ga0495639_0026775_629_1375 241
275 3300046499 Ga0495594_0004998 Ga0495594_0004998_4185_4931 241
276 3300046642 Ga0495634_0035279 Ga0495634_0035279_1833_2579 241
277 3300046663 Ga0495635_0001451 Ga0495635_0001451_846_1592 241
278 3300046683 Ga0495658_0000057 Ga0495658_0000057_43926_44672 241
279 3300046689 Ga0495613_0002697 Ga0495613_0002697_1403_2149 241
280 3300047315 Ga0495581_0000007 Ga0495581_0000007_53652_54398 241
281 3300047321 Ga0495676_0159505 Ga0495676_0159505_140_886 241
282 3300047322 Ga0495680_0025226 Ga0495680_0025226_2863_3609 241
283 3300048089 Ga0495614_0048470 Ga0495614_0048470_302_1048 241
284 3300035172 Ga0373955_0300068 Ga0373955_0300068_226_957 243
285 3300044842 Ga0466957_0113013 Ga0466957_0113013_621_1382 243
286 3300045836 Ga0466958_0011513 Ga0466958_0011513_2298_3053 243
287 3300045836 Ga0466958_0077113 Ga0466958_0077113_1221_1982 243
288 3300048914 Ga0496111_0006048 Ga0496111_0006048_2456_3187 243
289 3300048920 Ga0496117_0024021 Ga0496117_0024021_1695_2429 243
290 3300048921 Ga0496118_0014701 Ga0496118_0014701_3784_4518 243
291 3300006042 Ga0075368_10004447 Ga0075368_100044472 244
292 3300006048 Ga0075363_100039933 Ga0075363_1000399333 244
293 3300006051 Ga0075364_10015616 Ga0075364_100156167 244
294 3300025302 Ga0207426_1003407 Ga0207426_10034074 244
295 3300031824 Ga0307413_10532512 Ga0307413_105325121 244
296 3300032002 Ga0307416_100014685 Ga0307416_1000146857 244
297 3300047444 Ga0495675_0016249 Ga0495675_0016249_181_930 244
298 3300049660 Ga0501216_037931 Ga0501216_037931_69_803 244
299 3300037068 Ga0373925_0304351 Ga0373925_0304351_411_1244 245
300 3300046459 Ga0495629_0067480 Ga0495629_0067480_775_1608 245
301 3300005718 Ga0068866_10029454 Ga0068866_100294542 246
302 iso_pu_bacteria 2551306166 2552113964 246
303 iso_pu_bacteria 2643221692 2644512161 246
304 iso_pu_bacteria 8001781756 8001785422 246
305 3300005985 Ga0081539_10005489 Ga0081539_1000548912 247
306 3300053142 Ga0500577_0009374 Ga0500577_0009374_128_883 247
307 iso_pu_bacteria 2551306166 2552113984 247
308 3300005347 Ga0070668_100004901 Ga0070668_1000049016 248
309 3300009098 Ga0105245_10371493 Ga0105245_103714932 248
310 3300025972 Ga0207668_10008120 Ga0207668_100081203 248
311 3300025986 Ga0207658_10050613 Ga0207658_100506133 248
312 3300028381 Ga0268264_10278872 Ga0268264_102788722 248
313 3300037466 Ga0395898_0196859 Ga0395898_0196859_823_1572 248
314 3300038443 Ga0395901_0248924 Ga0395901_0248924_1035_1790 248
315 3300045976 Ga0466967_0144720 Ga0466967_0144720_1291_2052 248
316 3300049583 Ga0501067_0081461 Ga0501067_0081461_295_1047 248
317 3300053142 Ga0500577_0092583 Ga0500577_0092583_110_880 248
318 iso_pu_bacteria 2501939600 2501941593 248
319 iso_pu_bacteria 2643221601 2644019523 248
320 iso_pu_bacteria 2643221631 2644180590 248
321 iso_pu_bacteria 2738543010 2739232751 248
322 iso_pu_bacteria 2808606360 2808849892 248
323 iso_pu_bacteria 2808606371 2808899010 248
324 iso_pu_bacteria 2811994871 2812319649 248
325 iso_pu_bacteria 2818991472 2819739170 248
326 iso_pu_bacteria 2856741275 2856742713 248
327 iso_pu_bacteria 2891562705 2891565010 248
328 iso_pu_bacteria 2995463766 2995468117 248
329 iso_pu_bacteria 649633069 649816049 248
330 iso_pu_bacteria 8003856774 8003861676 248
331 iso_pu_bacteria 8055157932 8055159749 248
332 3300009551 Ga0105238_10322401 Ga0105238_103224012 249
333 3300010375 Ga0105239_10050416 Ga0105239_100504167 249
334 3300013307 Ga0157372_10087937 Ga0157372_100879374 249
335 3300020082 Ga0206353_10256792 Ga0206353_102567922 249
336 3300025939 Ga0207665_10021790 Ga0207665_100217905 249
337 3300026067 Ga0207678_10095644 Ga0207678_100956443 249
338 3300032002 Ga0307416_100683726 Ga0307416_1006837262 249
339 3300032005 Ga0307411_10608273 Ga0307411_106082731 249
340 3300032126 Ga0307415_100009535 Ga0307415_1000095353 249
341 3300034818 Ga0373950_0005439 Ga0373950_0005439_620_1384 249
342 3300035088 Ga0373940_0009630 Ga0373940_0009630_740_1504 249
343 3300035207 Ga0373942_0000328 Ga0373942_0000328_11126_11890 249
344 3300038443 Ga0395901_0850247 Ga0395901_0850247_130_885 249
345 3300044656 Ga0466969_0010424 Ga0466969_0010424_1257_2006 249
346 3300044693 Ga0466961_0122029 Ga0466961_0122029_292_1041 249
347 3300044765 Ga0466970_0006879 Ga0466970_0006879_49_798 249
348 3300044842 Ga0466957_0450243 Ga0466957_0450243_14_769 249
349 3300045976 Ga0466967_0313568 Ga0466967_0313568_591_1346 249
350 3300049568 Ga0501031_0043843 Ga0501031_0043843_1712_2467 249
351 3300049569 Ga0501032_0228082 Ga0501032_0228082_97_852 249
352 3300049570 Ga0501033_0124002 Ga0501033_0124002_85_840 249
353 3300049572 Ga0501036_0086867 Ga0501036_0086867_379_1134 249
354 3300049574 Ga0501038_0081904 Ga0501038_0081904_1569_2324 249
355 3300049575 Ga0501039_0018878 Ga0501039_0018878_4272_5027 249
356 3300049576 Ga0501040_0017199 Ga0501040_0017199_260_1015 249
357 3300049578 Ga0501042_0257449 Ga0501042_0257449_430_1185 249
358 3300049582 Ga0501048_0147412 Ga0501048_0147412_477_1232 249
359 3300049584 Ga0501068_0072495 Ga0501068_0072495_839_1594 249
360 3300049587 Ga0501071_0006292 Ga0501071_0006292_571_1326 249
361 3300049588 Ga0501072_0039929 Ga0501072_0039929_1198_1953 249
362 3300049591 Ga0501075_0031277 Ga0501075_0031277_201_956 249
363 3300049592 Ga0501076_0055369 Ga0501076_0055369_574_1329 249
364 3300049593 Ga0501077_0047277 Ga0501077_0047277_660_1415 249
365 3300049741 Ga0501079_0125998 Ga0501079_0125998_1170_1925 249
366 3300049742 Ga0501080_0203794 Ga0501080_0203794_369_1124 249
367 3300049743 Ga0501081_0347039 Ga0501081_0347039_38_793 249
368 3300049744 Ga0501083_0051045 Ga0501083_0051045_432_1187 249
369 3300049822 Ga0501035_0024558 Ga0501035_0024558_477_1232 249
370 3300049823 Ga0501044_0345679 Ga0501044_0345679_538_1293 249
371 3300049824 Ga0501045_0035555 Ga0501045_0035555_2468_3223 249
372 3300054114 Ga0501084_0215614 Ga0501084_0215614_29_784 249
373 3300060353 Ga0501082_0093468 Ga0501082_0093468_731_1486 249
374 3300061734 Ga0530510_0016407 Ga0530510_0016407_2737_3492 249
375 iso_pu_bacteria 2643221576 2643889919 249
376 iso_pu_bacteria 2643221590 2643958975 249
377 iso_pu_bacteria 2643221604 2644033872 249
378 iso_pu_bacteria 2643221617 2644102618 249
379 iso_pu_bacteria 2643221620 2644118280 249
380 iso_pu_bacteria 2811994874 2812331707 249
381 iso_pu_bacteria 2862574272 2862575323 249
382 iso_pu_bacteria 2887478801 2887480904 249
383 iso_pu_bacteria 3006826541 3006826896 249
384 iso_pu_bacteria 8022893055 8022894106 249
385 3300005366 Ga0070659_100074720 Ga0070659_1000747202 250
386 3300005445 Ga0070708_100031336 Ga0070708_1000313364 250
387 3300005467 Ga0070706_100004098 Ga0070706_1000040988 250
388 3300005471 Ga0070698_100089243 Ga0070698_1000892432 250
389 3300005983 Ga0081540_1088150 Ga0081540_10881501 250
390 3300006844 Ga0075428_100184363 Ga0075428_1001843632 250
391 3300013105 Ga0157369_10272408 Ga0157369_102724082 250
392 3300014745 Ga0157377_10399380 Ga0157377_103993801 250
393 3300014969 Ga0157376_10606287 Ga0157376_106062872 250
394 3300025904 Ga0207647_10016687 Ga0207647_100166876 250
395 3300025919 Ga0207657_10060954 Ga0207657_100609546 250
396 3300025922 Ga0207646_10171736 Ga0207646_101717363 250
397 3300025944 Ga0207661_10313984 Ga0207661_103139843 250
398 3300031852 Ga0307410_10049971 Ga0307410_100499712 250
399 3300031901 Ga0307406_10081331 Ga0307406_100813313 250
400 3300031995 Ga0307409_100016843 Ga0307409_1000168434 250
401 3300032002 Ga0307416_100404222 Ga0307416_1004042221 250
402 3300035117 Ga0373953_0011082 Ga0373953_0011082_328_1080 250
403 3300035118 Ga0373954_0062890 Ga0373954_0062890_601_1353 250
404 3300035119 Ga0373956_0006754 Ga0373956_0006754_2199_2951 250
405 3300035170 Ga0373943_0147097 Ga0373943_0147097_76_828 250
406 3300035172 Ga0373955_0024911 Ga0373955_0024911_1047_1799 250
407 3300035692 Ga0373935_0022512 Ga0373935_0022512_851_1603 250
408 3300035724 Ga0373933_0008466 Ga0373933_0008466_2271_3023 250
409 3300036401 Ga0373937_0542575 Ga0373937_0542575_266_1018 250
410 3300037068 Ga0373925_0387683 Ga0373925_0387683_82_834 250
411 3300042006 Ga0439432_069941 Ga0439432_069941_112_870 250
412 3300042007 Ga0439449_0005087 Ga0439449_0005087_1029_1787 250
413 3300044656 Ga0466969_0009652 Ga0466969_0009652_1039_1797 250
414 3300044656 Ga0466969_0070638 Ga0466969_0070638_431_1189 250
415 3300044658 Ga0466972_0047727 Ga0466972_0047727_108_869 250
416 3300044683 Ga0466965_0048033 Ga0466965_0048033_1158_1919 250
417 3300044684 Ga0466966_0001445 Ga0466966_0001445_3081_3839 250
418 3300044693 Ga0466961_0064476 Ga0466961_0064476_1191_1949 250
419 3300044765 Ga0466970_0026432 Ga0466970_0026432_988_1749 250
420 3300044901 Ga0466960_0035516 Ga0466960_0035516_1085_1846 250
421 3300045049 Ga0466959_0062467 Ga0466959_0062467_592_1350 250
422 3300046461 Ga0495641_0111554 Ga0495641_0111554_95_847 250
423 3300046462 Ga0495651_0003407 Ga0495651_0003407_8635_9387 250
424 3300046463 Ga0495653_0058177 Ga0495653_0058177_1804_2556 250
425 3300046511 Ga0495608_0002781 Ga0495608_0002781_4790_5548 250
426 3300046511 Ga0495608_0020655 Ga0495608_0020655_1532_2284 250
427 3300046535 Ga0495586_0241308 Ga0495586_0241308_146_904 250
428 3300046543 Ga0495645_0044434 Ga0495645_0044434_672_1430 250
429 3300046559 Ga0495667_0010954 Ga0495667_0010954_4093_4845 250
430 3300046663 Ga0495635_0007651 Ga0495635_0007651_235_987 250
431 3300046674 Ga0495588_0064304 Ga0495588_0064304_1031_1789 250
432 3300046675 Ga0495657_0010506 Ga0495657_0010506_3830_4582 250
433 3300046678 Ga0495599_0115489 Ga0495599_0115489_799_1551 250
434 3300046679 Ga0495623_0013784 Ga0495623_0013784_3824_4582 250
435 3300046809 Ga0495600_0025215 Ga0495600_0025215_1124_1876 250
436 3300047317 Ga0495604_0014104 Ga0495604_0014104_2897_3655 250
437 3300047319 Ga0495674_0029245 Ga0495674_0029245_36_788 250
438 3300047321 Ga0495676_0167164 Ga0495676_0167164_731_1501 250
439 3300047322 Ga0495680_0012974 Ga0495680_0012974_3956_4708 250
440 3300047444 Ga0495675_0019337 Ga0495675_0019337_1918_2676 250
441 3300047444 Ga0495675_0060814 Ga0495675_0060814_169_927 250
442 3300047447 Ga0495685_070498 Ga0495685_070498_150_908 250
443 3300047471 Ga0495684_0022700 Ga0495684_0022700_2271_3023 250
444 3300048088 Ga0495602_0036059 Ga0495602_0036059_2737_3489 250
445 3300048904 Ga0496101_0131350 Ga0496101_0131350_759_1517 250
446 3300048907 Ga0496104_0140678 Ga0496104_0140678_288_1046 250
447 3300048908 Ga0496105_0025490 Ga0496105_0025490_3679_4437 250
448 3300048908 Ga0496105_0119845 Ga0496105_0119845_584_1342 250
449 3300048911 Ga0496108_0350621 Ga0496108_0350621_115_873 250
450 3300048913 Ga0496110_0172103 Ga0496110_0172103_641_1399 250
451 3300048913 Ga0496110_0319209 Ga0496110_0319209_80_838 250
452 3300048917 Ga0496114_0053585 Ga0496114_0053585_2263_3021 250
453 3300048917 Ga0496114_0682967 Ga0496114_0682967_17_775 250
454 3300050492 nmdc:mga0yw44_42147_c1 nmdc:mga0yw44_42147_c1_549_1307 250
455 3300050510 nmdc:mga06r32_67353_c1 nmdc:mga06r32_67353_c1_1529_2287 250
456 3300001904 JGI24736J21556_1001712 JGI24736J21556_10017124 251
457 3300001979 JGI24740J21852_10008764 JGI24740J21852_100087644 251
458 3300001989 JGI24739J22299_10000064 JGI24739J22299_1000006412 251
459 3300001990 JGI24737J22298_10001765 JGI24737J22298_100017653 251
460 3300005329 Ga0070683_100506973 Ga0070683_1005069732 251
461 3300005339 Ga0070660_100004481 Ga0070660_1000044815 251
462 3300005366 Ga0070659_100009247 Ga0070659_1000092472 251
463 3300005436 Ga0070713_100686314 Ga0070713_1006863141 251
464 3300005439 Ga0070711_100061196 Ga0070711_1000611961 251
465 3300005445 Ga0070708_100058196 Ga0070708_1000581963 251
466 3300005445 Ga0070708_100113950 Ga0070708_1001139502 251
467 3300005458 Ga0070681_10325911 Ga0070681_103259111 251
468 3300005467 Ga0070706_100507853 Ga0070706_1005078531 251
469 3300005468 Ga0070707_100166915 Ga0070707_1001669152 251
470 3300005518 Ga0070699_100134048 Ga0070699_1001340481 251
471 3300005535 Ga0070684_100035439 Ga0070684_1000354391 251
472 3300005535 Ga0070684_100642438 Ga0070684_1006424382 251
473 3300005536 Ga0070697_100056441 Ga0070697_1000564412 251
474 3300005539 Ga0068853_100001500 Ga0068853_10000150016 251
475 3300005563 Ga0068855_100001045 Ga0068855_10000104513 251
476 3300005577 Ga0068857_100033467 Ga0068857_1000334671 251
477 3300005578 Ga0068854_100001196 Ga0068854_1000011968 251
478 3300005578 Ga0068854_100423067 Ga0068854_1004230672 251
479 3300005614 Ga0068856_100045173 Ga0068856_1000451735 251
480 3300005616 Ga0068852_100000924 Ga0068852_1000009245 251
481 3300005834 Ga0068851_10007031 Ga0068851_100070313 251
482 3300005981 Ga0081538_10016227 Ga0081538_100162276 251
483 3300005981 Ga0081538_10054394 Ga0081538_100543942 251
484 3300005981 Ga0081538_10086006 Ga0081538_100860061 251
485 3300006028 Ga0070717_10016423 Ga0070717_100164233 251
486 3300006028 Ga0070717_10092781 Ga0070717_100927812 251
487 3300006038 Ga0075365_10006611 Ga0075365_100066115 251
488 3300006175 Ga0070712_100015119 Ga0070712_1000151195 251
489 3300006177 Ga0075362_10002027 Ga0075362_100020272 251
490 3300006353 Ga0075370_10135981 Ga0075370_101359812 251
491 3300006844 Ga0075428_100214647 Ga0075428_1002146471 251
492 3300009011 Ga0105251_10001505 Ga0105251_100015055 251
493 3300009036 Ga0105244_10001347 Ga0105244_100013475 251
494 3300009092 Ga0105250_10002004 Ga0105250_100020042 251
495 3300009093 Ga0105240_10029849 Ga0105240_100298494 251
496 3300009098 Ga0105245_10042569 Ga0105245_100425691 251
497 3300009147 Ga0114129_10140385 Ga0114129_101403851 251
498 3300009174 Ga0105241_10000156 Ga0105241_1000015634 251
499 3300009545 Ga0105237_10068545 Ga0105237_100685454 251
500 3300009551 Ga0105238_10007164 Ga0105238_100071647 251
501 3300010375 Ga0105239_10034546 Ga0105239_100345463 251
502 3300010375 Ga0105239_10399812 Ga0105239_103998122 251
503 3300013105 Ga0157369_10002092 Ga0157369_1000209216 251
504 3300013306 Ga0163162_10077494 Ga0163162_100774942 251
505 3300022467 Ga0224712_10056235 Ga0224712_100562351 251
506 3300025321 Ga0207656_10009161 Ga0207656_100091614 251
507 3300025728 Ga0207655_1001563 Ga0207655_100156315 251
508 3300025735 Ga0207713_1001245 Ga0207713_10012457 251
509 3300025901 Ga0207688_10081152 Ga0207688_100811522 251
510 3300025904 Ga0207647_10000033 Ga0207647_1000003311 251
511 3300025910 Ga0207684_10012883 Ga0207684_100128832 251
512 3300025911 Ga0207654_10008183 Ga0207654_100081835 251
513 3300025913 Ga0207695_10002681 Ga0207695_100026813 251
514 3300025914 Ga0207671_10041228 Ga0207671_100412283 251
515 3300025915 Ga0207693_10383838 Ga0207693_103838381 251
516 3300025919 Ga0207657_10001739 Ga0207657_100017397 251
517 3300025924 Ga0207694_10020030 Ga0207694_100200302 251
518 3300025927 Ga0207687_10051445 Ga0207687_100514453 251
519 3300025933 Ga0207706_10037034 Ga0207706_100370345 251
520 3300025944 Ga0207661_10027976 Ga0207661_100279762 251
521 3300025944 Ga0207661_10381712 Ga0207661_103817121 251
522 3300025949 Ga0207667_10002487 Ga0207667_1000248711 251
523 3300025981 Ga0207640_10000460 Ga0207640_1000046020 251
524 3300026041 Ga0207639_10072126 Ga0207639_100721261 251
525 3300026078 Ga0207702_10000793 Ga0207702_1000079310 251
526 3300026116 Ga0207674_10013896 Ga0207674_100138966 251
527 3300026116 Ga0207674_10378173 Ga0207674_103781731 251
528 3300026142 Ga0207698_10013410 Ga0207698_100134105 251
529 3300031456 Ga0307513_10027389 Ga0307513_100273893 251
530 3300031548 Ga0307408_100000387 Ga0307408_10000038723 251
531 3300031731 Ga0307405_10011285 Ga0307405_100112852 251
532 3300031731 Ga0307405_10153812 Ga0307405_101538122 251
533 3300031731 Ga0307405_10463048 Ga0307405_104630482 251
534 3300031852 Ga0307410_10019242 Ga0307410_100192421 251
535 3300031903 Ga0307407_10060291 Ga0307407_100602913 251
536 3300031903 Ga0307407_10088370 Ga0307407_100883702 251
537 3300031995 Ga0307409_100003060 Ga0307409_1000030608 251
538 3300031995 Ga0307409_100075207 Ga0307409_1000752072 251
539 3300031995 Ga0307409_100468805 Ga0307409_1004688052 251
540 3300032126 Ga0307415_100062968 Ga0307415_1000629682 251
541 3300035172 Ga0373955_0210507 Ga0373955_0210507_31_786 251
542 3300036401 Ga0373937_0237763 Ga0373937_0237763_90_863 251
543 3300037418 Ga0395900_0680420 Ga0395900_0680420_29_799 251
544 3300037853 Ga0436364_1208927 Ga0436364_1208927_2657_3421 251
545 3300038443 Ga0395901_0049393 Ga0395901_0049393_1039_1809 251
546 3300038735 Ga0400485_14387 Ga0400485_14387_10936_11709 251
547 3300038741 Ga0400488_33105 Ga0400488_33105_1948_2721 251
548 3300038742 Ga0400486_21500 Ga0400486_21500_4245_5018 251
549 3300041456 Ga0451795_0766239 Ga0451795_0766239_499_1260 251
550 3300041505 Ga0451849_0593111 Ga0451849_0593111_41_802 251
551 3300042004 Ga0439445_0025124 Ga0439445_0025124_284_1039 251
552 3300044765 Ga0466970_0031436 Ga0466970_0031436_1289_2059 251
553 3300044842 Ga0466957_0090956 Ga0466957_0090956_186_956 251
554 3300046533 Ga0495640_0197073 Ga0495640_0197073_406_1179 251
555 3300048911 Ga0496108_0628073 Ga0496108_0628073_93_857 251
556 3300048923 Ga0496120_0002693 Ga0496120_0002693_554_1336 251
557 3300050491 nmdc:mga00v17_7749_c1 nmdc:mga00v17_7749_c1_3085_3849 251
558 3300050492 nmdc:mga0yw44_2105_c1 nmdc:mga0yw44_2105_c1_160_915 251
559 3300050492 nmdc:mga0yw44_230237_c1 nmdc:mga0yw44_230237_c1_132_899 251
560 3300050494 nmdc:mga06z11_106199_c1 nmdc:mga06z11_106199_c1_170_934 251
561 3300050496 nmdc:mga07m45_2591_c1 nmdc:mga07m45_2591_c1_10_774 251
562 3300050516 nmdc:mga0sz30_110914_c1 nmdc:mga0sz30_110914_c1_171_935 251
563 3300059424 Ga0590075_001853 Ga0590075_001853_1846_2607 251
564 3300059426 Ga0590077_006260 Ga0590077_006260_754_1515 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

229

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

281

0.96

PF08659

KR

KR domain

37

211

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sju-assembly1.cif.gz_A hedamycin polyketide ketoreductase bound to nadph 0.9673 5 248
6t62-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii fabg in complex with nadph at 1.8 a resolution 0.9661 4 248
7pcs-assembly1.cif.gz_D structure of the heterotetrameric sdr family member bbscd 0.9648 1 248
4cqm-assembly2.cif.gz_C crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9645 5 248
4cql-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9641 5 248
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9651 4 179 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9649 5 183 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9605 5 248 3.40.50.720
5jy1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9577 5 248 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9565 5 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B3G9J1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9988 4 184
AF-A0A223SAM0-F1-model_v4 Acyl-CoA dehydrogenase 0.9984 4 250 GO:0005886
GO:0016627
GO:0050660
AF-A0A6I5X221-F1-model_v4 SDR family oxidoreductase 0.998 2 249 GO:0016491
AF-A0A6N7CA84-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase MabA 0.9967 3 251 GO:0016491
AF-K1E4Y3-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9962 69 249 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.7 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map