F464148
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 564 | 385 | 532 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100423067|Ga0068854_1004230672 |
| Length | 282 |
| Sequence | MLLGRASRLIAVLDLQRRMVIAIARPGRSAKLSEARVAVVSGAAQGIGAATARRLASDGHAVALIDLDENACKDGVDAILADGGQATAIGCDVADESAVAAAFETIAAQLGAPTILVNNAGIIRDNLLFKMPVDDFDAVLNVHLRGAFLMSRAAQRFMTGQRFGRIVNLSSVAALGNRGQTNYSAAKAGVQGFTKTLAIELGPFGVTVNAIAPGFIQTDMTAATAERIGVPFEEFIASASEQIPVRRVGQPEDIAHTVSFLVSEGAGFVSGQIIYLAGGPTC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 3 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 4 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 5 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 6 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 7 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 8 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 9 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 10 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 11 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 12 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 13 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 14 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 15 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 16 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 17 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 18 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 19 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 20 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 21 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 22 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 23 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 24 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 25 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 26 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 27 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 28 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 29 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 30 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 33 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 34 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 35 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 36 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 37 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 40 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 41 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 49 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 203 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 225 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 226 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 232 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 233 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 234 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 325 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 351 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 374 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 375 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 381 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 382 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 383 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 384 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 385 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.73 |
| Metatranscriptomes | 1.6 |
| Isolates | 5.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.3 |
| Nodule | 0.53 |
| Rhizoplane | 4.96 |
| Rhizosphere | 75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001712 | 3300001904 | Bacteria | 3954 |
| 2 | JGI24741J21665_1000010 | 3300001915 | Bacteria | 44368 |
| 3 | JGI24740J21852_10008764 | 3300001979 | Bacteria | 4013 |
| 4 | JGI24739J22299_10000064 | 3300001989 | Bacteria | 29745 |
| 5 | JGI24737J22298_10001765 | 3300001990 | Bacteria | 7737 |
| 6 | JGI24743J22301_10011629 | 3300001991 | Bacteria | 1589 |
| 7 | JGI24750J21931_1023946 | 3300002070 | Bacteria | 869 |
| 8 | JGI24738J21930_10033544 | 3300002075 | Bacteria | 1046 |
| 9 | JGI25158J39367_1001766 | 3300002739 | Bacteria | 3689 |
| 10 | JGI25152J39213_1003851 | 3300002773 | Bacteria | 4950 |
| 11 | JGI25150J39212_1005125 | 3300002774 | Bacteria | 2829 |
| 12 | JGI25150J39212_1011438 | 3300002774 | Bacteria | 1609 |
| 13 | JGI25153J46596_10008450 | 3300003215 | Bacteria | 4921 |
| 14 | rootL2_10103237 | 3300003322 | Bacteria | 1177 |
| 15 | JGI25161J50226_1009399 | 3300003374 | Bacteria | 1395 |
| 16 | Ga0055539_1000034 | 3300003752 | Bacteria | 223400 |
| 17 | Ga0055533_1006415 | 3300003756 | Bacteria | 1736 |
| 18 | Ga0055525_1000538 | 3300003759 | Bacteria | 18074 |
| 19 | Ga0055529_1000403 | 3300003763 | Bacteria | 45873 |
| 20 | Ga0055526_1005592 | 3300003771 | Bacteria | 7164 |
| 21 | Ga0055537_1006604 | 3300003773 | Bacteria | 2913 |
| 22 | Ga0055524_1000234 | 3300003775 | Bacteria | 58774 |
| 23 | Ga0055524_1006560 | 3300003775 | Bacteria | 5033 |
| 24 | Ga0055524_1008881 | 3300003775 | Bacteria | 4137 |
| 25 | Ga0055524_1016262 | 3300003775 | Bacteria | 2675 |
| 26 | Ga0055534_1011123 | 3300003784 | Bacteria | 1845 |
| 27 | Ga0055534_1011642 | 3300003784 | Bacteria | 1777 |
| 28 | Ga0055528_1002474 | 3300003790 | Bacteria | 9876 |
| 29 | Ga0055530_10008671 | 3300003791 | Bacteria | 4027 |
| 30 | Ga0055531_10033093 | 3300003794 | Bacteria | 1673 |
| 31 | Ga0070683_100014373 | 3300005329 | Bacteria | 6924 |
| 32 | Ga0070683_100506973 | 3300005329 | Bacteria | 1153 |
| 33 | Ga0070682_100018971 | 3300005337 | Bacteria | 4028 |
| 34 | Ga0068868_100223154 | 3300005338 | Bacteria | 1578 |
| 35 | Ga0070660_100004481 | 3300005339 | Bacteria | 9653 |
| 36 | Ga0070687_100109015 | 3300005343 | Bacteria | 1564 |
| 37 | Ga0070661_100198773 | 3300005344 | Bacteria | 1531 |
| 38 | Ga0070668_100004901 | 3300005347 | Bacteria | 9920 |
| 39 | Ga0070668_100130364 | 3300005347 | Bacteria | 2018 |
| 40 | Ga0070668_100503163 | 3300005347 | Bacteria | 1049 |
| 41 | Ga0070669_100208607 | 3300005353 | Bacteria | 1540 |
| 42 | Ga0070674_100194342 | 3300005356 | Bacteria | 1562 |
| 43 | Ga0070688_100271507 | 3300005365 | Bacteria | 1215 |
| 44 | Ga0070659_100009247 | 3300005366 | Bacteria | 7234 |
| 45 | Ga0070659_100074720 | 3300005366 | Bacteria | 2700 |
| 46 | Ga0070659_100130848 | 3300005366 | Bacteria | 2038 |
| 47 | Ga0070713_100686314 | 3300005436 | Bacteria | 977 |
| 48 | Ga0070701_10047723 | 3300005438 | Bacteria | 2206 |
| 49 | Ga0070711_100061196 | 3300005439 | Bacteria | 2620 |
| 50 | Ga0070700_100022720 | 3300005441 | Bacteria | 3663 |
| 51 | Ga0070708_100031336 | 3300005445 | Bacteria | 4601 |
| 52 | Ga0070708_100058196 | 3300005445 | Bacteria | 3443 |
| 53 | Ga0070708_100113950 | 3300005445 | Bacteria | 2487 |
| 54 | Ga0070681_10325911 | 3300005458 | Bacteria | 1446 |
| 55 | Ga0068867_100240219 | 3300005459 | Bacteria | 1469 |
| 56 | Ga0070685_10039955 | 3300005466 | Bacteria | 2668 |
| 57 | Ga0070706_100004098 | 3300005467 | Bacteria | 14173 |
| 58 | Ga0070706_100016881 | 3300005467 | Bacteria | 6743 |
| 59 | Ga0070706_100507853 | 3300005467 | Bacteria | 1121 |
| 60 | Ga0070707_100003448 | 3300005468 | Bacteria | 14946 |
| 61 | Ga0070707_100166915 | 3300005468 | Bacteria | 2145 |
| 62 | Ga0070698_100077837 | 3300005471 | Bacteria | 3315 |
| 63 | Ga0070698_100089243 | 3300005471 | Bacteria | 3067 |
| 64 | Ga0070699_100000298 | 3300005518 | Bacteria | 47855 |
| 65 | Ga0070699_100134048 | 3300005518 | Bacteria | 2184 |
| 66 | Ga0070684_100020890 | 3300005535 | Bacteria | 5434 |
| 67 | Ga0070684_100035439 | 3300005535 | Bacteria | 4270 |
| 68 | Ga0070684_100642438 | 3300005535 | Bacteria | 988 |
| 69 | Ga0070697_100056441 | 3300005536 | Bacteria | 3195 |
| 70 | Ga0068853_100001500 | 3300005539 | Bacteria | 16952 |
| 71 | Ga0068853_100043128 | 3300005539 | Bacteria | 3860 |
| 72 | Ga0070672_100028650 | 3300005543 | Bacteria | 4167 |
| 73 | Ga0068855_100001045 | 3300005563 | Bacteria | 34361 |
| 74 | Ga0068857_100033467 | 3300005577 | Bacteria | 4545 |
| 75 | Ga0068854_100001196 | 3300005578 | Bacteria | 15559 |
| 76 | Ga0068854_100423067 | 3300005578 | Bacteria | 1107 |
| 77 | Ga0068856_100045173 | 3300005614 | Bacteria | 4336 |
| 78 | Ga0070702_100008749 | 3300005615 | Bacteria | 4920 |
| 79 | Ga0070702_100009006 | 3300005615 | Bacteria | 4864 |
| 80 | Ga0068852_100000924 | 3300005616 | Bacteria | 19430 |
| 81 | Ga0068852_100066930 | 3300005616 | Bacteria | 3139 |
| 82 | Ga0068852_100785124 | 3300005616 | Bacteria | 966 |
| 83 | Ga0068864_100096470 | 3300005618 | Bacteria | 2617 |
| 84 | Ga0068866_10004804 | 3300005718 | Bacteria | 5545 |
| 85 | Ga0068866_10029454 | 3300005718 | Bacteria | 2626 |
| 86 | Ga0068861_100067139 | 3300005719 | Bacteria | 2767 |
| 87 | Ga0068851_10007031 | 3300005834 | Bacteria | 5161 |
| 88 | Ga0068870_10004500 | 3300005840 | Bacteria | 6002 |
| 89 | Ga0081538_10016227 | 3300005981 | Bacteria | 5724 |
| 90 | Ga0081538_10054394 | 3300005981 | Bacteria | 2368 |
| 91 | Ga0081538_10086006 | 3300005981 | Bacteria | 1648 |
| 92 | Ga0081540_1088150 | 3300005983 | Bacteria | 1373 |
| 93 | Ga0081539_10005489 | 3300005985 | Bacteria | 12888 |
| 94 | Ga0070717_10016423 | 3300006028 | Bacteria | 5738 |
| 95 | Ga0070717_10092781 | 3300006028 | Bacteria | 2551 |
| 96 | Ga0075365_10006611 | 3300006038 | Bacteria | 6399 |
| 97 | Ga0075365_10012036 | 3300006038 | Bacteria | 5117 |
| 98 | Ga0075368_10004447 | 3300006042 | Bacteria | 4753 |
| 99 | Ga0075363_100039933 | 3300006048 | Bacteria | 2472 |
| 100 | Ga0075364_10015616 | 3300006051 | Bacteria | 4712 |
| 101 | Ga0070712_100015119 | 3300006175 | Bacteria | 4963 |
| 102 | Ga0075362_10002027 | 3300006177 | Bacteria | 6670 |
| 103 | Ga0075362_10128102 | 3300006177 | Bacteria | 1205 |
| 104 | Ga0097621_100256897 | 3300006237 | Bacteria | 1532 |
| 105 | Ga0075370_10135981 | 3300006353 | Bacteria | 1436 |
| 106 | Ga0075428_100000043 | 3300006844 | Bacteria | 102004 |
| 107 | Ga0075428_100101410 | 3300006844 | Bacteria | 3138 |
| 108 | Ga0075428_100184363 | 3300006844 | Bacteria | 2258 |
| 109 | Ga0075428_100214647 | 3300006844 | Bacteria | 2079 |
| 110 | Ga0068865_100025194 | 3300006881 | Bacteria | 3909 |
| 111 | Ga0068865_100171162 | 3300006881 | Bacteria | 1665 |
| 112 | Ga0068865_100439834 | 3300006881 | Bacteria | 1076 |
| 113 | Ga0105251_10001505 | 3300009011 | Bacteria | 20012 |
| 114 | Ga0105244_10001347 | 3300009036 | Bacteria | 20009 |
| 115 | Ga0105250_10002004 | 3300009092 | Bacteria | 10550 |
| 116 | Ga0105240_10029849 | 3300009093 | Bacteria | 7096 |
| 117 | Ga0111539_10231013 | 3300009094 | Bacteria | 2154 |
| 118 | Ga0105245_10036539 | 3300009098 | Bacteria | 4364 |
| 119 | Ga0105245_10042569 | 3300009098 | Bacteria | 4053 |
| 120 | Ga0105245_10371493 | 3300009098 | Bacteria | 1422 |
| 121 | Ga0114129_10140385 | 3300009147 | Bacteria | 3312 |
| 122 | Ga0105243_10033259 | 3300009148 | Bacteria | 3987 |
| 123 | Ga0105243_10084645 | 3300009148 | Bacteria | 2597 |
| 124 | Ga0105241_10000156 | 3300009174 | Bacteria | 49491 |
| 125 | Ga0105237_10068545 | 3300009545 | Bacteria | 3541 |
| 126 | Ga0105238_10000079 | 3300009551 | Bacteria | 109619 |
| 127 | Ga0105238_10007164 | 3300009551 | Bacteria | 11153 |
| 128 | Ga0105238_10037915 | 3300009551 | Bacteria | 4898 |
| 129 | Ga0105238_10322401 | 3300009551 | Bacteria | 1531 |
| 130 | Ga0105238_10606292 | 3300009551 | Bacteria | 1103 |
| 131 | Ga0105249_10061179 | 3300009553 | Bacteria | 3455 |
| 132 | Ga0105249_10117819 | 3300009553 | Bacteria | 2519 |
| 133 | Ga0105239_10034546 | 3300010375 | Bacteria | 5552 |
| 134 | Ga0105239_10050416 | 3300010375 | Bacteria | 4566 |
| 135 | Ga0105239_10151901 | 3300010375 | Bacteria | 2584 |
| 136 | Ga0105239_10399812 | 3300010375 | Bacteria | 1555 |
| 137 | Ga0157369_10002092 | 3300013105 | Bacteria | 24134 |
| 138 | Ga0157369_10272408 | 3300013105 | Bacteria | 1764 |
| 139 | Ga0157378_10023032 | 3300013297 | Bacteria | 5483 |
| 140 | Ga0163162_10077494 | 3300013306 | Bacteria | 3388 |
| 141 | Ga0157372_10087937 | 3300013307 | Bacteria | 3527 |
| 142 | Ga0157372_10259217 | 3300013307 | Bacteria | 2019 |
| 143 | Ga0157375_10041467 | 3300013308 | Bacteria | 4445 |
| 144 | Ga0157375_10273672 | 3300013308 | Bacteria | 1851 |
| 145 | Ga0157380_10019890 | 3300014326 | Bacteria | 5010 |
| 146 | Ga0157380_10323137 | 3300014326 | Bacteria | 1431 |
| 147 | Ga0157377_10399380 | 3300014745 | Bacteria | 936 |
| 148 | Ga0157376_10606287 | 3300014969 | Bacteria | 1090 |
| 149 | Ga0163161_10100949 | 3300017792 | Bacteria | 2148 |
| 150 | Ga0206353_10256792 | 3300020082 | Bacteria | 2425 |
| 151 | Ga0206353_11163641 | 3300020082 | Bacteria | 1956 |
| 152 | Ga0206353_11427395 | 3300020082 | Bacteria | 1352 |
| 153 | Ga0213872_10000263 | 3300021361 | Bacteria | 45483 |
| 154 | Ga0213872_10111713 | 3300021361 | Bacteria | 1213 |
| 155 | Ga0224712_10056235 | 3300022467 | Bacteria | 1550 |
| 156 | Ga0209436_100291 | 3300025208 | Bacteria | 23121 |
| 157 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 158 | Ga0209784_100293 | 3300025224 | Bacteria | 27186 |
| 159 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 160 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 161 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 162 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 163 | Ga0207425_1001467 | 3300025245 | Bacteria | 9823 |
| 164 | Ga0207425_1001639 | 3300025245 | Bacteria | 9024 |
| 165 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 166 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 167 | Ga0209129_1005030 | 3300025258 | Bacteria | 4863 |
| 168 | Ga0209565_1000902 | 3300025263 | Bacteria | 16045 |
| 169 | Ga0209565_1001159 | 3300025263 | Bacteria | 12725 |
| 170 | Ga0209565_1009721 | 3300025263 | Bacteria | 2421 |
| 171 | Ga0209565_1014062 | 3300025263 | Bacteria | 1851 |
| 172 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 173 | Ga0209673_1004849 | 3300025273 | Bacteria | 7033 |
| 174 | Ga0209675_1000769 | 3300025291 | Bacteria | 21492 |
| 175 | Ga0209675_1005996 | 3300025291 | Bacteria | 4973 |
| 176 | Ga0209675_1009461 | 3300025291 | Bacteria | 3443 |
| 177 | Ga0209564_1001707 | 3300025295 | Bacteria | 20758 |
| 178 | Ga0209564_1003112 | 3300025295 | Bacteria | 11717 |
| 179 | Ga0209758_1000073 | 3300025297 | Bacteria | 276262 |
| 180 | Ga0209758_1002044 | 3300025297 | Bacteria | 21637 |
| 181 | Ga0209050_1000046 | 3300025298 | Bacteria | 386466 |
| 182 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 183 | Ga0209256_1002001 | 3300025299 | Bacteria | 18236 |
| 184 | Ga0209256_1010975 | 3300025299 | Bacteria | 3700 |
| 185 | Ga0207426_1002103 | 3300025302 | Bacteria | 13707 |
| 186 | Ga0207426_1003407 | 3300025302 | Bacteria | 8683 |
| 187 | Ga0209257_1000068 | 3300025304 | Bacteria | 341291 |
| 188 | Ga0207656_10009161 | 3300025321 | Bacteria | 3670 |
| 189 | Ga0207655_1001563 | 3300025728 | Bacteria | 20594 |
| 190 | Ga0207713_1001245 | 3300025735 | Bacteria | 21110 |
| 191 | Ga0207642_10013933 | 3300025899 | Bacteria | 2949 |
| 192 | Ga0207688_10003187 | 3300025901 | Bacteria | 8951 |
| 193 | Ga0207688_10081152 | 3300025901 | Bacteria | 1852 |
| 194 | Ga0207647_10000033 | 3300025904 | Bacteria | 100573 |
| 195 | Ga0207647_10016687 | 3300025904 | Bacteria | 5006 |
| 196 | Ga0207647_10127528 | 3300025904 | Bacteria | 1497 |
| 197 | Ga0207643_10007047 | 3300025908 | Bacteria | 6023 |
| 198 | Ga0207684_10012883 | 3300025910 | Bacteria | 7241 |
| 199 | Ga0207654_10008183 | 3300025911 | Bacteria | 5274 |
| 200 | Ga0207695_10002681 | 3300025913 | Bacteria | 25984 |
| 201 | Ga0207671_10041228 | 3300025914 | Bacteria | 3416 |
| 202 | Ga0207693_10383838 | 3300025915 | Bacteria | 1099 |
| 203 | Ga0207662_10107878 | 3300025918 | Bacteria | 1733 |
| 204 | Ga0207657_10001739 | 3300025919 | Bacteria | 23466 |
| 205 | Ga0207657_10060954 | 3300025919 | Bacteria | 3237 |
| 206 | Ga0207657_10063062 | 3300025919 | Bacteria | 3171 |
| 207 | Ga0207646_10000520 | 3300025922 | Bacteria | 51319 |
| 208 | Ga0207646_10171736 | 3300025922 | Bacteria | 1958 |
| 209 | Ga0207694_10001799 | 3300025924 | Bacteria | 17857 |
| 210 | Ga0207694_10020030 | 3300025924 | Bacteria | 5059 |
| 211 | Ga0207694_10093762 | 3300025924 | Bacteria | 2372 |
| 212 | Ga0207694_10419684 | 3300025924 | Bacteria | 1114 |
| 213 | Ga0207687_10051445 | 3300025927 | Bacteria | 2872 |
| 214 | Ga0207687_10075707 | 3300025927 | Bacteria | 2416 |
| 215 | Ga0207690_10032879 | 3300025932 | Bacteria | 3331 |
| 216 | Ga0207706_10037034 | 3300025933 | Bacteria | 4332 |
| 217 | Ga0207709_10054871 | 3300025935 | Bacteria | 2459 |
| 218 | Ga0207709_10107392 | 3300025935 | Bacteria | 1859 |
| 219 | Ga0207704_10031843 | 3300025938 | Bacteria | 2976 |
| 220 | Ga0207665_10021790 | 3300025939 | Bacteria | 4215 |
| 221 | Ga0207691_10015968 | 3300025940 | Bacteria | 7133 |
| 222 | Ga0207711_10365708 | 3300025941 | Bacteria | 1337 |
| 223 | Ga0207661_10027976 | 3300025944 | Bacteria | 4313 |
| 224 | Ga0207661_10036828 | 3300025944 | Bacteria | 3822 |
| 225 | Ga0207661_10199282 | 3300025944 | Bacteria | 1759 |
| 226 | Ga0207661_10313984 | 3300025944 | Bacteria | 1408 |
| 227 | Ga0207661_10381712 | 3300025944 | Bacteria | 1275 |
| 228 | Ga0207667_10002487 | 3300025949 | Bacteria | 22974 |
| 229 | Ga0207651_10068255 | 3300025960 | Bacteria | 2506 |
| 230 | Ga0207712_10092846 | 3300025961 | Bacteria | 2226 |
| 231 | Ga0207668_10008120 | 3300025972 | Bacteria | 6248 |
| 232 | Ga0207668_10073671 | 3300025972 | Bacteria | 2448 |
| 233 | Ga0207640_10000460 | 3300025981 | Bacteria | 24848 |
| 234 | Ga0207658_10050613 | 3300025986 | Bacteria | 3058 |
| 235 | Ga0207639_10072126 | 3300026041 | Bacteria | 2703 |
| 236 | Ga0207678_10095644 | 3300026067 | Bacteria | 2538 |
| 237 | Ga0207708_10000589 | 3300026075 | Bacteria | 28085 |
| 238 | Ga0207702_10000793 | 3300026078 | Bacteria | 33517 |
| 239 | Ga0207648_10013560 | 3300026089 | Bacteria | 7577 |
| 240 | Ga0207648_10402734 | 3300026089 | Bacteria | 1240 |
| 241 | Ga0207676_10249445 | 3300026095 | Bacteria | 1597 |
| 242 | Ga0207674_10013896 | 3300026116 | Bacteria | 8909 |
| 243 | Ga0207674_10378173 | 3300026116 | Bacteria | 1369 |
| 244 | Ga0207675_100017896 | 3300026118 | Bacteria | 6608 |
| 245 | Ga0207675_100591083 | 3300026118 | Bacteria | 1112 |
| 246 | Ga0207698_10013410 | 3300026142 | Bacteria | 5407 |
| 247 | Ga0207698_10101581 | 3300026142 | Bacteria | 2385 |
| 248 | Ga0207698_10906986 | 3300026142 | Bacteria | 889 |
| 249 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 250 | Ga0207428_10159418 | 3300027907 | Bacteria | 1714 |
| 251 | Ga0207428_10206860 | 3300027907 | Bacteria | 1476 |
| 252 | Ga0268264_10278872 | 3300028381 | Bacteria | 1565 |
| 253 | Ga0265327_10004040 | 3300031251 | Bacteria | 13324 |
| 254 | Ga0307513_10027389 | 3300031456 | Bacteria | 6544 |
| 255 | Ga0307408_100000387 | 3300031548 | Bacteria | 40174 |
| 256 | Ga0307408_100001210 | 3300031548 | Bacteria | 19453 |
| 257 | Ga0307408_100021297 | 3300031548 | Bacteria | 4386 |
| 258 | Ga0307408_100628375 | 3300031548 | Bacteria | 957 |
| 259 | Ga0307405_10011285 | 3300031731 | Bacteria | 4673 |
| 260 | Ga0307405_10153812 | 3300031731 | Bacteria | 1621 |
| 261 | Ga0307405_10463048 | 3300031731 | Bacteria | 1008 |
| 262 | Ga0307413_10253647 | 3300031824 | Bacteria | 1307 |
| 263 | Ga0307413_10532512 | 3300031824 | Bacteria | 949 |
| 264 | Ga0307410_10019242 | 3300031852 | Bacteria | 4148 |
| 265 | Ga0307410_10049971 | 3300031852 | Bacteria | 2809 |
| 266 | Ga0307406_10081331 | 3300031901 | Bacteria | 2154 |
| 267 | Ga0307406_10445333 | 3300031901 | Bacteria | 1038 |
| 268 | Ga0307407_10060291 | 3300031903 | Bacteria | 2214 |
| 269 | Ga0307407_10088370 | 3300031903 | Bacteria | 1893 |
| 270 | Ga0307409_100003060 | 3300031995 | Bacteria | 8946 |
| 271 | Ga0307409_100016843 | 3300031995 | Bacteria | 4851 |
| 272 | Ga0307409_100075207 | 3300031995 | Bacteria | 2703 |
| 273 | Ga0307409_100468805 | 3300031995 | Bacteria | 1219 |
| 274 | Ga0307416_100014685 | 3300032002 | Bacteria | 5380 |
| 275 | Ga0307416_100020341 | 3300032002 | Bacteria | 4733 |
| 276 | Ga0307416_100404222 | 3300032002 | Bacteria | 1404 |
| 277 | Ga0307416_100683726 | 3300032002 | Bacteria | 1114 |
| 278 | Ga0307411_10608273 | 3300032005 | Bacteria | 941 |
| 279 | Ga0307415_100009535 | 3300032126 | Bacteria | 5449 |
| 280 | Ga0307415_100062968 | 3300032126 | Bacteria | 2575 |
| 281 | Ga0316583_10015566 | 3300032133 | Bacteria | 2736 |
| 282 | Ga0373950_0005439 | 3300034818 | Bacteria | 1904 |
| 283 | Ga0373934_0223708 | 3300035086 | Bacteria | 776 |
| 284 | Ga0373940_0009630 | 3300035088 | Bacteria | 2250 |
| 285 | Ga0373953_0011082 | 3300035117 | Bacteria | 3153 |
| 286 | Ga0373954_0062890 | 3300035118 | Bacteria | 1754 |
| 287 | Ga0373956_0006754 | 3300035119 | Bacteria | 4602 |
| 288 | Ga0373943_0147097 | 3300035170 | Bacteria | 1274 |
| 289 | Ga0373946_0010767 | 3300035171 | Bacteria | 3396 |
| 290 | Ga0373955_0024911 | 3300035172 | Bacteria | 3065 |
| 291 | Ga0373955_0210507 | 3300035172 | Bacteria | 1159 |
| 292 | Ga0373955_0300068 | 3300035172 | Bacteria | 968 |
| 293 | Ga0373942_0000328 | 3300035207 | Bacteria | 12928 |
| 294 | Ga0373924_0125566 | 3300035410 | Bacteria | 1115 |
| 295 | Ga0373935_0002124 | 3300035692 | Bacteria | 11241 |
| 296 | Ga0373935_0022512 | 3300035692 | Bacteria | 3865 |
| 297 | Ga0373933_0008466 | 3300035724 | Bacteria | 5611 |
| 298 | Ga0373933_0175706 | 3300035724 | Bacteria | 1364 |
| 299 | Ga0373947_0000003 | 3300035725 | Bacteria | 345338 |
| 300 | Ga0373937_0138239 | 3300036401 | Bacteria | 2278 |
| 301 | Ga0373937_0237763 | 3300036401 | Bacteria | 1716 |
| 302 | Ga0373937_0542575 | 3300036401 | Bacteria | 1104 |
| 303 | Ga0373925_0304351 | 3300037068 | Bacteria | 1288 |
| 304 | Ga0373925_0387683 | 3300037068 | Bacteria | 1138 |
| 305 | Ga0395900_0286281 | 3300037418 | Bacteria | 1638 |
| 306 | Ga0395900_0680420 | 3300037418 | Bacteria | 963 |
| 307 | Ga0395898_0196859 | 3300037466 | Bacteria | 1925 |
| 308 | Ga0395905_0618281 | 3300037471 | Bacteria | 985 |
| 309 | Ga0436364_1208927 | 3300037853 | Bacteria | 3598 |
| 310 | Ga0395901_0049393 | 3300038443 | Bacteria | 4371 |
| 311 | Ga0395901_0248924 | 3300038443 | Bacteria | 1852 |
| 312 | Ga0395901_0850247 | 3300038443 | Bacteria | 898 |
| 313 | Ga0400485_14387 | 3300038735 | Bacteria | 23975 |
| 314 | Ga0400488_33105 | 3300038741 | Bacteria | 11860 |
| 315 | Ga0400486_21500 | 3300038742 | Bacteria | 94371 |
| 316 | Ga0436361_0080172 | 3300039447 | Bacteria | 39325 |
| 317 | Ga0436361_0181426 | 3300039447 | Bacteria | 1331 |
| 318 | Ga0436361_0715182 | 3300039447 | Bacteria | 1054 |
| 319 | Ga0451795_0766239 | 3300041456 | Bacteria | 3862 |
| 320 | Ga0451849_0593111 | 3300041505 | Bacteria | 1036 |
| 321 | Ga0439445_0025124 | 3300042004 | Bacteria | 1518 |
| 322 | Ga0439432_069941 | 3300042006 | Bacteria | 1071 |
| 323 | Ga0439449_0005087 | 3300042007 | Bacteria | 5057 |
| 324 | Ga0439455_0019950 | 3300042012 | Bacteria | 1585 |
| 325 | Ga0450893_0028985 | 3300042532 | Bacteria | 981 |
| 326 | Ga0451577_0010831 | 3300042876 | Bacteria | 8668 |
| 327 | Ga0466969_0009652 | 3300044656 | Bacteria | 5115 |
| 328 | Ga0466969_0010424 | 3300044656 | Bacteria | 4926 |
| 329 | Ga0466969_0070638 | 3300044656 | Bacteria | 1679 |
| 330 | Ga0466969_0086919 | 3300044656 | Bacteria | 1485 |
| 331 | Ga0466972_0047727 | 3300044658 | Bacteria | 2070 |
| 332 | Ga0466965_0048033 | 3300044683 | Bacteria | 2114 |
| 333 | Ga0466966_0001445 | 3300044684 | Bacteria | 15254 |
| 334 | Ga0466966_0096362 | 3300044684 | Bacteria | 1832 |
| 335 | Ga0466961_0064476 | 3300044693 | Bacteria | 2328 |
| 336 | Ga0466961_0122029 | 3300044693 | Bacteria | 1635 |
| 337 | Ga0466963_0388672 | 3300044694 | Bacteria | 983 |
| 338 | Ga0453684_0032889 | 3300044712 | Bacteria | 7242 |
| 339 | Ga0466971_0023125 | 3300044719 | Bacteria | 2770 |
| 340 | Ga0466970_0006879 | 3300044765 | Bacteria | 5694 |
| 341 | Ga0466970_0026432 | 3300044765 | Bacteria | 3041 |
| 342 | Ga0466970_0031436 | 3300044765 | Bacteria | 2803 |
| 343 | Ga0466957_0090956 | 3300044842 | Bacteria | 1912 |
| 344 | Ga0466957_0113013 | 3300044842 | Bacteria | 1724 |
| 345 | Ga0466957_0450243 | 3300044842 | Bacteria | 887 |
| 346 | Ga0466960_0035516 | 3300044901 | Bacteria | 2330 |
| 347 | Ga0466960_0260535 | 3300044901 | Bacteria | 966 |
| 348 | Ga0466959_0062467 | 3300045049 | Bacteria | 2706 |
| 349 | Ga0466959_0069963 | 3300045049 | Bacteria | 2542 |
| 350 | Ga0466958_0011513 | 3300045836 | Bacteria | 4982 |
| 351 | Ga0466958_0077113 | 3300045836 | Bacteria | 2046 |
| 352 | Ga0466958_0087969 | 3300045836 | Bacteria | 1919 |
| 353 | Ga0466967_0135634 | 3300045976 | Bacteria | 2289 |
| 354 | Ga0466967_0144720 | 3300045976 | Bacteria | 2216 |
| 355 | Ga0466967_0313568 | 3300045976 | Bacteria | 1511 |
| 356 | Ga0466967_0488696 | 3300045976 | Bacteria | 1207 |
| 357 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 358 | Ga0495592_0024366 | 3300046454 | Bacteria | 4601 |
| 359 | Ga0495590_0008695 | 3300046457 | Bacteria | 3866 |
| 360 | Ga0495629_0000012 | 3300046459 | Bacteria | 230331 |
| 361 | Ga0495629_0067480 | 3300046459 | Bacteria | 2496 |
| 362 | Ga0495638_0061151 | 3300046460 | Bacteria | 2328 |
| 363 | Ga0495641_0111554 | 3300046461 | Bacteria | 1220 |
| 364 | Ga0495651_0003407 | 3300046462 | Bacteria | 12194 |
| 365 | Ga0495653_0058177 | 3300046463 | Bacteria | 2939 |
| 366 | Ga0495582_0021655 | 3300046473 | Bacteria | 3517 |
| 367 | Ga0495639_0026775 | 3300046475 | Bacteria | 2550 |
| 368 | Ga0495662_0001123 | 3300046476 | Bacteria | 13186 |
| 369 | Ga0495594_0004998 | 3300046499 | Bacteria | 6823 |
| 370 | Ga0495607_0004150 | 3300046501 | Bacteria | 10781 |
| 371 | Ga0495583_0004868 | 3300046506 | Bacteria | 9379 |
| 372 | Ga0495606_0004181 | 3300046507 | Bacteria | 14633 |
| 373 | Ga0495608_0002781 | 3300046511 | Bacteria | 12555 |
| 374 | Ga0495608_0020655 | 3300046511 | Bacteria | 4524 |
| 375 | Ga0495616_0058898 | 3300046513 | Bacteria | 1890 |
| 376 | Ga0495628_0090078 | 3300046516 | Bacteria | 2374 |
| 377 | Ga0495630_0158389 | 3300046517 | Bacteria | 1723 |
| 378 | Ga0495644_0027912 | 3300046523 | Bacteria | 2137 |
| 379 | Ga0495663_0031250 | 3300046525 | Bacteria | 1581 |
| 380 | Ga0495652_0050203 | 3300046529 | Bacteria | 3567 |
| 381 | Ga0495640_0020229 | 3300046533 | Bacteria | 4901 |
| 382 | Ga0495640_0197073 | 3300046533 | Bacteria | 1278 |
| 383 | Ga0495586_0241308 | 3300046535 | Bacteria | 1030 |
| 384 | Ga0495587_0213049 | 3300046536 | Bacteria | 1090 |
| 385 | Ga0495609_0002949 | 3300046538 | Bacteria | 10058 |
| 386 | Ga0495609_0003102 | 3300046538 | Bacteria | 9742 |
| 387 | Ga0495645_0044434 | 3300046543 | Bacteria | 3240 |
| 388 | Ga0495667_0010954 | 3300046559 | Bacteria | 6127 |
| 389 | Ga0495668_0000173 | 3300046616 | Bacteria | 95830 |
| 390 | Ga0495668_0026989 | 3300046616 | Bacteria | 3254 |
| 391 | Ga0495634_0016004 | 3300046642 | Bacteria | 5372 |
| 392 | Ga0495634_0035279 | 3300046642 | Bacteria | 3427 |
| 393 | Ga0495625_0001016 | 3300046660 | Bacteria | 37004 |
| 394 | Ga0495625_0001679 | 3300046660 | Bacteria | 25832 |
| 395 | Ga0495635_0001451 | 3300046663 | Bacteria | 15860 |
| 396 | Ga0495635_0007651 | 3300046663 | Bacteria | 7537 |
| 397 | Ga0495659_0004469 | 3300046664 | Bacteria | 4405 |
| 398 | Ga0495661_0017969 | 3300046665 | Bacteria | 4660 |
| 399 | Ga0495588_0064304 | 3300046674 | Bacteria | 1903 |
| 400 | Ga0495657_0010506 | 3300046675 | Bacteria | 6965 |
| 401 | Ga0495599_0115489 | 3300046678 | Bacteria | 1670 |
| 402 | Ga0495623_0013784 | 3300046679 | Bacteria | 5240 |
| 403 | Ga0495623_0033174 | 3300046679 | Bacteria | 3313 |
| 404 | Ga0495646_0055862 | 3300046680 | Bacteria | 2368 |
| 405 | Ga0495658_0000057 | 3300046683 | Bacteria | 56081 |
| 406 | Ga0495669_0006988 | 3300046684 | Bacteria | 4726 |
| 407 | Ga0495613_0002697 | 3300046689 | Bacteria | 13325 |
| 408 | Ga0495613_0042904 | 3300046689 | Bacteria | 3345 |
| 409 | Ga0495670_0180051 | 3300046691 | Bacteria | 1116 |
| 410 | Ga0495600_0025215 | 3300046809 | Bacteria | 3831 |
| 411 | Ga0495600_0352495 | 3300046809 | Bacteria | 922 |
| 412 | Ga0495660_0003426 | 3300046810 | Bacteria | 9818 |
| 413 | Ga0495660_0014659 | 3300046810 | Bacteria | 4533 |
| 414 | Ga0495581_0000007 | 3300047315 | Bacteria | 67949 |
| 415 | Ga0495604_0000834 | 3300047317 | Bacteria | 25747 |
| 416 | Ga0495604_0014104 | 3300047317 | Bacteria | 6371 |
| 417 | Ga0495636_0036491 | 3300047318 | Bacteria | 2027 |
| 418 | Ga0495674_0029245 | 3300047319 | Bacteria | 5020 |
| 419 | Ga0495674_0035379 | 3300047319 | Bacteria | 4507 |
| 420 | Ga0495676_0159505 | 3300047321 | Bacteria | 1597 |
| 421 | Ga0495676_0167164 | 3300047321 | Bacteria | 1551 |
| 422 | Ga0495680_0012974 | 3300047322 | Bacteria | 7295 |
| 423 | Ga0495680_0025226 | 3300047322 | Bacteria | 4923 |
| 424 | Ga0495675_0016249 | 3300047444 | Bacteria | 4707 |
| 425 | Ga0495675_0019337 | 3300047444 | Bacteria | 4325 |
| 426 | Ga0495675_0060814 | 3300047444 | Bacteria | 2393 |
| 427 | Ga0495685_070498 | 3300047447 | Bacteria | 1171 |
| 428 | Ga0495685_120163 | 3300047447 | Bacteria | 863 |
| 429 | Ga0495681_0004664 | 3300047470 | Bacteria | 9291 |
| 430 | Ga0495681_0022872 | 3300047470 | Bacteria | 3334 |
| 431 | Ga0495684_0022700 | 3300047471 | Bacteria | 4826 |
| 432 | Ga0495684_0064187 | 3300047471 | Bacteria | 2790 |
| 433 | Ga0495686_0425048 | 3300047472 | Bacteria | 709 |
| 434 | Ga0495602_0036059 | 3300048088 | Bacteria | 4606 |
| 435 | Ga0495614_0048470 | 3300048089 | Bacteria | 1821 |
| 436 | Ga0495626_0000267 | 3300048091 | Bacteria | 58992 |
| 437 | Ga0496101_0131350 | 3300048904 | Bacteria | 1902 |
| 438 | Ga0496101_0213712 | 3300048904 | Bacteria | 1495 |
| 439 | Ga0496102_0011650 | 3300048905 | Bacteria | 7588 |
| 440 | Ga0496103_0006680 | 3300048906 | Bacteria | 6884 |
| 441 | Ga0496104_0054457 | 3300048907 | Bacteria | 3781 |
| 442 | Ga0496104_0140678 | 3300048907 | Bacteria | 2318 |
| 443 | Ga0496104_0457814 | 3300048907 | Bacteria | 1187 |
| 444 | Ga0496105_0025490 | 3300048908 | Bacteria | 4814 |
| 445 | Ga0496105_0119845 | 3300048908 | Bacteria | 2170 |
| 446 | Ga0496107_0187159 | 3300048910 | Bacteria | 1538 |
| 447 | Ga0496107_0385983 | 3300048910 | Bacteria | 1042 |
| 448 | Ga0496108_0350621 | 3300048911 | Bacteria | 1288 |
| 449 | Ga0496108_0628073 | 3300048911 | Bacteria | 935 |
| 450 | Ga0496109_0224892 | 3300048912 | Bacteria | 1765 |
| 451 | Ga0496110_0067955 | 3300048913 | Bacteria | 3154 |
| 452 | Ga0496110_0172103 | 3300048913 | Bacteria | 1965 |
| 453 | Ga0496110_0319209 | 3300048913 | Bacteria | 1415 |
| 454 | Ga0496111_0006048 | 3300048914 | Bacteria | 7820 |
| 455 | Ga0496112_0007764 | 3300048915 | Bacteria | 9544 |
| 456 | Ga0496112_0667391 | 3300048915 | Bacteria | 969 |
| 457 | Ga0496114_0053585 | 3300048917 | Bacteria | 3362 |
| 458 | Ga0496114_0100343 | 3300048917 | Bacteria | 2470 |
| 459 | Ga0496114_0108317 | 3300048917 | Bacteria | 2378 |
| 460 | Ga0496114_0124774 | 3300048917 | Bacteria | 2218 |
| 461 | Ga0496114_0207152 | 3300048917 | Bacteria | 1719 |
| 462 | Ga0496114_0682967 | 3300048917 | Bacteria | 901 |
| 463 | Ga0496115_0386796 | 3300048918 | Bacteria | 1137 |
| 464 | Ga0496117_0024021 | 3300048920 | Bacteria | 4837 |
| 465 | Ga0496118_0014701 | 3300048921 | Bacteria | 7313 |
| 466 | Ga0496120_0002693 | 3300048923 | Bacteria | 17433 |
| 467 | Ga0501306_001055 | 3300049127 | Bacteria | 2451 |
| 468 | Ga0501310_000580 | 3300049130 | Bacteria | 3210 |
| 469 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 470 | Ga0495678_140658 | 3300049459 | Bacteria | 790 |
| 471 | Ga0495682_0078456 | 3300049460 | Bacteria | 1188 |
| 472 | Ga0501311_001778 | 3300049527 | Bacteria | 1956 |
| 473 | Ga0501315_000655 | 3300049531 | Bacteria | 2533 |
| 474 | Ga0501315_006228 | 3300049531 | Bacteria | 1322 |
| 475 | Ga0501031_0043843 | 3300049568 | Bacteria | 2918 |
| 476 | Ga0501032_0228082 | 3300049569 | Bacteria | 1211 |
| 477 | Ga0501033_0124002 | 3300049570 | Bacteria | 1873 |
| 478 | Ga0501036_0086867 | 3300049572 | Bacteria | 2643 |
| 479 | Ga0501038_0081904 | 3300049574 | Bacteria | 2718 |
| 480 | Ga0501039_0018878 | 3300049575 | Bacteria | 5294 |
| 481 | Ga0501040_0017199 | 3300049576 | Bacteria | 4799 |
| 482 | Ga0501042_0257449 | 3300049578 | Bacteria | 1259 |
| 483 | Ga0501047_0515297 | 3300049581 | Bacteria | 1022 |
| 484 | Ga0501048_0147412 | 3300049582 | Bacteria | 1664 |
| 485 | Ga0501067_0081461 | 3300049583 | Bacteria | 1794 |
| 486 | Ga0501068_0072495 | 3300049584 | Bacteria | 2103 |
| 487 | Ga0501069_0317516 | 3300049585 | Bacteria | 915 |
| 488 | Ga0501070_0029135 | 3300049586 | Bacteria | 4630 |
| 489 | Ga0501071_0006292 | 3300049587 | Bacteria | 7704 |
| 490 | Ga0501072_0039929 | 3300049588 | Bacteria | 3684 |
| 491 | Ga0501075_0031277 | 3300049591 | Bacteria | 3949 |
| 492 | Ga0501076_0055369 | 3300049592 | Bacteria | 3145 |
| 493 | Ga0501077_0047277 | 3300049593 | Bacteria | 2734 |
| 494 | Ga0501216_037931 | 3300049660 | Bacteria | 912 |
| 495 | Ga0501227_002589 | 3300049665 | Bacteria | 3970 |
| 496 | Ga0501238_001798 | 3300049671 | Bacteria | 2498 |
| 497 | Ga0501079_0125998 | 3300049741 | Bacteria | 1992 |
| 498 | Ga0501080_0203794 | 3300049742 | Bacteria | 1815 |
| 499 | Ga0501081_0347039 | 3300049743 | Bacteria | 1093 |
| 500 | Ga0501083_0051045 | 3300049744 | Bacteria | 2782 |
| 501 | Ga0501279_001917 | 3300049775 | Bacteria | 2740 |
| 502 | Ga0501279_017062 | 3300049775 | Bacteria | 1015 |
| 503 | Ga0501035_0024558 | 3300049822 | Bacteria | 5527 |
| 504 | Ga0501044_0345679 | 3300049823 | Bacteria | 1408 |
| 505 | Ga0501045_0035555 | 3300049824 | Bacteria | 3617 |
| 506 | nmdc:mga00v17_7749_c1 | 3300050491 | Bacteria | 5753 |
| 507 | nmdc:mga0yw44_2105_c1 | 3300050492 | Bacteria | 8331 |
| 508 | nmdc:mga0yw44_230237_c1 | 3300050492 | Bacteria | 1230 |
| 509 | nmdc:mga0yw44_42147_c1 | 3300050492 | Bacteria | 2721 |
| 510 | nmdc:mga0yw44_7060_c1 | 3300050492 | Bacteria | 5497 |
| 511 | nmdc:mga06z11_106199_c1 | 3300050494 | Bacteria | 1548 |
| 512 | nmdc:mga07m45_2591_c1 | 3300050496 | Bacteria | 7827 |
| 513 | nmdc:mga09592_270402_c1 | 3300050508 | Bacteria | 1474 |
| 514 | nmdc:mga0qj67_306087_c1 | 3300050509 | Bacteria | 1287 |
| 515 | nmdc:mga06r32_67353_c1 | 3300050510 | Bacteria | 3456 |
| 516 | nmdc:mga08y16_200494_c1 | 3300050511 | Bacteria | 2068 |
| 517 | nmdc:mga08y16_715192_c1 | 3300050511 | Bacteria | 1000 |
| 518 | nmdc:mga0sz30_110914_c1 | 3300050516 | Bacteria | 1202 |
| 519 | Ga0495601_0034528 | 3300053077 | Bacteria | 3156 |
| 520 | Ga0495619_0024511 | 3300053085 | Bacteria | 3870 |
| 521 | Ga0500644_0000050 | 3300053088 | Bacteria | 71907 |
| 522 | Ga0500650_0032643 | 3300053098 | Bacteria | 2372 |
| 523 | Ga0500573_0027068 | 3300053140 | Bacteria | 3296 |
| 524 | Ga0500577_0009374 | 3300053142 | Bacteria | 2838 |
| 525 | Ga0500577_0035092 | 3300053142 | Bacteria | 1786 |
| 526 | Ga0500577_0092583 | 3300053142 | Bacteria | 1224 |
| 527 | Ga0501084_0215614 | 3300054114 | Bacteria | 1619 |
| 528 | Ga0590075_001853 | 3300059424 | Bacteria | 5139 |
| 529 | Ga0590077_006260 | 3300059426 | Bacteria | 2440 |
| 530 | Ga0501082_0093468 | 3300060353 | Bacteria | 2598 |
| 531 | Ga0530510_0016407 | 3300061734 | Bacteria | 5242 |
| 532 | Ga0530510_0239506 | 3300061734 | Bacteria | 1350 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003784 | Ga0055534_1011123 | Ga0055534_10111232 | 195 |
| 2 | 3300021361 | Ga0213872_10111713 | Ga0213872_101117132 | 197 |
| 3 | 3300039447 | Ga0436361_0181426 | Ga0436361_0181426_226_972 | 197 |
| 4 | 3300039447 | Ga0436361_0715182 | Ga0436361_0715182_93_839 | 197 |
| 5 | 3300046457 | Ga0495590_0008695 | Ga0495590_0008695_2370_3116 | 197 |
| 6 | 3300046506 | Ga0495583_0004868 | Ga0495583_0004868_2870_3616 | 197 |
| 7 | 3300046660 | Ga0495625_0001679 | Ga0495625_0001679_9186_9932 | 197 |
| 8 | 3300046664 | Ga0495659_0004469 | Ga0495659_0004469_948_1694 | 197 |
| 9 | 3300046665 | Ga0495661_0017969 | Ga0495661_0017969_1118_1864 | 197 |
| 10 | 3300046684 | Ga0495669_0006988 | Ga0495669_0006988_2320_3066 | 197 |
| 11 | 3300047318 | Ga0495636_0036491 | Ga0495636_0036491_462_1208 | 197 |
| 12 | 3300046453 | Ga0495627_000007 | Ga0495627_000007_417022_417780 | 198 |
| 13 | 3300047470 | Ga0495681_0022872 | Ga0495681_0022872_2346_3092 | 198 |
| 14 | 3300046538 | Ga0495609_0002949 | Ga0495609_0002949_3607_4371 | 199 |
| 15 | 3300046460 | Ga0495638_0061151 | Ga0495638_0061151_59_805 | 200 |
| 16 | 3300046501 | Ga0495607_0004150 | Ga0495607_0004150_5946_6692 | 200 |
| 17 | 3300046513 | Ga0495616_0058898 | Ga0495616_0058898_13_759 | 200 |
| 18 | 3300046525 | Ga0495663_0031250 | Ga0495663_0031250_525_1271 | 200 |
| 19 | 3300046538 | Ga0495609_0003102 | Ga0495609_0003102_5361_6107 | 200 |
| 20 | 3300046616 | Ga0495668_0026989 | Ga0495668_0026989_511_1257 | 200 |
| 21 | 3300046691 | Ga0495670_0180051 | Ga0495670_0180051_132_878 | 200 |
| 22 | 3300049459 | Ga0495678_140658 | Ga0495678_140658_13_759 | 200 |
| 23 | 3300049460 | Ga0495682_0078456 | Ga0495682_0078456_147_893 | 200 |
| 24 | 3300003374 | JGI25161J50226_1009399 | JGI25161J50226_10093992 | 202 |
| 25 | 3300046810 | Ga0495660_0003426 | Ga0495660_0003426_5777_6541 | 204 |
| 26 | 3300046810 | Ga0495660_0014659 | Ga0495660_0014659_3317_4081 | 204 |
| 27 | 3300037471 | Ga0395905_0618281 | Ga0395905_0618281_22_741 | 205 |
| 28 | 3300031548 | Ga0307408_100001210 | Ga0307408_1000012105 | 206 |
| 29 | 3300049130 | Ga0501310_000580 | Ga0501310_000580_1919_2665 | 206 |
| 30 | 3300002739 | JGI25158J39367_1001766 | JGI25158J39367_10017662 | 208 |
| 31 | 3300002774 | JGI25150J39212_1005125 | JGI25150J39212_10051253 | 208 |
| 32 | 3300003771 | Ga0055526_1005592 | Ga0055526_10055926 | 208 |
| 33 | 3300003773 | Ga0055537_1006604 | Ga0055537_10066042 | 208 |
| 34 | 3300003775 | Ga0055524_1006560 | Ga0055524_10065603 | 208 |
| 35 | 3300003775 | Ga0055524_1008881 | Ga0055524_10088814 | 208 |
| 36 | 3300003775 | Ga0055524_1016262 | Ga0055524_10162621 | 208 |
| 37 | 3300003784 | Ga0055534_1011642 | Ga0055534_10116423 | 208 |
| 38 | 3300003790 | Ga0055528_1002474 | Ga0055528_10024749 | 208 |
| 39 | 3300003794 | Ga0055531_10033093 | Ga0055531_100330932 | 208 |
| 40 | 3300025208 | Ga0209436_100291 | Ga0209436_10029132 | 208 |
| 41 | 3300025245 | Ga0207425_1001639 | Ga0207425_100163910 | 208 |
| 42 | 3300025258 | Ga0209129_1005030 | Ga0209129_10050303 | 208 |
| 43 | 3300025263 | Ga0209565_1000902 | Ga0209565_100090217 | 208 |
| 44 | 3300025263 | Ga0209565_1001159 | Ga0209565_10011592 | 208 |
| 45 | 3300025263 | Ga0209565_1009721 | Ga0209565_10097213 | 208 |
| 46 | 3300025273 | Ga0209673_1004849 | Ga0209673_10048493 | 208 |
| 47 | 3300025291 | Ga0209675_1000769 | Ga0209675_10007695 | 208 |
| 48 | 3300025291 | Ga0209675_1005996 | Ga0209675_10059967 | 208 |
| 49 | 3300025291 | Ga0209675_1009461 | Ga0209675_10094614 | 208 |
| 50 | 3300025295 | Ga0209564_1001707 | Ga0209564_100170715 | 208 |
| 51 | 3300025295 | Ga0209564_1003112 | Ga0209564_100311210 | 208 |
| 52 | 3300025297 | Ga0209758_1002044 | Ga0209758_100204425 | 208 |
| 53 | 3300025298 | Ga0209050_1000046 | Ga0209050_1000046106 | 208 |
| 54 | 3300025299 | Ga0209256_1002001 | Ga0209256_10020013 | 208 |
| 55 | 3300025299 | Ga0209256_1010975 | Ga0209256_10109754 | 208 |
| 56 | 3300025302 | Ga0207426_1002103 | Ga0207426_10021032 | 208 |
| 57 | 3300025304 | Ga0209257_1000068 | Ga0209257_1000068224 | 208 |
| 58 | 3300031548 | Ga0307408_100021297 | Ga0307408_1000212974 | 208 |
| 59 | 3300042532 | Ga0450893_0028985 | Ga0450893_0028985_164_910 | 208 |
| 60 | 3300049531 | Ga0501315_000655 | Ga0501315_000655_144_890 | 208 |
| 61 | 3300049775 | Ga0501279_017062 | Ga0501279_017062_186_938 | 208 |
| 62 | 3300031548 | Ga0307408_100628375 | Ga0307408_1006283751 | 209 |
| 63 | 3300032002 | Ga0307416_100020341 | Ga0307416_1000203414 | 209 |
| 64 | 3300002773 | JGI25152J39213_1003851 | JGI25152J39213_10038513 | 210 |
| 65 | 3300002774 | JGI25150J39212_1011438 | JGI25150J39212_10114382 | 210 |
| 66 | 3300003215 | JGI25153J46596_10008450 | JGI25153J46596_100084503 | 210 |
| 67 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011288 | 210 |
| 68 | 3300025245 | Ga0207425_1001467 | Ga0207425_100146710 | 210 |
| 69 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001465 | 210 |
| 70 | 3300025297 | Ga0209758_1000073 | Ga0209758_100007314 | 210 |
| 71 | 3300046523 | Ga0495644_0027912 | Ga0495644_0027912_863_1627 | 210 |
| 72 | 3300047470 | Ga0495681_0004664 | Ga0495681_0004664_4861_5625 | 210 |
| 73 | 3300049127 | Ga0501306_001055 | Ga0501306_001055_539_1285 | 210 |
| 74 | 3300049459 | Ga0495678_000004 | Ga0495678_000004_367348_368112 | 210 |
| 75 | 3300049527 | Ga0501311_001778 | Ga0501311_001778_1114_1860 | 210 |
| 76 | 3300049531 | Ga0501315_006228 | Ga0501315_006228_348_1094 | 210 |
| 77 | 3300049665 | Ga0501227_002589 | Ga0501227_002589_1525_2271 | 210 |
| 78 | 3300049775 | Ga0501279_001917 | Ga0501279_001917_1095_1841 | 210 |
| 79 | 3300003791 | Ga0055530_10008671 | Ga0055530_100086715 | 211 |
| 80 | 3300035086 | Ga0373934_0223708 | Ga0373934_0223708_72_743 | 211 |
| 81 | 3300035410 | Ga0373924_0125566 | Ga0373924_0125566_345_1037 | 211 |
| 82 | 3300035725 | Ga0373947_0000003 | Ga0373947_0000003_274961_275782 | 211 |
| 83 | 3300035171 | Ga0373946_0010767 | Ga0373946_0010767_933_1754 | 212 |
| 84 | 3300035692 | Ga0373935_0002124 | Ga0373935_0002124_903_1724 | 212 |
| 85 | 3300047472 | Ga0495686_0425048 | Ga0495686_0425048_46_699 | 212 |
| 86 | 3300003322 | rootL2_10103237 | rootL2_101032371 | 214 |
| 87 | 3300006881 | Ga0068865_100171162 | Ga0068865_1001711623 | 214 |
| 88 | 3300027907 | Ga0207428_10159418 | Ga0207428_101594181 | 214 |
| 89 | 3300042876 | Ga0451577_0010831 | Ga0451577_0010831_6517_7263 | 215 |
| 90 | 3300044712 | Ga0453684_0032889 | Ga0453684_0032889_5674_6420 | 215 |
| 91 | 3300003775 | Ga0055524_1000234 | Ga0055524_100023424 | 218 |
| 92 | 3300025263 | Ga0209565_1014062 | Ga0209565_10140623 | 218 |
| 93 | 3300025299 | Ga0209256_1000044 | Ga0209256_100004423 | 218 |
| 94 | 3300006038 | Ga0075365_10012036 | Ga0075365_100120363 | 220 |
| 95 | 3300037418 | Ga0395900_0286281 | Ga0395900_0286281_645_1400 | 220 |
| 96 | 3300050492 | nmdc:mga0yw44_7060_c1 | nmdc:mga0yw44_7060_c1_4517_5272 | 220 |
| 97 | 3300042012 | Ga0439455_0019950 | Ga0439455_0019950_524_1270 | 221 |
| 98 | 3300020082 | Ga0206353_11427395 | Ga0206353_114273952 | 222 |
| 99 | 3300027907 | Ga0207428_10206860 | Ga0207428_102068602 | 222 |
| 100 | 3300050511 | nmdc:mga08y16_200494_c1 | nmdc:mga08y16_200494_c1_1288_2034 | 222 |
| 101 | 3300001991 | JGI24743J22301_10011629 | JGI24743J22301_100116292 | 223 |
| 102 | 3300002070 | JGI24750J21931_1023946 | JGI24750J21931_10239461 | 223 |
| 103 | 3300003763 | Ga0055529_1000403 | Ga0055529_100040351 | 223 |
| 104 | 3300005329 | Ga0070683_100014373 | Ga0070683_1000143736 | 223 |
| 105 | 3300005338 | Ga0068868_100223154 | Ga0068868_1002231542 | 223 |
| 106 | 3300005343 | Ga0070687_100109015 | Ga0070687_1001090151 | 223 |
| 107 | 3300005344 | Ga0070661_100198773 | Ga0070661_1001987731 | 223 |
| 108 | 3300005347 | Ga0070668_100503163 | Ga0070668_1005031631 | 223 |
| 109 | 3300005353 | Ga0070669_100208607 | Ga0070669_1002086072 | 223 |
| 110 | 3300005356 | Ga0070674_100194342 | Ga0070674_1001943421 | 223 |
| 111 | 3300005366 | Ga0070659_100130848 | Ga0070659_1001308482 | 223 |
| 112 | 3300005459 | Ga0068867_100240219 | Ga0068867_1002402192 | 223 |
| 113 | 3300005466 | Ga0070685_10039955 | Ga0070685_100399553 | 223 |
| 114 | 3300005543 | Ga0070672_100028650 | Ga0070672_1000286503 | 223 |
| 115 | 3300005615 | Ga0070702_100009006 | Ga0070702_1000090062 | 223 |
| 116 | 3300005616 | Ga0068852_100066930 | Ga0068852_1000669303 | 223 |
| 117 | 3300005718 | Ga0068866_10004804 | Ga0068866_100048045 | 223 |
| 118 | 3300005719 | Ga0068861_100067139 | Ga0068861_1000671392 | 223 |
| 119 | 3300005840 | Ga0068870_10004500 | Ga0068870_100045006 | 223 |
| 120 | 3300006237 | Ga0097621_100256897 | Ga0097621_1002568972 | 223 |
| 121 | 3300006881 | Ga0068865_100025194 | Ga0068865_1000251943 | 223 |
| 122 | 3300009094 | Ga0111539_10231013 | Ga0111539_102310132 | 223 |
| 123 | 3300009148 | Ga0105243_10084645 | Ga0105243_100846451 | 223 |
| 124 | 3300009553 | Ga0105249_10061179 | Ga0105249_100611794 | 223 |
| 125 | 3300010375 | Ga0105239_10151901 | Ga0105239_101519011 | 223 |
| 126 | 3300013307 | Ga0157372_10259217 | Ga0157372_102592172 | 223 |
| 127 | 3300013308 | Ga0157375_10273672 | Ga0157375_102736722 | 223 |
| 128 | 3300014326 | Ga0157380_10019890 | Ga0157380_100198902 | 223 |
| 129 | 3300025272 | Ga0209455_1000037 | Ga0209455_1000037343 | 223 |
| 130 | 3300025901 | Ga0207688_10003187 | Ga0207688_100031876 | 223 |
| 131 | 3300025908 | Ga0207643_10007047 | Ga0207643_100070476 | 223 |
| 132 | 3300025918 | Ga0207662_10107878 | Ga0207662_101078782 | 223 |
| 133 | 3300025919 | Ga0207657_10063062 | Ga0207657_100630623 | 223 |
| 134 | 3300025927 | Ga0207687_10075707 | Ga0207687_100757072 | 223 |
| 135 | 3300025932 | Ga0207690_10032879 | Ga0207690_100328792 | 223 |
| 136 | 3300025935 | Ga0207709_10107392 | Ga0207709_101073922 | 223 |
| 137 | 3300025938 | Ga0207704_10031843 | Ga0207704_100318434 | 223 |
| 138 | 3300025944 | Ga0207661_10199282 | Ga0207661_101992822 | 223 |
| 139 | 3300025960 | Ga0207651_10068255 | Ga0207651_100682552 | 223 |
| 140 | 3300025961 | Ga0207712_10092846 | Ga0207712_100928461 | 223 |
| 141 | 3300026075 | Ga0207708_10000589 | Ga0207708_1000058919 | 223 |
| 142 | 3300026089 | Ga0207648_10013560 | Ga0207648_100135607 | 223 |
| 143 | 3300026118 | Ga0207675_100017896 | Ga0207675_1000178963 | 223 |
| 144 | 3300048912 | Ga0496109_0224892 | Ga0496109_0224892_148_903 | 223 |
| 145 | 3300048913 | Ga0496110_0067955 | Ga0496110_0067955_972_1727 | 223 |
| 146 | 3300048917 | Ga0496114_0108317 | Ga0496114_0108317_989_1744 | 223 |
| 147 | 3300061734 | Ga0530510_0239506 | Ga0530510_0239506_557_1312 | 223 |
| 148 | 3300005467 | Ga0070706_100016881 | Ga0070706_1000168812 | 224 |
| 149 | 3300005468 | Ga0070707_100003448 | Ga0070707_1000034486 | 224 |
| 150 | 3300005471 | Ga0070698_100077837 | Ga0070698_1000778373 | 224 |
| 151 | 3300005518 | Ga0070699_100000298 | Ga0070699_10000029841 | 224 |
| 152 | 3300006844 | Ga0075428_100101410 | Ga0075428_1001014103 | 224 |
| 153 | 3300021361 | Ga0213872_10000263 | Ga0213872_1000026339 | 224 |
| 154 | 3300025922 | Ga0207646_10000520 | Ga0207646_100005206 | 224 |
| 155 | 3300027666 | Ga0209282_1000001 | Ga0209282_1000001297 | 224 |
| 156 | 3300039447 | Ga0436361_0080172 | Ga0436361_0080172_38364_39110 | 224 |
| 157 | 3300046507 | Ga0495606_0004181 | Ga0495606_0004181_7483_8244 | 224 |
| 158 | 3300046616 | Ga0495668_0000173 | Ga0495668_0000173_50206_50967 | 224 |
| 159 | 3300046660 | Ga0495625_0001016 | Ga0495625_0001016_15585_16346 | 224 |
| 160 | 3300048091 | Ga0495626_0000267 | Ga0495626_0000267_53470_54231 | 224 |
| 161 | 3300049671 | Ga0501238_001798 | Ga0501238_001798_1064_1810 | 224 |
| 162 | 3300050508 | nmdc:mga09592_270402_c1 | nmdc:mga09592_270402_c1_88_852 | 224 |
| 163 | 3300050509 | nmdc:mga0qj67_306087_c1 | nmdc:mga0qj67_306087_c1_510_1274 | 224 |
| 164 | 3300026089 | Ga0207648_10402734 | Ga0207648_104027341 | 225 |
| 165 | 3300048917 | Ga0496114_0100343 | Ga0496114_0100343_649_1407 | 227 |
| 166 | 3300025944 | Ga0207661_10036828 | Ga0207661_100368285 | 228 |
| 167 | 3300046454 | Ga0495592_0024366 | Ga0495592_0024366_2569_3327 | 228 |
| 168 | 3300046476 | Ga0495662_0001123 | Ga0495662_0001123_5095_5853 | 228 |
| 169 | 3300046516 | Ga0495628_0090078 | Ga0495628_0090078_1114_1872 | 228 |
| 170 | 3300046517 | Ga0495630_0158389 | Ga0495630_0158389_864_1622 | 228 |
| 171 | 3300046529 | Ga0495652_0050203 | Ga0495652_0050203_369_1127 | 228 |
| 172 | 3300046533 | Ga0495640_0020229 | Ga0495640_0020229_3641_4399 | 228 |
| 173 | 3300046536 | Ga0495587_0213049 | Ga0495587_0213049_231_989 | 228 |
| 174 | 3300046642 | Ga0495634_0016004 | Ga0495634_0016004_1111_1869 | 228 |
| 175 | 3300046679 | Ga0495623_0033174 | Ga0495623_0033174_497_1255 | 228 |
| 176 | 3300046680 | Ga0495646_0055862 | Ga0495646_0055862_1242_2000 | 228 |
| 177 | 3300046689 | Ga0495613_0042904 | Ga0495613_0042904_1778_2536 | 228 |
| 178 | 3300047317 | Ga0495604_0000834 | Ga0495604_0000834_9343_10101 | 228 |
| 179 | 3300047471 | Ga0495684_0064187 | Ga0495684_0064187_2013_2771 | 228 |
| 180 | 3300049586 | Ga0501070_0029135 | Ga0501070_0029135_1316_2071 | 228 |
| 181 | 3300053077 | Ga0495601_0034528 | Ga0495601_0034528_1997_2755 | 228 |
| 182 | 3300053140 | Ga0500573_0027068 | Ga0500573_0027068_2430_3188 | 228 |
| 183 | 3300044656 | Ga0466969_0086919 | Ga0466969_0086919_520_1275 | 229 |
| 184 | 3300044684 | Ga0466966_0096362 | Ga0466966_0096362_318_1073 | 229 |
| 185 | 3300044694 | Ga0466963_0388672 | Ga0466963_0388672_162_917 | 229 |
| 186 | 3300044719 | Ga0466971_0023125 | Ga0466971_0023125_581_1336 | 229 |
| 187 | 3300045049 | Ga0466959_0069963 | Ga0466959_0069963_1324_2079 | 229 |
| 188 | 3300045836 | Ga0466958_0087969 | Ga0466958_0087969_194_949 | 229 |
| 189 | 3300053098 | Ga0500650_0032643 | Ga0500650_0032643_755_1522 | 229 |
| 190 | 3300053142 | Ga0500577_0035092 | Ga0500577_0035092_189_956 | 229 |
| 191 | 3300046809 | Ga0495600_0352495 | Ga0495600_0352495_52_807 | 230 |
| 192 | 3300005347 | Ga0070668_100130364 | Ga0070668_1001303642 | 231 |
| 193 | 3300005615 | Ga0070702_100008749 | Ga0070702_1000087492 | 231 |
| 194 | 3300006881 | Ga0068865_100439834 | Ga0068865_1004398341 | 231 |
| 195 | 3300009148 | Ga0105243_10033259 | Ga0105243_100332591 | 231 |
| 196 | 3300009551 | Ga0105238_10606292 | Ga0105238_106062921 | 231 |
| 197 | 3300009553 | Ga0105249_10117819 | Ga0105249_101178192 | 231 |
| 198 | 3300013297 | Ga0157378_10023032 | Ga0157378_100230321 | 231 |
| 199 | 3300013308 | Ga0157375_10041467 | Ga0157375_100414672 | 231 |
| 200 | 3300014326 | Ga0157380_10323137 | Ga0157380_103231372 | 231 |
| 201 | 3300017792 | Ga0163161_10100949 | Ga0163161_101009491 | 231 |
| 202 | 3300025899 | Ga0207642_10013933 | Ga0207642_100139332 | 231 |
| 203 | 3300025924 | Ga0207694_10419684 | Ga0207694_104196842 | 231 |
| 204 | 3300025935 | Ga0207709_10054871 | Ga0207709_100548711 | 231 |
| 205 | 3300025972 | Ga0207668_10073671 | Ga0207668_100736712 | 231 |
| 206 | 3300026118 | Ga0207675_100591083 | Ga0207675_1005910831 | 231 |
| 207 | 3300026142 | Ga0207698_10906986 | Ga0207698_109069861 | 231 |
| 208 | 3300048915 | Ga0496112_0667391 | Ga0496112_0667391_240_938 | 231 |
| 209 | 3300005616 | Ga0068852_100785124 | Ga0068852_1007851241 | 233 |
| 210 | 3300048910 | Ga0496107_0385983 | Ga0496107_0385983_131_883 | 233 |
| 211 | 3300005337 | Ga0070682_100018971 | Ga0070682_1000189714 | 234 |
| 212 | 3300005365 | Ga0070688_100271507 | Ga0070688_1002715071 | 234 |
| 213 | 3300005438 | Ga0070701_10047723 | Ga0070701_100477233 | 234 |
| 214 | 3300005441 | Ga0070700_100022720 | Ga0070700_1000227203 | 234 |
| 215 | 3300005618 | Ga0068864_100096470 | Ga0068864_1000964702 | 234 |
| 216 | 3300025924 | Ga0207694_10093762 | Ga0207694_100937623 | 234 |
| 217 | 3300026095 | Ga0207676_10249445 | Ga0207676_102494452 | 234 |
| 218 | 3300026142 | Ga0207698_10101581 | Ga0207698_101015813 | 234 |
| 219 | 3300048904 | Ga0496101_0213712 | Ga0496101_0213712_453_1208 | 234 |
| 220 | 3300048917 | Ga0496114_0207152 | Ga0496114_0207152_944_1699 | 234 |
| 221 | 3300006177 | Ga0075362_10128102 | Ga0075362_101281021 | 235 |
| 222 | 3300045976 | Ga0466967_0488696 | Ga0466967_0488696_24_779 | 235 |
| 223 | 3300048917 | Ga0496114_0124774 | Ga0496114_0124774_52_810 | 235 |
| 224 | 3300049585 | Ga0501069_0317516 | Ga0501069_0317516_67_822 | 235 |
| 225 | 3300053088 | Ga0500644_0000050 | Ga0500644_0000050_60417_61151 | 235 |
| 226 | 3300009098 | Ga0105245_10036539 | Ga0105245_100365393 | 236 |
| 227 | 3300020082 | Ga0206353_11163641 | Ga0206353_111636412 | 236 |
| 228 | 3300047319 | Ga0495674_0035379 | Ga0495674_0035379_1449_2222 | 236 |
| 229 | 3300050511 | nmdc:mga08y16_715192_c1 | nmdc:mga08y16_715192_c1_12_767 | 236 |
| 230 | 3300053085 | Ga0495619_0024511 | Ga0495619_0024511_49_822 | 236 |
| 231 | 3300048905 | Ga0496102_0011650 | Ga0496102_0011650_2935_3669 | 237 |
| 232 | 3300048906 | Ga0496103_0006680 | Ga0496103_0006680_4446_5180 | 237 |
| 233 | 3300048907 | Ga0496104_0054457 | Ga0496104_0054457_510_1268 | 237 |
| 234 | 3300048915 | Ga0496112_0007764 | Ga0496112_0007764_8743_9501 | 237 |
| 235 | 3300005535 | Ga0070684_100020890 | Ga0070684_1000208905 | 238 |
| 236 | 3300005539 | Ga0068853_100043128 | Ga0068853_1000431284 | 238 |
| 237 | 3300009551 | Ga0105238_10037915 | Ga0105238_100379154 | 238 |
| 238 | 3300025940 | Ga0207691_10015968 | Ga0207691_100159684 | 238 |
| 239 | 3300025941 | Ga0207711_10365708 | Ga0207711_103657082 | 238 |
| 240 | 3300035724 | Ga0373933_0175706 | Ga0373933_0175706_28_780 | 238 |
| 241 | 3300036401 | Ga0373937_0138239 | Ga0373937_0138239_1210_1962 | 238 |
| 242 | 3300045976 | Ga0466967_0135634 | Ga0466967_0135634_417_1172 | 238 |
| 243 | 3300047447 | Ga0495685_120163 | Ga0495685_120163_54_812 | 238 |
| 244 | 3300048910 | Ga0496107_0187159 | Ga0496107_0187159_339_1094 | 238 |
| 245 | iso_pu_bacteria | 2643221554 | 2643786923 | 238 |
| 246 | iso_pu_bacteria | 2643221638 | 2644215988 | 238 |
| 247 | iso_pu_bacteria | 2857553236 | 2857554480 | 238 |
| 248 | 3300002075 | JGI24738J21930_10033544 | JGI24738J21930_100335442 | 239 |
| 249 | 3300032133 | Ga0316583_10015566 | Ga0316583_100155663 | 239 |
| 250 | 3300009551 | Ga0105238_10000079 | Ga0105238_1000007978 | 240 |
| 251 | 3300025924 | Ga0207694_10001799 | Ga0207694_100017998 | 240 |
| 252 | 3300031251 | Ga0265327_10004040 | Ga0265327_100040404 | 240 |
| 253 | 3300031901 | Ga0307406_10445333 | Ga0307406_104453331 | 240 |
| 254 | 3300048907 | Ga0496104_0457814 | Ga0496104_0457814_181_951 | 240 |
| 255 | 3300048918 | Ga0496115_0386796 | Ga0496115_0386796_287_1057 | 240 |
| 256 | 3300049581 | Ga0501047_0515297 | Ga0501047_0515297_106_861 | 240 |
| 257 | iso_pu_bacteria | 2885270888 | 2885271109 | 240 |
| 258 | 3300001915 | JGI24741J21665_1000010 | JGI24741J21665_100001024 | 241 |
| 259 | 3300003752 | Ga0055539_1000034 | Ga0055539_1000034141 | 241 |
| 260 | 3300003756 | Ga0055533_1006415 | Ga0055533_10064151 | 241 |
| 261 | 3300003759 | Ga0055525_1000538 | Ga0055525_100053816 | 241 |
| 262 | 3300006844 | Ga0075428_100000043 | Ga0075428_10000004391 | 241 |
| 263 | 3300025224 | Ga0209784_100003 | Ga0209784_100003442 | 241 |
| 264 | 3300025224 | Ga0209784_100293 | Ga0209784_10029322 | 241 |
| 265 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021485 | 241 |
| 266 | 3300025226 | Ga0209674_100008 | Ga0209674_100008704 | 241 |
| 267 | 3300025230 | Ga0209563_100004 | Ga0209563_100004898 | 241 |
| 268 | 3300025253 | Ga0209677_100009 | Ga0209677_100009734 | 241 |
| 269 | 3300025904 | Ga0207647_10127528 | Ga0207647_101275283 | 241 |
| 270 | 3300031824 | Ga0307413_10253647 | Ga0307413_102536472 | 241 |
| 271 | 3300044901 | Ga0466960_0260535 | Ga0466960_0260535_36_803 | 241 |
| 272 | 3300046459 | Ga0495629_0000012 | Ga0495629_0000012_211067_211813 | 241 |
| 273 | 3300046473 | Ga0495582_0021655 | Ga0495582_0021655_466_1212 | 241 |
| 274 | 3300046475 | Ga0495639_0026775 | Ga0495639_0026775_629_1375 | 241 |
| 275 | 3300046499 | Ga0495594_0004998 | Ga0495594_0004998_4185_4931 | 241 |
| 276 | 3300046642 | Ga0495634_0035279 | Ga0495634_0035279_1833_2579 | 241 |
| 277 | 3300046663 | Ga0495635_0001451 | Ga0495635_0001451_846_1592 | 241 |
| 278 | 3300046683 | Ga0495658_0000057 | Ga0495658_0000057_43926_44672 | 241 |
| 279 | 3300046689 | Ga0495613_0002697 | Ga0495613_0002697_1403_2149 | 241 |
| 280 | 3300047315 | Ga0495581_0000007 | Ga0495581_0000007_53652_54398 | 241 |
| 281 | 3300047321 | Ga0495676_0159505 | Ga0495676_0159505_140_886 | 241 |
| 282 | 3300047322 | Ga0495680_0025226 | Ga0495680_0025226_2863_3609 | 241 |
| 283 | 3300048089 | Ga0495614_0048470 | Ga0495614_0048470_302_1048 | 241 |
| 284 | 3300035172 | Ga0373955_0300068 | Ga0373955_0300068_226_957 | 243 |
| 285 | 3300044842 | Ga0466957_0113013 | Ga0466957_0113013_621_1382 | 243 |
| 286 | 3300045836 | Ga0466958_0011513 | Ga0466958_0011513_2298_3053 | 243 |
| 287 | 3300045836 | Ga0466958_0077113 | Ga0466958_0077113_1221_1982 | 243 |
| 288 | 3300048914 | Ga0496111_0006048 | Ga0496111_0006048_2456_3187 | 243 |
| 289 | 3300048920 | Ga0496117_0024021 | Ga0496117_0024021_1695_2429 | 243 |
| 290 | 3300048921 | Ga0496118_0014701 | Ga0496118_0014701_3784_4518 | 243 |
| 291 | 3300006042 | Ga0075368_10004447 | Ga0075368_100044472 | 244 |
| 292 | 3300006048 | Ga0075363_100039933 | Ga0075363_1000399333 | 244 |
| 293 | 3300006051 | Ga0075364_10015616 | Ga0075364_100156167 | 244 |
| 294 | 3300025302 | Ga0207426_1003407 | Ga0207426_10034074 | 244 |
| 295 | 3300031824 | Ga0307413_10532512 | Ga0307413_105325121 | 244 |
| 296 | 3300032002 | Ga0307416_100014685 | Ga0307416_1000146857 | 244 |
| 297 | 3300047444 | Ga0495675_0016249 | Ga0495675_0016249_181_930 | 244 |
| 298 | 3300049660 | Ga0501216_037931 | Ga0501216_037931_69_803 | 244 |
| 299 | 3300037068 | Ga0373925_0304351 | Ga0373925_0304351_411_1244 | 245 |
| 300 | 3300046459 | Ga0495629_0067480 | Ga0495629_0067480_775_1608 | 245 |
| 301 | 3300005718 | Ga0068866_10029454 | Ga0068866_100294542 | 246 |
| 302 | iso_pu_bacteria | 2551306166 | 2552113964 | 246 |
| 303 | iso_pu_bacteria | 2643221692 | 2644512161 | 246 |
| 304 | iso_pu_bacteria | 8001781756 | 8001785422 | 246 |
| 305 | 3300005985 | Ga0081539_10005489 | Ga0081539_1000548912 | 247 |
| 306 | 3300053142 | Ga0500577_0009374 | Ga0500577_0009374_128_883 | 247 |
| 307 | iso_pu_bacteria | 2551306166 | 2552113984 | 247 |
| 308 | 3300005347 | Ga0070668_100004901 | Ga0070668_1000049016 | 248 |
| 309 | 3300009098 | Ga0105245_10371493 | Ga0105245_103714932 | 248 |
| 310 | 3300025972 | Ga0207668_10008120 | Ga0207668_100081203 | 248 |
| 311 | 3300025986 | Ga0207658_10050613 | Ga0207658_100506133 | 248 |
| 312 | 3300028381 | Ga0268264_10278872 | Ga0268264_102788722 | 248 |
| 313 | 3300037466 | Ga0395898_0196859 | Ga0395898_0196859_823_1572 | 248 |
| 314 | 3300038443 | Ga0395901_0248924 | Ga0395901_0248924_1035_1790 | 248 |
| 315 | 3300045976 | Ga0466967_0144720 | Ga0466967_0144720_1291_2052 | 248 |
| 316 | 3300049583 | Ga0501067_0081461 | Ga0501067_0081461_295_1047 | 248 |
| 317 | 3300053142 | Ga0500577_0092583 | Ga0500577_0092583_110_880 | 248 |
| 318 | iso_pu_bacteria | 2501939600 | 2501941593 | 248 |
| 319 | iso_pu_bacteria | 2643221601 | 2644019523 | 248 |
| 320 | iso_pu_bacteria | 2643221631 | 2644180590 | 248 |
| 321 | iso_pu_bacteria | 2738543010 | 2739232751 | 248 |
| 322 | iso_pu_bacteria | 2808606360 | 2808849892 | 248 |
| 323 | iso_pu_bacteria | 2808606371 | 2808899010 | 248 |
| 324 | iso_pu_bacteria | 2811994871 | 2812319649 | 248 |
| 325 | iso_pu_bacteria | 2818991472 | 2819739170 | 248 |
| 326 | iso_pu_bacteria | 2856741275 | 2856742713 | 248 |
| 327 | iso_pu_bacteria | 2891562705 | 2891565010 | 248 |
| 328 | iso_pu_bacteria | 2995463766 | 2995468117 | 248 |
| 329 | iso_pu_bacteria | 649633069 | 649816049 | 248 |
| 330 | iso_pu_bacteria | 8003856774 | 8003861676 | 248 |
| 331 | iso_pu_bacteria | 8055157932 | 8055159749 | 248 |
| 332 | 3300009551 | Ga0105238_10322401 | Ga0105238_103224012 | 249 |
| 333 | 3300010375 | Ga0105239_10050416 | Ga0105239_100504167 | 249 |
| 334 | 3300013307 | Ga0157372_10087937 | Ga0157372_100879374 | 249 |
| 335 | 3300020082 | Ga0206353_10256792 | Ga0206353_102567922 | 249 |
| 336 | 3300025939 | Ga0207665_10021790 | Ga0207665_100217905 | 249 |
| 337 | 3300026067 | Ga0207678_10095644 | Ga0207678_100956443 | 249 |
| 338 | 3300032002 | Ga0307416_100683726 | Ga0307416_1006837262 | 249 |
| 339 | 3300032005 | Ga0307411_10608273 | Ga0307411_106082731 | 249 |
| 340 | 3300032126 | Ga0307415_100009535 | Ga0307415_1000095353 | 249 |
| 341 | 3300034818 | Ga0373950_0005439 | Ga0373950_0005439_620_1384 | 249 |
| 342 | 3300035088 | Ga0373940_0009630 | Ga0373940_0009630_740_1504 | 249 |
| 343 | 3300035207 | Ga0373942_0000328 | Ga0373942_0000328_11126_11890 | 249 |
| 344 | 3300038443 | Ga0395901_0850247 | Ga0395901_0850247_130_885 | 249 |
| 345 | 3300044656 | Ga0466969_0010424 | Ga0466969_0010424_1257_2006 | 249 |
| 346 | 3300044693 | Ga0466961_0122029 | Ga0466961_0122029_292_1041 | 249 |
| 347 | 3300044765 | Ga0466970_0006879 | Ga0466970_0006879_49_798 | 249 |
| 348 | 3300044842 | Ga0466957_0450243 | Ga0466957_0450243_14_769 | 249 |
| 349 | 3300045976 | Ga0466967_0313568 | Ga0466967_0313568_591_1346 | 249 |
| 350 | 3300049568 | Ga0501031_0043843 | Ga0501031_0043843_1712_2467 | 249 |
| 351 | 3300049569 | Ga0501032_0228082 | Ga0501032_0228082_97_852 | 249 |
| 352 | 3300049570 | Ga0501033_0124002 | Ga0501033_0124002_85_840 | 249 |
| 353 | 3300049572 | Ga0501036_0086867 | Ga0501036_0086867_379_1134 | 249 |
| 354 | 3300049574 | Ga0501038_0081904 | Ga0501038_0081904_1569_2324 | 249 |
| 355 | 3300049575 | Ga0501039_0018878 | Ga0501039_0018878_4272_5027 | 249 |
| 356 | 3300049576 | Ga0501040_0017199 | Ga0501040_0017199_260_1015 | 249 |
| 357 | 3300049578 | Ga0501042_0257449 | Ga0501042_0257449_430_1185 | 249 |
| 358 | 3300049582 | Ga0501048_0147412 | Ga0501048_0147412_477_1232 | 249 |
| 359 | 3300049584 | Ga0501068_0072495 | Ga0501068_0072495_839_1594 | 249 |
| 360 | 3300049587 | Ga0501071_0006292 | Ga0501071_0006292_571_1326 | 249 |
| 361 | 3300049588 | Ga0501072_0039929 | Ga0501072_0039929_1198_1953 | 249 |
| 362 | 3300049591 | Ga0501075_0031277 | Ga0501075_0031277_201_956 | 249 |
| 363 | 3300049592 | Ga0501076_0055369 | Ga0501076_0055369_574_1329 | 249 |
| 364 | 3300049593 | Ga0501077_0047277 | Ga0501077_0047277_660_1415 | 249 |
| 365 | 3300049741 | Ga0501079_0125998 | Ga0501079_0125998_1170_1925 | 249 |
| 366 | 3300049742 | Ga0501080_0203794 | Ga0501080_0203794_369_1124 | 249 |
| 367 | 3300049743 | Ga0501081_0347039 | Ga0501081_0347039_38_793 | 249 |
| 368 | 3300049744 | Ga0501083_0051045 | Ga0501083_0051045_432_1187 | 249 |
| 369 | 3300049822 | Ga0501035_0024558 | Ga0501035_0024558_477_1232 | 249 |
| 370 | 3300049823 | Ga0501044_0345679 | Ga0501044_0345679_538_1293 | 249 |
| 371 | 3300049824 | Ga0501045_0035555 | Ga0501045_0035555_2468_3223 | 249 |
| 372 | 3300054114 | Ga0501084_0215614 | Ga0501084_0215614_29_784 | 249 |
| 373 | 3300060353 | Ga0501082_0093468 | Ga0501082_0093468_731_1486 | 249 |
| 374 | 3300061734 | Ga0530510_0016407 | Ga0530510_0016407_2737_3492 | 249 |
| 375 | iso_pu_bacteria | 2643221576 | 2643889919 | 249 |
| 376 | iso_pu_bacteria | 2643221590 | 2643958975 | 249 |
| 377 | iso_pu_bacteria | 2643221604 | 2644033872 | 249 |
| 378 | iso_pu_bacteria | 2643221617 | 2644102618 | 249 |
| 379 | iso_pu_bacteria | 2643221620 | 2644118280 | 249 |
| 380 | iso_pu_bacteria | 2811994874 | 2812331707 | 249 |
| 381 | iso_pu_bacteria | 2862574272 | 2862575323 | 249 |
| 382 | iso_pu_bacteria | 2887478801 | 2887480904 | 249 |
| 383 | iso_pu_bacteria | 3006826541 | 3006826896 | 249 |
| 384 | iso_pu_bacteria | 8022893055 | 8022894106 | 249 |
| 385 | 3300005366 | Ga0070659_100074720 | Ga0070659_1000747202 | 250 |
| 386 | 3300005445 | Ga0070708_100031336 | Ga0070708_1000313364 | 250 |
| 387 | 3300005467 | Ga0070706_100004098 | Ga0070706_1000040988 | 250 |
| 388 | 3300005471 | Ga0070698_100089243 | Ga0070698_1000892432 | 250 |
| 389 | 3300005983 | Ga0081540_1088150 | Ga0081540_10881501 | 250 |
| 390 | 3300006844 | Ga0075428_100184363 | Ga0075428_1001843632 | 250 |
| 391 | 3300013105 | Ga0157369_10272408 | Ga0157369_102724082 | 250 |
| 392 | 3300014745 | Ga0157377_10399380 | Ga0157377_103993801 | 250 |
| 393 | 3300014969 | Ga0157376_10606287 | Ga0157376_106062872 | 250 |
| 394 | 3300025904 | Ga0207647_10016687 | Ga0207647_100166876 | 250 |
| 395 | 3300025919 | Ga0207657_10060954 | Ga0207657_100609546 | 250 |
| 396 | 3300025922 | Ga0207646_10171736 | Ga0207646_101717363 | 250 |
| 397 | 3300025944 | Ga0207661_10313984 | Ga0207661_103139843 | 250 |
| 398 | 3300031852 | Ga0307410_10049971 | Ga0307410_100499712 | 250 |
| 399 | 3300031901 | Ga0307406_10081331 | Ga0307406_100813313 | 250 |
| 400 | 3300031995 | Ga0307409_100016843 | Ga0307409_1000168434 | 250 |
| 401 | 3300032002 | Ga0307416_100404222 | Ga0307416_1004042221 | 250 |
| 402 | 3300035117 | Ga0373953_0011082 | Ga0373953_0011082_328_1080 | 250 |
| 403 | 3300035118 | Ga0373954_0062890 | Ga0373954_0062890_601_1353 | 250 |
| 404 | 3300035119 | Ga0373956_0006754 | Ga0373956_0006754_2199_2951 | 250 |
| 405 | 3300035170 | Ga0373943_0147097 | Ga0373943_0147097_76_828 | 250 |
| 406 | 3300035172 | Ga0373955_0024911 | Ga0373955_0024911_1047_1799 | 250 |
| 407 | 3300035692 | Ga0373935_0022512 | Ga0373935_0022512_851_1603 | 250 |
| 408 | 3300035724 | Ga0373933_0008466 | Ga0373933_0008466_2271_3023 | 250 |
| 409 | 3300036401 | Ga0373937_0542575 | Ga0373937_0542575_266_1018 | 250 |
| 410 | 3300037068 | Ga0373925_0387683 | Ga0373925_0387683_82_834 | 250 |
| 411 | 3300042006 | Ga0439432_069941 | Ga0439432_069941_112_870 | 250 |
| 412 | 3300042007 | Ga0439449_0005087 | Ga0439449_0005087_1029_1787 | 250 |
| 413 | 3300044656 | Ga0466969_0009652 | Ga0466969_0009652_1039_1797 | 250 |
| 414 | 3300044656 | Ga0466969_0070638 | Ga0466969_0070638_431_1189 | 250 |
| 415 | 3300044658 | Ga0466972_0047727 | Ga0466972_0047727_108_869 | 250 |
| 416 | 3300044683 | Ga0466965_0048033 | Ga0466965_0048033_1158_1919 | 250 |
| 417 | 3300044684 | Ga0466966_0001445 | Ga0466966_0001445_3081_3839 | 250 |
| 418 | 3300044693 | Ga0466961_0064476 | Ga0466961_0064476_1191_1949 | 250 |
| 419 | 3300044765 | Ga0466970_0026432 | Ga0466970_0026432_988_1749 | 250 |
| 420 | 3300044901 | Ga0466960_0035516 | Ga0466960_0035516_1085_1846 | 250 |
| 421 | 3300045049 | Ga0466959_0062467 | Ga0466959_0062467_592_1350 | 250 |
| 422 | 3300046461 | Ga0495641_0111554 | Ga0495641_0111554_95_847 | 250 |
| 423 | 3300046462 | Ga0495651_0003407 | Ga0495651_0003407_8635_9387 | 250 |
| 424 | 3300046463 | Ga0495653_0058177 | Ga0495653_0058177_1804_2556 | 250 |
| 425 | 3300046511 | Ga0495608_0002781 | Ga0495608_0002781_4790_5548 | 250 |
| 426 | 3300046511 | Ga0495608_0020655 | Ga0495608_0020655_1532_2284 | 250 |
| 427 | 3300046535 | Ga0495586_0241308 | Ga0495586_0241308_146_904 | 250 |
| 428 | 3300046543 | Ga0495645_0044434 | Ga0495645_0044434_672_1430 | 250 |
| 429 | 3300046559 | Ga0495667_0010954 | Ga0495667_0010954_4093_4845 | 250 |
| 430 | 3300046663 | Ga0495635_0007651 | Ga0495635_0007651_235_987 | 250 |
| 431 | 3300046674 | Ga0495588_0064304 | Ga0495588_0064304_1031_1789 | 250 |
| 432 | 3300046675 | Ga0495657_0010506 | Ga0495657_0010506_3830_4582 | 250 |
| 433 | 3300046678 | Ga0495599_0115489 | Ga0495599_0115489_799_1551 | 250 |
| 434 | 3300046679 | Ga0495623_0013784 | Ga0495623_0013784_3824_4582 | 250 |
| 435 | 3300046809 | Ga0495600_0025215 | Ga0495600_0025215_1124_1876 | 250 |
| 436 | 3300047317 | Ga0495604_0014104 | Ga0495604_0014104_2897_3655 | 250 |
| 437 | 3300047319 | Ga0495674_0029245 | Ga0495674_0029245_36_788 | 250 |
| 438 | 3300047321 | Ga0495676_0167164 | Ga0495676_0167164_731_1501 | 250 |
| 439 | 3300047322 | Ga0495680_0012974 | Ga0495680_0012974_3956_4708 | 250 |
| 440 | 3300047444 | Ga0495675_0019337 | Ga0495675_0019337_1918_2676 | 250 |
| 441 | 3300047444 | Ga0495675_0060814 | Ga0495675_0060814_169_927 | 250 |
| 442 | 3300047447 | Ga0495685_070498 | Ga0495685_070498_150_908 | 250 |
| 443 | 3300047471 | Ga0495684_0022700 | Ga0495684_0022700_2271_3023 | 250 |
| 444 | 3300048088 | Ga0495602_0036059 | Ga0495602_0036059_2737_3489 | 250 |
| 445 | 3300048904 | Ga0496101_0131350 | Ga0496101_0131350_759_1517 | 250 |
| 446 | 3300048907 | Ga0496104_0140678 | Ga0496104_0140678_288_1046 | 250 |
| 447 | 3300048908 | Ga0496105_0025490 | Ga0496105_0025490_3679_4437 | 250 |
| 448 | 3300048908 | Ga0496105_0119845 | Ga0496105_0119845_584_1342 | 250 |
| 449 | 3300048911 | Ga0496108_0350621 | Ga0496108_0350621_115_873 | 250 |
| 450 | 3300048913 | Ga0496110_0172103 | Ga0496110_0172103_641_1399 | 250 |
| 451 | 3300048913 | Ga0496110_0319209 | Ga0496110_0319209_80_838 | 250 |
| 452 | 3300048917 | Ga0496114_0053585 | Ga0496114_0053585_2263_3021 | 250 |
| 453 | 3300048917 | Ga0496114_0682967 | Ga0496114_0682967_17_775 | 250 |
| 454 | 3300050492 | nmdc:mga0yw44_42147_c1 | nmdc:mga0yw44_42147_c1_549_1307 | 250 |
| 455 | 3300050510 | nmdc:mga06r32_67353_c1 | nmdc:mga06r32_67353_c1_1529_2287 | 250 |
| 456 | 3300001904 | JGI24736J21556_1001712 | JGI24736J21556_10017124 | 251 |
| 457 | 3300001979 | JGI24740J21852_10008764 | JGI24740J21852_100087644 | 251 |
| 458 | 3300001989 | JGI24739J22299_10000064 | JGI24739J22299_1000006412 | 251 |
| 459 | 3300001990 | JGI24737J22298_10001765 | JGI24737J22298_100017653 | 251 |
| 460 | 3300005329 | Ga0070683_100506973 | Ga0070683_1005069732 | 251 |
| 461 | 3300005339 | Ga0070660_100004481 | Ga0070660_1000044815 | 251 |
| 462 | 3300005366 | Ga0070659_100009247 | Ga0070659_1000092472 | 251 |
| 463 | 3300005436 | Ga0070713_100686314 | Ga0070713_1006863141 | 251 |
| 464 | 3300005439 | Ga0070711_100061196 | Ga0070711_1000611961 | 251 |
| 465 | 3300005445 | Ga0070708_100058196 | Ga0070708_1000581963 | 251 |
| 466 | 3300005445 | Ga0070708_100113950 | Ga0070708_1001139502 | 251 |
| 467 | 3300005458 | Ga0070681_10325911 | Ga0070681_103259111 | 251 |
| 468 | 3300005467 | Ga0070706_100507853 | Ga0070706_1005078531 | 251 |
| 469 | 3300005468 | Ga0070707_100166915 | Ga0070707_1001669152 | 251 |
| 470 | 3300005518 | Ga0070699_100134048 | Ga0070699_1001340481 | 251 |
| 471 | 3300005535 | Ga0070684_100035439 | Ga0070684_1000354391 | 251 |
| 472 | 3300005535 | Ga0070684_100642438 | Ga0070684_1006424382 | 251 |
| 473 | 3300005536 | Ga0070697_100056441 | Ga0070697_1000564412 | 251 |
| 474 | 3300005539 | Ga0068853_100001500 | Ga0068853_10000150016 | 251 |
| 475 | 3300005563 | Ga0068855_100001045 | Ga0068855_10000104513 | 251 |
| 476 | 3300005577 | Ga0068857_100033467 | Ga0068857_1000334671 | 251 |
| 477 | 3300005578 | Ga0068854_100001196 | Ga0068854_1000011968 | 251 |
| 478 | 3300005578 | Ga0068854_100423067 | Ga0068854_1004230672 | 251 |
| 479 | 3300005614 | Ga0068856_100045173 | Ga0068856_1000451735 | 251 |
| 480 | 3300005616 | Ga0068852_100000924 | Ga0068852_1000009245 | 251 |
| 481 | 3300005834 | Ga0068851_10007031 | Ga0068851_100070313 | 251 |
| 482 | 3300005981 | Ga0081538_10016227 | Ga0081538_100162276 | 251 |
| 483 | 3300005981 | Ga0081538_10054394 | Ga0081538_100543942 | 251 |
| 484 | 3300005981 | Ga0081538_10086006 | Ga0081538_100860061 | 251 |
| 485 | 3300006028 | Ga0070717_10016423 | Ga0070717_100164233 | 251 |
| 486 | 3300006028 | Ga0070717_10092781 | Ga0070717_100927812 | 251 |
| 487 | 3300006038 | Ga0075365_10006611 | Ga0075365_100066115 | 251 |
| 488 | 3300006175 | Ga0070712_100015119 | Ga0070712_1000151195 | 251 |
| 489 | 3300006177 | Ga0075362_10002027 | Ga0075362_100020272 | 251 |
| 490 | 3300006353 | Ga0075370_10135981 | Ga0075370_101359812 | 251 |
| 491 | 3300006844 | Ga0075428_100214647 | Ga0075428_1002146471 | 251 |
| 492 | 3300009011 | Ga0105251_10001505 | Ga0105251_100015055 | 251 |
| 493 | 3300009036 | Ga0105244_10001347 | Ga0105244_100013475 | 251 |
| 494 | 3300009092 | Ga0105250_10002004 | Ga0105250_100020042 | 251 |
| 495 | 3300009093 | Ga0105240_10029849 | Ga0105240_100298494 | 251 |
| 496 | 3300009098 | Ga0105245_10042569 | Ga0105245_100425691 | 251 |
| 497 | 3300009147 | Ga0114129_10140385 | Ga0114129_101403851 | 251 |
| 498 | 3300009174 | Ga0105241_10000156 | Ga0105241_1000015634 | 251 |
| 499 | 3300009545 | Ga0105237_10068545 | Ga0105237_100685454 | 251 |
| 500 | 3300009551 | Ga0105238_10007164 | Ga0105238_100071647 | 251 |
| 501 | 3300010375 | Ga0105239_10034546 | Ga0105239_100345463 | 251 |
| 502 | 3300010375 | Ga0105239_10399812 | Ga0105239_103998122 | 251 |
| 503 | 3300013105 | Ga0157369_10002092 | Ga0157369_1000209216 | 251 |
| 504 | 3300013306 | Ga0163162_10077494 | Ga0163162_100774942 | 251 |
| 505 | 3300022467 | Ga0224712_10056235 | Ga0224712_100562351 | 251 |
| 506 | 3300025321 | Ga0207656_10009161 | Ga0207656_100091614 | 251 |
| 507 | 3300025728 | Ga0207655_1001563 | Ga0207655_100156315 | 251 |
| 508 | 3300025735 | Ga0207713_1001245 | Ga0207713_10012457 | 251 |
| 509 | 3300025901 | Ga0207688_10081152 | Ga0207688_100811522 | 251 |
| 510 | 3300025904 | Ga0207647_10000033 | Ga0207647_1000003311 | 251 |
| 511 | 3300025910 | Ga0207684_10012883 | Ga0207684_100128832 | 251 |
| 512 | 3300025911 | Ga0207654_10008183 | Ga0207654_100081835 | 251 |
| 513 | 3300025913 | Ga0207695_10002681 | Ga0207695_100026813 | 251 |
| 514 | 3300025914 | Ga0207671_10041228 | Ga0207671_100412283 | 251 |
| 515 | 3300025915 | Ga0207693_10383838 | Ga0207693_103838381 | 251 |
| 516 | 3300025919 | Ga0207657_10001739 | Ga0207657_100017397 | 251 |
| 517 | 3300025924 | Ga0207694_10020030 | Ga0207694_100200302 | 251 |
| 518 | 3300025927 | Ga0207687_10051445 | Ga0207687_100514453 | 251 |
| 519 | 3300025933 | Ga0207706_10037034 | Ga0207706_100370345 | 251 |
| 520 | 3300025944 | Ga0207661_10027976 | Ga0207661_100279762 | 251 |
| 521 | 3300025944 | Ga0207661_10381712 | Ga0207661_103817121 | 251 |
| 522 | 3300025949 | Ga0207667_10002487 | Ga0207667_1000248711 | 251 |
| 523 | 3300025981 | Ga0207640_10000460 | Ga0207640_1000046020 | 251 |
| 524 | 3300026041 | Ga0207639_10072126 | Ga0207639_100721261 | 251 |
| 525 | 3300026078 | Ga0207702_10000793 | Ga0207702_1000079310 | 251 |
| 526 | 3300026116 | Ga0207674_10013896 | Ga0207674_100138966 | 251 |
| 527 | 3300026116 | Ga0207674_10378173 | Ga0207674_103781731 | 251 |
| 528 | 3300026142 | Ga0207698_10013410 | Ga0207698_100134105 | 251 |
| 529 | 3300031456 | Ga0307513_10027389 | Ga0307513_100273893 | 251 |
| 530 | 3300031548 | Ga0307408_100000387 | Ga0307408_10000038723 | 251 |
| 531 | 3300031731 | Ga0307405_10011285 | Ga0307405_100112852 | 251 |
| 532 | 3300031731 | Ga0307405_10153812 | Ga0307405_101538122 | 251 |
| 533 | 3300031731 | Ga0307405_10463048 | Ga0307405_104630482 | 251 |
| 534 | 3300031852 | Ga0307410_10019242 | Ga0307410_100192421 | 251 |
| 535 | 3300031903 | Ga0307407_10060291 | Ga0307407_100602913 | 251 |
| 536 | 3300031903 | Ga0307407_10088370 | Ga0307407_100883702 | 251 |
| 537 | 3300031995 | Ga0307409_100003060 | Ga0307409_1000030608 | 251 |
| 538 | 3300031995 | Ga0307409_100075207 | Ga0307409_1000752072 | 251 |
| 539 | 3300031995 | Ga0307409_100468805 | Ga0307409_1004688052 | 251 |
| 540 | 3300032126 | Ga0307415_100062968 | Ga0307415_1000629682 | 251 |
| 541 | 3300035172 | Ga0373955_0210507 | Ga0373955_0210507_31_786 | 251 |
| 542 | 3300036401 | Ga0373937_0237763 | Ga0373937_0237763_90_863 | 251 |
| 543 | 3300037418 | Ga0395900_0680420 | Ga0395900_0680420_29_799 | 251 |
| 544 | 3300037853 | Ga0436364_1208927 | Ga0436364_1208927_2657_3421 | 251 |
| 545 | 3300038443 | Ga0395901_0049393 | Ga0395901_0049393_1039_1809 | 251 |
| 546 | 3300038735 | Ga0400485_14387 | Ga0400485_14387_10936_11709 | 251 |
| 547 | 3300038741 | Ga0400488_33105 | Ga0400488_33105_1948_2721 | 251 |
| 548 | 3300038742 | Ga0400486_21500 | Ga0400486_21500_4245_5018 | 251 |
| 549 | 3300041456 | Ga0451795_0766239 | Ga0451795_0766239_499_1260 | 251 |
| 550 | 3300041505 | Ga0451849_0593111 | Ga0451849_0593111_41_802 | 251 |
| 551 | 3300042004 | Ga0439445_0025124 | Ga0439445_0025124_284_1039 | 251 |
| 552 | 3300044765 | Ga0466970_0031436 | Ga0466970_0031436_1289_2059 | 251 |
| 553 | 3300044842 | Ga0466957_0090956 | Ga0466957_0090956_186_956 | 251 |
| 554 | 3300046533 | Ga0495640_0197073 | Ga0495640_0197073_406_1179 | 251 |
| 555 | 3300048911 | Ga0496108_0628073 | Ga0496108_0628073_93_857 | 251 |
| 556 | 3300048923 | Ga0496120_0002693 | Ga0496120_0002693_554_1336 | 251 |
| 557 | 3300050491 | nmdc:mga00v17_7749_c1 | nmdc:mga00v17_7749_c1_3085_3849 | 251 |
| 558 | 3300050492 | nmdc:mga0yw44_2105_c1 | nmdc:mga0yw44_2105_c1_160_915 | 251 |
| 559 | 3300050492 | nmdc:mga0yw44_230237_c1 | nmdc:mga0yw44_230237_c1_132_899 | 251 |
| 560 | 3300050494 | nmdc:mga06z11_106199_c1 | nmdc:mga06z11_106199_c1_170_934 | 251 |
| 561 | 3300050496 | nmdc:mga07m45_2591_c1 | nmdc:mga07m45_2591_c1_10_774 | 251 |
| 562 | 3300050516 | nmdc:mga0sz30_110914_c1 | nmdc:mga0sz30_110914_c1_171_935 | 251 |
| 563 | 3300059424 | Ga0590075_001853 | Ga0590075_001853_1846_2607 | 251 |
| 564 | 3300059426 | Ga0590077_006260 | Ga0590077_006260_754_1515 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sju-assembly1.cif.gz_A | hedamycin polyketide ketoreductase bound to nadph | 0.9673 | 5 | 248 |
| 6t62-assembly1.cif.gz_B-2 | crystal structure of acinetobacter baumannii fabg in complex with nadph at 1.8 a resolution | 0.9661 | 4 | 248 |
| 7pcs-assembly1.cif.gz_D | structure of the heterotetrameric sdr family member bbscd | 0.9648 | 1 | 248 |
| 4cqm-assembly2.cif.gz_C | crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp | 0.9645 | 5 | 248 |
| 4cql-assembly2.cif.gz_B | crystal structure of heterotetrameric human ketoacyl reductase complexed with nad | 0.9641 | 5 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9651 | 4 | 179 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9649 | 5 | 183 | 3.40.50.720 |
| 3ftpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9605 | 5 | 248 | 3.40.50.720 |
| 5jy1D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9577 | 5 | 248 | 3.40.50.720 |
| 2et6A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9565 | 5 | 248 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3G9J1-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9988 | 4 | 184 |
|
| AF-A0A223SAM0-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9984 | 4 | 250 |
GO:0005886
GO:0016627 GO:0050660 |
| AF-A0A6I5X221-F1-model_v4 | SDR family oxidoreductase | 0.998 | 2 | 249 |
GO:0016491
|
| AF-A0A6N7CA84-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase MabA | 0.9967 | 3 | 251 |
GO:0016491
|
| AF-K1E4Y3-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9962 | 69 | 249 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar