F464102

General Info

Members Datasets Scaffolds Average Seq Length
563 248 538 147

Family's Representative Sequence

Representative Sequence 3300049529|Ga0501313_006245|Ga0501313_006245_516_1037
Length 173
Sequence MSRNESVQKRLQKVRAPRVQMSYDVEIGDAVESKELPFVMGVVGDFAGASQIEQKKLKDRKFVGVDRDTFDDVMKGIAPRAAYRVPNELTPEGGEFSVDLTFESMNDFRPESVVEQVEPLRKLLEARTRLADLRNKLAGNDKLEDILSXXLSNTEKLAELSRASATPPRNDKE

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
4 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2738541280 Massilia sp. GV090 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
15 2842711865 Duganella sp. R-73148 Isolate Unclassified
16 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
17 2857558681 Duganella sp. R-74565 Isolate Unclassified
18 2904424332 Duganella sp. 1411 Isolate Rhizosphere
19 2919476304 Duganella sp. 3397 Isolate Unclassified
20 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
21 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
120 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
121 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
122 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
206 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
238 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
239 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
244 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
245 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.49
Metatranscriptomes 1.07
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.04
Nodule 0.18
Rhizoplane 5.68
Rhizosphere 78.69
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1002686 3300002774 Bacteria 4336
2 JGI25159J45721_1004405 3300002987 Bacteria 4683
3 Ga0006759J45824_1049560 3300003163 Bacteria 1988
4 rootL2_10178613 3300003322 Bacteria 2314
5 Ga0055525_1000047 3300003759 Bacteria 261507
6 Ga0055526_1003332 3300003771 Bacteria 10268
7 Ga0055537_1000248 3300003773 Bacteria 39459
8 Ga0055524_1000021 3300003775 Bacteria 227578
9 Ga0055524_1005175 3300003775 Bacteria 5876
10 Ga0055534_1000318 3300003784 Bacteria 31952
11 Ga0055528_1000116 3300003790 Bacteria 63713
12 Ga0055543_1006681 3300004625 Bacteria 2753
13 Ga0065165_1000630 3300005262 Bacteria 51211
14 Ga0065165_1032915 3300005262 Bacteria 1620
15 Ga0065714_10119742 3300005288 Bacteria 1363
16 Ga0070658_10187716 3300005327 Bacteria 1741
17 Ga0070682_100577336 3300005337 Bacteria 884
18 Ga0070660_100049675 3300005339 Bacteria 3225
19 Ga0070660_100184814 3300005339 Bacteria 1687
20 Ga0070660_100436355 3300005339 Bacteria 1085
21 Ga0070661_100108999 3300005344 Bacteria 2066
22 Ga0070659_100411039 3300005366 Bacteria 1143
23 Ga0070663_100109839 3300005455 Bacteria 2071
24 Ga0070662_100215759 3300005457 Bacteria 1529
25 Ga0070662_100746708 3300005457 Bacteria 830
26 Ga0070672_100593160 3300005543 Bacteria 964
27 Ga0068855_100081836 3300005563 Bacteria 3742
28 Ga0070664_100098391 3300005564 Bacteria 2541
29 Ga0068856_100226794 3300005614 Bacteria 1884
30 Ga0068852_100172577 3300005616 Bacteria 2028
31 Ga0070716_100178177 3300006173 Bacteria 1393
32 Ga0075367_10151836 3300006178 Bacteria 1438
33 Ga0068865_100236463 3300006881 Bacteria 1436
34 Ga0105245_10110816 3300009098 Bacteria 2552
35 Ga0105243_10125915 3300009148 Bacteria 2167
36 Ga0105241_10583003 3300009174 Bacteria 1008
37 Ga0105242_10022993 3300009176 Bacteria 4911
38 Ga0105248_11456117 3300009177 Bacteria 775
39 Ga0105237_10280296 3300009545 Bacteria 1669
40 Ga0105238_10187663 3300009551 Bacteria 2044
41 Ga0157373_10231832 3300013100 Bacteria 1304
42 Ga0157371_10502872 3300013102 Bacteria 895
43 Ga0157369_10794764 3300013105 Bacteria 972
44 Ga0157374_10918875 3300013296 Bacteria 893
45 Ga0182008_10000228 3300014497 Bacteria 43946
46 Ga0182008_10006642 3300014497 Bacteria 6441
47 Ga0182006_1000142 3300015261 Bacteria 76916
48 Ga0182007_10000231 3300015262 Bacteria 37454
49 Ga0182005_1000090 3300015265 Bacteria 68199
50 Ga0163161_10058471 3300017792 Bacteria 2802
51 Ga0163161_10065577 3300017792 Bacteria 2650
52 Ga0209436_108583 3300025208 Bacteria 2021
53 Ga0209563_100003 3300025230 Bacteria 1932942
54 Ga0207425_1000318 3300025245 Bacteria 34531
55 Ga0209677_102029 3300025253 Bacteria 8033
56 Ga0209148_1001353 3300025254 Bacteria 12872
57 Ga0209565_1000009 3300025263 Bacteria 751701
58 Ga0209673_1000019 3300025273 Bacteria 449094
59 Ga0209130_1003480 3300025284 Bacteria 6644
60 Ga0209675_1000028 3300025291 Bacteria 281253
61 Ga0209025_1003609 3300025294 Bacteria 14413
62 Ga0209564_1000058 3300025295 Bacteria 332955
63 Ga0209564_1021418 3300025295 Bacteria 2325
64 Ga0209758_1000675 3300025297 Bacteria 50917
65 Ga0209256_1000044 3300025299 Bacteria 337264
66 Ga0209256_1000093 3300025299 Bacteria 209318
67 Ga0207426_1036634 3300025302 Bacteria 1558
68 Ga0207705_10074561 3300025909 Bacteria 2463
69 Ga0207705_10421702 3300025909 Bacteria 1033
70 Ga0207654_10061273 3300025911 Bacteria 2201
71 Ga0207671_10143141 3300025914 Bacteria 1843
72 Ga0207657_10003522 3300025919 Bacteria 16718
73 Ga0207657_10032076 3300025919 Bacteria 4750
74 Ga0207657_10215831 3300025919 Bacteria 1538
75 Ga0207657_10272440 3300025919 Bacteria 1345
76 Ga0207694_10106979 3300025924 Bacteria 2222
77 Ga0207687_10467552 3300025927 Bacteria 1048
78 Ga0207690_10104052 3300025932 Bacteria 2033
79 Ga0207706_10005937 3300025933 Bacteria 11359
80 Ga0207706_10106679 3300025933 Bacteria 2465
81 Ga0207686_10002979 3300025934 Bacteria 9125
82 Ga0207704_10159109 3300025938 Bacteria 1605
83 Ga0207665_10216039 3300025939 Bacteria 1403
84 Ga0207667_10018225 3300025949 Bacteria 7878
85 Ga0207678_10669588 3300026067 Bacteria 912
86 Ga0207702_11169880 3300026078 Bacteria 763
87 Ga0207698_10353097 3300026142 Bacteria 1390
88 Ga0209974_10002896 3300027876 Bacteria 6225
89 Ga0307515_10000381 3300028794 Bacteria 108373
90 Ga0307515_10002386 3300028794 Bacteria 40952
91 Ga0307515_10009310 3300028794 Bacteria 19001
92 Ga0307512_10064991 3300030522 Bacteria 2772
93 Ga0307512_10247649 3300030522 Bacteria 892
94 Ga0265328_10106892 3300031239 Bacteria 1038
95 Ga0265327_10000205 3300031251 Bacteria 123596
96 Ga0307513_10009505 3300031456 Bacteria 12297
97 Ga0307509_10241816 3300031507 Bacteria 1597
98 Ga0307408_100000735 3300031548 Bacteria 26492
99 Ga0307508_10000194 3300031616 Bacteria 73425
100 Ga0307514_10014297 3300031649 Bacteria 6574
101 Ga0307516_10009770 3300031730 Bacteria 10643
102 Ga0307507_10011647 3300033179 Bacteria 11041
103 Ga0373939_0032490 3300035114 Bacteria 1517
104 Ga0395899_0002576 3300037312 Bacteria 14635
105 Ga0395899_0078926 3300037312 Bacteria 2398
106 Ga0395900_0000763 3300037418 Bacteria 42856
107 Ga0395900_0179082 3300037418 Bacteria 2155
108 Ga0395900_0190798 3300037418 Bacteria 2078
109 Ga0395900_0255632 3300037418 Bacteria 1751
110 Ga0395900_0284786 3300037418 Bacteria 1643
111 Ga0395900_0382423 3300037418 Bacteria 1375
112 Ga0395900_0446947 3300037418 Bacteria 1249
113 Ga0395898_0056317 3300037466 Bacteria 3832
114 Ga0395898_0892230 3300037466 Bacteria 827
115 Ga0395905_0072684 3300037471 Bacteria 3224
116 Ga0395905_0124627 3300037471 Bacteria 2422
117 Ga0395905_0132405 3300037471 Bacteria 2345
118 Ga0395905_0242639 3300037471 Bacteria 1683
119 Ga0395905_0409058 3300037471 Bacteria 1252
120 Ga0395905_0491859 3300037471 Bacteria 1126
121 Ga0395901_0000097 3300038443 Bacteria 118528
122 Ga0395901_0053904 3300038443 Bacteria 4179
123 Ga0395901_0082617 3300038443 Bacteria 3356
124 Ga0395901_0145881 3300038443 Bacteria 2487
125 Ga0395901_0270960 3300038443 Bacteria 1766
126 Ga0395901_0318499 3300038443 Bacteria 1609
127 Ga0395901_0449224 3300038443 Bacteria 1318
128 Ga0395901_1425133 3300038443 Bacteria 650
129 Ga0395901_1645216 3300038443 Bacteria 594
130 Ga0436361_0674642 3300039447 Bacteria 25335
131 Ga0451789_0916289 3300041443 Bacteria 2109
132 Ga0451791_0523573 3300041451 Bacteria 1326
133 Ga0451795_0697288 3300041456 Bacteria 985
134 Ga0451798_0428385 3300041458 Bacteria 1221
135 Ga0451800_0130513 3300041459 Bacteria 2091
136 Ga0451833_0498765 3300041491 Bacteria 1108
137 Ga0451841_1119001 3300041498 Bacteria 2269
138 Ga0451849_0995850 3300041505 Bacteria 1075
139 Ga0451843_0325161 3300041509 Bacteria 730
140 Ga0451853_0705861 3300041512 Bacteria 4119
141 Ga0439448_0088639 3300042005 Bacteria 1044
142 Ga0439450_093292 3300042008 Bacteria 758
143 Ga0439450_160617 3300042008 Bacteria 592
144 Ga0439458_0134152 3300042157 Bacteria 657
145 Ga0466969_0075719 3300044656 Bacteria 1612
146 Ga0466969_0102468 3300044656 Bacteria 1346
147 Ga0466969_0161251 3300044656 Bacteria 1030
148 Ga0466969_0186935 3300044656 Bacteria 947
149 Ga0466972_0148977 3300044658 Bacteria 1100
150 Ga0466965_0001236 3300044683 Bacteria 10110
151 Ga0466965_0008112 3300044683 Bacteria 4851
152 Ga0466965_0083980 3300044683 Bacteria 1612
153 Ga0466965_0091692 3300044683 Bacteria 1546
154 Ga0466966_0025511 3300044684 Bacteria 3859
155 Ga0466966_0041914 3300044684 Bacteria 2940
156 Ga0466966_0053136 3300044684 Bacteria 2570
157 Ga0466966_0058430 3300044684 Bacteria 2437
158 Ga0466966_0757039 3300044684 Bacteria 585
159 Ga0466961_0116076 3300044693 Bacteria 1682
160 Ga0466963_0032740 3300044694 Bacteria 3368
161 Ga0466964_0000163 3300044706 Bacteria 18439
162 Ga0466964_0043842 3300044706 Bacteria 1815
163 Ga0466970_0048703 3300044765 Bacteria 2260
164 Ga0466970_0192753 3300044765 Bacteria 1133
165 Ga0466957_0000007 3300044842 Bacteria 84513
166 Ga0466957_0027093 3300044842 Bacteria 3404
167 Ga0466957_0098671 3300044842 Bacteria 1838
168 Ga0466957_0106670 3300044842 Bacteria 1772
169 Ga0466960_0114381 3300044901 Bacteria 1406
170 Ga0466960_0643677 3300044901 Bacteria 632
171 Ga0466959_0029414 3300045049 Bacteria 4070
172 Ga0466959_0287050 3300045049 Bacteria 1128
173 Ga0466958_0064190 3300045836 Bacteria 2239
174 Ga0466958_0098425 3300045836 Bacteria 1816
175 Ga0466958_0223926 3300045836 Bacteria 1200
176 Ga0466958_0448723 3300045836 Bacteria 835
177 Ga0466967_0001164 3300045976 Bacteria 14741
178 Ga0466967_0176830 3300045976 Bacteria 2011
179 Ga0466967_0250612 3300045976 Bacteria 1691
180 Ga0495627_000255 3300046453 Bacteria 54602
181 Ga0495627_006218 3300046453 Bacteria 4700
182 Ga0495627_006421 3300046453 Bacteria 4610
183 Ga0495603_0309309 3300046455 Bacteria 907
184 Ga0495629_0046219 3300046459 Bacteria 3054
185 Ga0495638_0084028 3300046460 Bacteria 1927
186 Ga0495638_0084275 3300046460 Bacteria 1924
187 Ga0495638_0115682 3300046460 Bacteria 1589
188 Ga0495653_0158082 3300046463 Bacteria 1576
189 Ga0495650_0000477 3300046471 Bacteria 61376
190 Ga0495650_0013865 3300046471 Bacteria 4235
191 Ga0495650_0048992 3300046471 Bacteria 1757
192 Ga0495605_0000024 3300046474 Bacteria 236016
193 Ga0495605_0000044 3300046474 Bacteria 182513
194 Ga0495605_0000236 3300046474 Bacteria 67212
195 Ga0495605_0014617 3300046474 Bacteria 4292
196 Ga0495605_0016225 3300046474 Bacteria 4034
197 Ga0495605_0344993 3300046474 Bacteria 625
198 Ga0495584_0000003 3300046491 Bacteria 323768
199 Ga0495584_0000097 3300046491 Bacteria 59505
200 Ga0495584_0000657 3300046491 Bacteria 23045
201 Ga0495584_0009984 3300046491 Bacteria 4873
202 Ga0495584_0019199 3300046491 Bacteria 3472
203 Ga0495584_0021517 3300046491 Bacteria 3275
204 Ga0495584_0027783 3300046491 Bacteria 2866
205 Ga0495584_0043264 3300046491 Bacteria 2273
206 Ga0495584_0062019 3300046491 Bacteria 1879
207 Ga0495584_0082372 3300046491 Bacteria 1619
208 Ga0495584_0299689 3300046491 Bacteria 816
209 Ga0495585_0000130 3300046492 Bacteria 81689
210 Ga0495585_0000655 3300046492 Bacteria 31822
211 Ga0495585_0000807 3300046492 Bacteria 27258
212 Ga0495585_0001776 3300046492 Bacteria 16376
213 Ga0495585_0006830 3300046492 Bacteria 7038
214 Ga0495585_0008154 3300046492 Bacteria 6364
215 Ga0495585_0037898 3300046492 Bacteria 2714
216 Ga0495585_0068838 3300046492 Bacteria 1932
217 Ga0495585_0103274 3300046492 Bacteria 1522
218 Ga0495594_0144113 3300046499 Bacteria 1351
219 Ga0495596_0001049 3300046500 Bacteria 16417
220 Ga0495596_0005896 3300046500 Bacteria 5721
221 Ga0495596_0007439 3300046500 Bacteria 4941
222 Ga0495596_0010212 3300046500 Bacteria 4097
223 Ga0495596_0029115 3300046500 Bacteria 2215
224 Ga0495607_0001317 3300046501 Bacteria 22137
225 Ga0495607_0001333 3300046501 Bacteria 22039
226 Ga0495607_0002811 3300046501 Bacteria 13834
227 Ga0495607_0013597 3300046501 Bacteria 5328
228 Ga0495607_0014224 3300046501 Bacteria 5189
229 Ga0495607_0037431 3300046501 Bacteria 2915
230 Ga0495607_0056778 3300046501 Bacteria 2246
231 Ga0495607_0093853 3300046501 Bacteria 1620
232 Ga0495607_0228469 3300046501 Bacteria 906
233 Ga0495583_0000235 3300046506 Bacteria 91939
234 Ga0495583_0000560 3300046506 Bacteria 51454
235 Ga0495583_0001243 3300046506 Bacteria 27052
236 Ga0495583_0007311 3300046506 Bacteria 6972
237 Ga0495583_0014241 3300046506 Bacteria 4396
238 Ga0495583_0015784 3300046506 Bacteria 4090
239 Ga0495606_0000229 3300046507 Bacteria 98732
240 Ga0495606_0000537 3300046507 Bacteria 61013
241 Ga0495606_0002327 3300046507 Bacteria 22401
242 Ga0495606_0005020 3300046507 Bacteria 12897
243 Ga0495606_0015478 3300046507 Bacteria 5873
244 Ga0495606_0063852 3300046507 Bacteria 2345
245 Ga0495606_0118496 3300046507 Bacteria 1587
246 Ga0495606_0149490 3300046507 Bacteria 1372
247 Ga0495606_0213926 3300046507 Bacteria 1090
248 Ga0495606_0223020 3300046507 Bacteria 1061
249 Ga0495610_0003072 3300046512 Bacteria 13335
250 Ga0495616_0000634 3300046513 Bacteria 26282
251 Ga0495616_0000913 3300046513 Bacteria 21264
252 Ga0495616_0003494 3300046513 Bacteria 10051
253 Ga0495616_0005288 3300046513 Bacteria 7958
254 Ga0495616_0023002 3300046513 Bacteria 3358
255 Ga0495616_0038749 3300046513 Bacteria 2445
256 Ga0495616_0046097 3300046513 Bacteria 2202
257 Ga0495616_0084115 3300046513 Bacteria 1517
258 Ga0495616_0134870 3300046513 Bacteria 1128
259 Ga0495616_0212917 3300046513 Bacteria 845
260 Ga0495628_1040392 3300046516 Bacteria 562
261 Ga0495631_0005485 3300046518 Bacteria 6631
262 Ga0495631_0014378 3300046518 Bacteria 3821
263 Ga0495631_0050090 3300046518 Bacteria 1827
264 Ga0495631_0055205 3300046518 Bacteria 1730
265 Ga0495631_0193837 3300046518 Bacteria 869
266 Ga0495632_0000203 3300046519 Bacteria 60607
267 Ga0495632_0000225 3300046519 Bacteria 57394
268 Ga0495632_0005704 3300046519 Bacteria 8171
269 Ga0495632_0009707 3300046519 Bacteria 5776
270 Ga0495632_0016996 3300046519 Bacteria 4029
271 Ga0495643_0000171 3300046522 Bacteria 103167
272 Ga0495643_0002430 3300046522 Bacteria 14806
273 Ga0495643_0004286 3300046522 Bacteria 10060
274 Ga0495643_0014827 3300046522 Bacteria 4627
275 Ga0495643_0039456 3300046522 Bacteria 2582
276 Ga0495643_0059539 3300046522 Bacteria 2030
277 Ga0495643_0063034 3300046522 Bacteria 1961
278 Ga0495643_0170049 3300046522 Bacteria 1066
279 Ga0495644_0006396 3300046523 Bacteria 4567
280 Ga0495644_0056827 3300046523 Bacteria 1470
281 Ga0495648_0000003 3300046524 Bacteria 386817
282 Ga0495648_0000290 3300046524 Bacteria 57025
283 Ga0495648_0000863 3300046524 Bacteria 31958
284 Ga0495663_0205456 3300046525 Bacteria 688
285 Ga0495642_0000065 3300046528 Bacteria 63401
286 Ga0495642_0000125 3300046528 Bacteria 43793
287 Ga0495642_0002169 3300046528 Bacteria 8059
288 Ga0495642_0009551 3300046528 Bacteria 3712
289 Ga0495642_0066558 3300046528 Bacteria 1501
290 Ga0495642_0074366 3300046528 Bacteria 1424
291 Ga0495642_0074589 3300046528 Bacteria 1422
292 Ga0495642_0100954 3300046528 Bacteria 1228
293 Ga0495642_0111907 3300046528 Bacteria 1168
294 Ga0495654_0026371 3300046530 Bacteria 2987
295 Ga0495654_0039194 3300046530 Bacteria 2366
296 Ga0495654_0070954 3300046530 Bacteria 1651
297 Ga0495654_0230825 3300046530 Bacteria 778
298 Ga0495665_0142865 3300046531 Bacteria 1250
299 Ga0495665_0519442 3300046531 Bacteria 599
300 Ga0495640_0046100 3300046533 Bacteria 3023
301 Ga0495586_0010261 3300046535 Bacteria 4981
302 Ga0495609_0000030 3300046538 Bacteria 215885
303 Ga0495609_0000140 3300046538 Bacteria 76163
304 Ga0495609_0001927 3300046538 Bacteria 13189
305 Ga0495609_0014277 3300046538 Bacteria 3738
306 Ga0495609_0053355 3300046538 Bacteria 1797
307 Ga0495609_0089068 3300046538 Bacteria 1343
308 Ga0495609_0094040 3300046538 Bacteria 1302
309 Ga0495609_0119236 3300046538 Bacteria 1135
310 Ga0495597_0007929 3300046542 Bacteria 5351
311 Ga0495597_0008345 3300046542 Bacteria 5190
312 Ga0495597_0020828 3300046542 Bacteria 3050
313 Ga0495597_0068152 3300046542 Bacteria 1538
314 Ga0495597_0125224 3300046542 Bacteria 1068
315 Ga0495597_0369615 3300046542 Bacteria 548
316 Ga0495622_0140563 3300046557 Bacteria 1096
317 Ga0495633_0002846 3300046558 Bacteria 11908
318 Ga0495633_0010022 3300046558 Bacteria 5199
319 Ga0495633_0027799 3300046558 Bacteria 2761
320 Ga0495633_0053494 3300046558 Bacteria 1900
321 Ga0495633_0105444 3300046558 Bacteria 1307
322 Ga0495633_0362432 3300046558 Bacteria 656
323 Ga0495667_0178336 3300046559 Bacteria 1364
324 Ga0495656_0048541 3300046615 Bacteria 1804
325 Ga0495656_0059155 3300046615 Bacteria 1666
326 Ga0495656_0073127 3300046615 Bacteria 1528
327 Ga0495656_0086260 3300046615 Bacteria 1427
328 Ga0495656_0159100 3300046615 Bacteria 1096
329 Ga0495656_0366808 3300046615 Bacteria 749
330 Ga0495668_0000118 3300046616 Bacteria 119439
331 Ga0495668_0000155 3300046616 Bacteria 103810
332 Ga0495668_0001326 3300046616 Bacteria 24343
333 Ga0495668_0002548 3300046616 Bacteria 14824
334 Ga0495668_0010819 3300046616 Bacteria 5500
335 Ga0495668_0014413 3300046616 Bacteria 4635
336 Ga0495668_0014502 3300046616 Bacteria 4619
337 Ga0495668_0113973 3300046616 Bacteria 1478
338 Ga0495668_0258870 3300046616 Bacteria 952
339 Ga0495668_0281079 3300046616 Bacteria 912
340 Ga0495611_0005947 3300046648 Bacteria 5206
341 Ga0495611_0008176 3300046648 Bacteria 4437
342 Ga0495611_0067521 3300046648 Bacteria 1631
343 Ga0495611_0071471 3300046648 Bacteria 1586
344 Ga0495611_0461690 3300046648 Bacteria 578
345 Ga0495625_0080449 3300046660 Bacteria 2269
346 Ga0495625_0094653 3300046660 Bacteria 2060
347 Ga0495659_0056455 3300046664 Bacteria 1441
348 Ga0495659_0115174 3300046664 Bacteria 1053
349 Ga0495661_0000209 3300046665 Bacteria 67580
350 Ga0495661_0000754 3300046665 Bacteria 31377
351 Ga0495661_0000949 3300046665 Bacteria 26312
352 Ga0495661_0019946 3300046665 Bacteria 4384
353 Ga0495661_0025005 3300046665 Bacteria 3863
354 Ga0495661_0034032 3300046665 Bacteria 3209
355 Ga0495661_0045380 3300046665 Bacteria 2688
356 Ga0495661_0073542 3300046665 Bacteria 1991
357 Ga0495661_0076015 3300046665 Bacteria 1950
358 Ga0495661_0353460 3300046665 Bacteria 723
359 Ga0495588_0000062 3300046674 Bacteria 253674
360 Ga0495588_0012983 3300046674 Bacteria 3956
361 Ga0495588_0024193 3300046674 Bacteria 3015
362 Ga0495588_0051250 3300046674 Bacteria 2125
363 Ga0495646_0329848 3300046680 Bacteria 802
364 Ga0495658_0030410 3300046683 Bacteria 2932
365 Ga0495669_0001810 3300046684 Bacteria 8736
366 Ga0495669_0005892 3300046684 Bacteria 5108
367 Ga0495670_0001919 3300046691 Bacteria 10235
368 Ga0495670_0002673 3300046691 Bacteria 8797
369 Ga0495670_0005624 3300046691 Bacteria 6147
370 Ga0495670_0011073 3300046691 Bacteria 4435
371 Ga0495670_0027250 3300046691 Bacteria 2830
372 Ga0495670_0175268 3300046691 Bacteria 1130
373 Ga0495670_0261024 3300046691 Bacteria 924
374 Ga0495671_0000001 3300046692 Bacteria 1169494
375 Ga0495671_0016092 3300046692 Bacteria 3999
376 Ga0495671_0038943 3300046692 Bacteria 2401
377 Ga0495671_0071270 3300046692 Bacteria 1707
378 Ga0495649_0013209 3300046694 Bacteria 4770
379 Ga0495649_0016261 3300046694 Bacteria 4218
380 Ga0495649_0043540 3300046694 Bacteria 2450
381 Ga0495649_0307516 3300046694 Bacteria 806
382 Ga0495589_0000021 3300046794 Bacteria 197941
383 Ga0495589_0007566 3300046794 Bacteria 5691
384 Ga0495589_0011516 3300046794 Bacteria 4592
385 Ga0495589_0016859 3300046794 Bacteria 3750
386 Ga0495589_0017109 3300046794 Bacteria 3724
387 Ga0495589_0044688 3300046794 Bacteria 2202
388 Ga0495589_0065818 3300046794 Bacteria 1776
389 Ga0495589_0105649 3300046794 Bacteria 1360
390 Ga0495660_0000173 3300046810 Bacteria 69912
391 Ga0495660_0031763 3300046810 Bacteria 2967
392 Ga0495660_0040819 3300046810 Bacteria 2571
393 Ga0495660_0061692 3300046810 Bacteria 2011
394 Ga0495660_0070711 3300046810 Bacteria 1851
395 Ga0495604_0028553 3300047317 Bacteria 4438
396 Ga0495604_0218463 3300047317 Bacteria 1313
397 Ga0495636_0001814 3300047318 Bacteria 8168
398 Ga0495636_0007941 3300047318 Bacteria 4178
399 Ga0495636_0217557 3300047318 Bacteria 876
400 Ga0495672_0000480 3300047320 Bacteria 47220
401 Ga0495672_0005516 3300047320 Bacteria 10018
402 Ga0495672_0024758 3300047320 Bacteria 3860
403 Ga0495672_0056799 3300047320 Bacteria 2275
404 Ga0495672_0101997 3300047320 Bacteria 1554
405 Ga0495672_0180540 3300047320 Bacteria 1069
406 Ga0495676_0012785 3300047321 Bacteria 7549
407 Ga0495680_0011356 3300047322 Bacteria 7887
408 Ga0495683_0000243 3300047323 Bacteria 48918
409 Ga0495683_0008513 3300047323 Bacteria 5485
410 Ga0495683_0015027 3300047323 Bacteria 4031
411 Ga0495683_0036135 3300047323 Bacteria 2509
412 Ga0495683_0048631 3300047323 Bacteria 2126
413 Ga0495683_0068513 3300047323 Bacteria 1745
414 Ga0495683_0083777 3300047323 Bacteria 1552
415 Ga0495687_000276 3300047443 Bacteria 67876
416 Ga0495687_000279 3300047443 Bacteria 67230
417 Ga0495687_000319 3300047443 Bacteria 62530
418 Ga0495687_057275 3300047443 Bacteria 1621
419 Ga0495687_082261 3300047443 Bacteria 1257
420 Ga0495687_121217 3300047443 Bacteria 943
421 Ga0495687_158639 3300047443 Bacteria 764
422 Ga0495675_0045991 3300047444 Bacteria 2779
423 Ga0495675_0129851 3300047444 Bacteria 1566
424 Ga0495675_0268788 3300047444 Bacteria 1019
425 Ga0495677_0000050 3300047445 Bacteria 67980
426 Ga0495677_0001535 3300047445 Bacteria 9294
427 Ga0495677_0001924 3300047445 Bacteria 8305
428 Ga0495677_0002264 3300047445 Bacteria 7606
429 Ga0495677_0004877 3300047445 Bacteria 5116
430 Ga0495677_0006637 3300047445 Bacteria 4360
431 Ga0495677_0017098 3300047445 Bacteria 2629
432 Ga0495677_0092789 3300047445 Bacteria 1138
433 Ga0495679_007740 3300047446 Bacteria 4444
434 Ga0495679_013266 3300047446 Bacteria 3102
435 Ga0495685_001691 3300047447 Bacteria 6795
436 Ga0495685_105384 3300047447 Bacteria 930
437 Ga0495673_0000006 3300047469 Bacteria 908691
438 Ga0495673_0018702 3300047469 Bacteria 3487
439 Ga0495681_0001449 3300047470 Bacteria 17784
440 Ga0495681_0005424 3300047470 Bacteria 8540
441 Ga0495681_0013429 3300047470 Bacteria 4750
442 Ga0495681_0061130 3300047470 Bacteria 1736
443 Ga0495686_0000474 3300047472 Bacteria 59917
444 Ga0495686_0010651 3300047472 Bacteria 6529
445 Ga0495686_0021085 3300047472 Bacteria 4335
446 Ga0495593_0000781 3300047673 Bacteria 18483
447 Ga0495602_1016587 3300048088 Bacteria 546
448 Ga0495614_0000519 3300048089 Bacteria 15857
449 Ga0495615_0018392 3300048090 Bacteria 1537
450 Ga0495626_0000624 3300048091 Bacteria 34501
451 Ga0495626_0004146 3300048091 Bacteria 8998
452 Ga0495626_0010493 3300048091 Bacteria 4937
453 Ga0495626_0028494 3300048091 Bacteria 2707
454 Ga0495626_0029371 3300048091 Bacteria 2661
455 Ga0495626_0031911 3300048091 Bacteria 2532
456 Ga0495626_0065292 3300048091 Bacteria 1647
457 Ga0495626_0074559 3300048091 Bacteria 1518
458 Ga0495626_0103979 3300048091 Bacteria 1235
459 Ga0495626_0128833 3300048091 Bacteria 1082
460 Ga0495626_0141914 3300048091 Bacteria 1018
461 Ga0496100_0122580 3300048903 Bacteria 1821
462 Ga0496100_0349669 3300048903 Bacteria 1116
463 Ga0496101_0602362 3300048904 Bacteria 869
464 Ga0496101_0666171 3300048904 Bacteria 822
465 Ga0496102_0000343 3300048905 Bacteria 56826
466 Ga0496102_0015304 3300048905 Bacteria 6680
467 Ga0496102_0021536 3300048905 Bacteria 5701
468 Ga0496102_0137485 3300048905 Bacteria 2290
469 Ga0496103_0050725 3300048906 Bacteria 2567
470 Ga0496103_0586246 3300048906 Bacteria 711
471 Ga0496103_0964971 3300048906 Bacteria 532
472 Ga0496104_0186509 3300048907 Bacteria 1985
473 Ga0496106_0007451 3300048909 Bacteria 8087
474 Ga0496108_0589081 3300048911 Bacteria 969
475 Ga0496109_0067239 3300048912 Bacteria 3283
476 Ga0496109_0098527 3300048912 Bacteria 2710
477 Ga0496109_1022764 3300048912 Bacteria 764
478 Ga0496109_1528157 3300048912 Bacteria 602
479 Ga0496110_0314764 3300048913 Bacteria 1425
480 Ga0496111_0022480 3300048914 Bacteria 4416
481 Ga0496111_0715479 3300048914 Bacteria 728
482 Ga0496112_0126727 3300048915 Bacteria 2524
483 Ga0496115_0043328 3300048918 Bacteria 3589
484 Ga0496115_0218084 3300048918 Bacteria 1574
485 Ga0496115_0423373 3300048918 Bacteria 1078
486 Ga0496116_0032098 3300048919 Bacteria 3748
487 Ga0496116_0037708 3300048919 Bacteria 3367
488 Ga0496117_0000045 3300048920 Bacteria 301047
489 Ga0496118_0000041 3300048921 Bacteria 301047
490 Ga0496119_0223290 3300048922 Bacteria 963
491 Ga0496121_0001068 3300048924 Bacteria 48493
492 Ga0496121_0002658 3300048924 Bacteria 26800
493 Ga0496121_0005605 3300048924 Bacteria 16009
494 Ga0496121_0189393 3300048924 Bacteria 1477
495 Ga0496122_0007303 3300048925 Bacteria 12340
496 Ga0496123_0001857 3300048926 Bacteria 27725
497 Ga0496123_0054801 3300048926 Bacteria 2621
498 Ga0496124_0009567 3300048927 Bacteria 9958
499 Ga0496124_0010958 3300048927 Bacteria 9116
500 Ga0496124_0032442 3300048927 Bacteria 4611
501 Ga0496124_0054261 3300048927 Bacteria 3393
502 Ga0496124_0109588 3300048927 Bacteria 2225
503 Ga0496124_0348345 3300048927 Bacteria 1049
504 Ga0496124_0795686 3300048927 Bacteria 586
505 Ga0496125_0159321 3300048928 Bacteria 1536
506 Ga0496125_0201002 3300048928 Bacteria 1304
507 Ga0496125_0219557 3300048928 Bacteria 1226
508 Ga0495678_000162 3300049459 Bacteria 79674
509 Ga0495678_000293 3300049459 Bacteria 54963
510 Ga0495678_001013 3300049459 Bacteria 24008
511 Ga0495678_006351 3300049459 Bacteria 6303
512 Ga0495678_016414 3300049459 Bacteria 3386
513 Ga0495678_106489 3300049459 Bacteria 963
514 Ga0495678_165978 3300049459 Bacteria 702
515 Ga0495682_0000509 3300049460 Bacteria 26895
516 Ga0495682_0110451 3300049460 Bacteria 985
517 Ga0501313_006245 3300049529 Bacteria 1285
518 Ga0501315_002804 3300049531 Bacteria 1684
519 Ga0501315_068580 3300049531 Bacteria 585
520 Ga0501316_001139 3300049532 Bacteria 2168
521 Ga0501034_0765014 3300049571 Bacteria 860
522 Ga0501046_0000226 3300049580 Bacteria 58757
523 Ga0501047_0000302 3300049581 Bacteria 56851
524 Ga0501047_0151277 3300049581 Bacteria 2197
525 Ga0501048_0003939 3300049582 Bacteria 11284
526 Ga0501238_056850 3300049671 Bacteria 592
527 Ga0501250_068550 3300049680 Bacteria 581
528 Ga0501279_006268 3300049775 Bacteria 1570
529 Ga0501035_0003370 3300049822 Bacteria 15295
530 nmdc:mga06z11_205728_c1 3300050494 Bacteria 1145
531 nmdc:mga07m45_103067_c1 3300050496 Bacteria 1376
532 Ga0500618_029093 3300053125 Bacteria 1305
533 Ga0500619_000084 3300053154 Bacteria 26259
534 Ga0500587_003214 3300053739 Bacteria 2298
535 Ga0590075_100288 3300059424 Bacteria 754
536 Ga0587068_015875 3300059641 Bacteria 1189
537 Ga0466962_0283775 3300061719 Bacteria 817
538 Ga0466962_0374721 3300061719 Bacteria 710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0000763 Ga0395900_0000763_1250_1768 121
2 3300038443 Ga0395901_0270960 Ga0395901_0270960_171_686 121
3 3300048904 Ga0496101_0666171 Ga0496101_0666171_174_692 121
4 3300048905 Ga0496102_0021536 Ga0496102_0021536_1326_1844 121
5 3300048906 Ga0496103_0050725 Ga0496103_0050725_1246_1764 121
6 3300048906 Ga0496103_0964971 Ga0496103_0964971_75_515 121
7 3300048912 Ga0496109_0098527 Ga0496109_0098527_415_930 121
8 3300048913 Ga0496110_0314764 Ga0496110_0314764_497_1012 121
9 3300046516 Ga0495628_1040392 Ga0495628_1040392_106_549 122
10 3300047444 Ga0495675_0129851 Ga0495675_0129851_21_464 122
11 3300048088 Ga0495602_1016587 Ga0495602_1016587_20_463 122
12 3300048912 Ga0496109_0067239 Ga0496109_0067239_2110_2625 122
13 3300003759 Ga0055525_1000047 Ga0055525_100004760 123
14 3300005339 Ga0070660_100436355 Ga0070660_1004363552 123
15 3300005366 Ga0070659_100411039 Ga0070659_1004110392 123
16 3300005457 Ga0070662_100746708 Ga0070662_1007467082 123
17 3300028794 Ga0307515_10002386 Ga0307515_1000238629 123
18 3300030522 Ga0307512_10247649 Ga0307512_102476492 123
19 3300031507 Ga0307509_10241816 Ga0307509_102418162 123
20 3300031616 Ga0307508_10000194 Ga0307508_100001948 123
21 3300031649 Ga0307514_10014297 Ga0307514_100142975 123
22 3300033179 Ga0307507_10011647 Ga0307507_100116478 123
23 3300042008 Ga0439450_160617 Ga0439450_160617_79_576 123
24 3300046474 Ga0495605_0016225 Ga0495605_0016225_857_1378 123
25 3300046474 Ga0495605_0344993 Ga0495605_0344993_126_611 123
26 3300046500 Ga0495596_0001049 Ga0495596_0001049_393_914 123
27 3300046524 Ga0495648_0000863 Ga0495648_0000863_30655_31176 123
28 3300046538 Ga0495609_0053355 Ga0495609_0053355_714_1235 123
29 3300046794 Ga0495589_0007566 Ga0495589_0007566_677_1198 123
30 3300047320 Ga0495672_0024758 Ga0495672_0024758_2293_2814 123
31 3300047323 Ga0495683_0008513 Ga0495683_0008513_1105_1626 123
32 3300048091 Ga0495626_0141914 Ga0495626_0141914_349_870 123
33 3300005327 Ga0070658_10187716 Ga0070658_101877162 124
34 3300005563 Ga0068855_100081836 Ga0068855_1000818364 124
35 3300005616 Ga0068852_100172577 Ga0068852_1001725772 124
36 3300009148 Ga0105243_10125915 Ga0105243_101259154 124
37 3300025230 Ga0209563_100003 Ga0209563_100003590 124
38 3300025253 Ga0209677_102029 Ga0209677_1020298 124
39 3300025254 Ga0209148_1001353 Ga0209148_100135311 124
40 3300025909 Ga0207705_10074561 Ga0207705_100745612 124
41 3300025909 Ga0207705_10421702 Ga0207705_104217022 124
42 3300025919 Ga0207657_10003522 Ga0207657_1000352213 124
43 3300025933 Ga0207706_10106679 Ga0207706_101066793 124
44 3300025949 Ga0207667_10018225 Ga0207667_100182254 124
45 3300037471 Ga0395905_0409058 Ga0395905_0409058_369_887 124
46 3300044656 Ga0466969_0075719 Ga0466969_0075719_268_786 124
47 3300044658 Ga0466972_0148977 Ga0466972_0148977_202_720 124
48 3300044683 Ga0466965_0091692 Ga0466965_0091692_23_541 124
49 3300044684 Ga0466966_0041914 Ga0466966_0041914_1528_2046 124
50 3300044684 Ga0466966_0757039 Ga0466966_0757039_27_545 124
51 3300044694 Ga0466963_0032740 Ga0466963_0032740_443_961 124
52 3300044842 Ga0466957_0027093 Ga0466957_0027093_13_531 124
53 3300044901 Ga0466960_0114381 Ga0466960_0114381_836_1354 124
54 3300045836 Ga0466958_0064190 Ga0466958_0064190_387_905 124
55 3300045836 Ga0466958_0098425 Ga0466958_0098425_171_686 124
56 3300045976 Ga0466967_0001164 Ga0466967_0001164_995_1513 124
57 3300045976 Ga0466967_0250612 Ga0466967_0250612_1016_1534 124
58 3300046453 Ga0495627_006421 Ga0495627_006421_2716_3219 124
59 3300046500 Ga0495596_0005896 Ga0495596_0005896_4490_4993 124
60 3300046500 Ga0495596_0007439 Ga0495596_0007439_2929_3432 124
61 3300046506 Ga0495583_0001243 Ga0495583_0001243_24064_24567 124
62 3300046507 Ga0495606_0063852 Ga0495606_0063852_282_785 124
63 3300046507 Ga0495606_0149490 Ga0495606_0149490_703_1206 124
64 3300046513 Ga0495616_0046097 Ga0495616_0046097_11_514 124
65 3300046519 Ga0495632_0000203 Ga0495632_0000203_8949_9452 124
66 3300046525 Ga0495663_0205456 Ga0495663_0205456_161_664 124
67 3300046528 Ga0495642_0074589 Ga0495642_0074589_880_1383 124
68 3300046616 Ga0495668_0113973 Ga0495668_0113973_979_1464 124
69 3300046648 Ga0495611_0461690 Ga0495611_0461690_18_521 124
70 3300046674 Ga0495588_0012983 Ga0495588_0012983_818_1321 124
71 3300046692 Ga0495671_0038943 Ga0495671_0038943_1496_1999 124
72 3300046694 Ga0495649_0013209 Ga0495649_0013209_3941_4444 124
73 3300046694 Ga0495649_0043540 Ga0495649_0043540_1527_2030 124
74 3300047323 Ga0495683_0083777 Ga0495683_0083777_716_1219 124
75 3300047443 Ga0495687_057275 Ga0495687_057275_801_1304 124
76 3300047470 Ga0495681_0001449 Ga0495681_0001449_8518_9021 124
77 3300048903 Ga0496100_0122580 Ga0496100_0122580_1191_1709 124
78 3300048927 Ga0496124_0010958 Ga0496124_0010958_3178_3696 124
79 3300049459 Ga0495678_000293 Ga0495678_000293_51217_51720 124
80 3300049459 Ga0495678_001013 Ga0495678_001013_862_1365 124
81 3300049460 Ga0495682_0000509 Ga0495682_0000509_722_1225 124
82 3300049671 Ga0501238_056850 Ga0501238_056850_97_543 124
83 3300005339 Ga0070660_100049675 Ga0070660_1000496752 125
84 3300005339 Ga0070660_100184814 Ga0070660_1001848142 125
85 3300005344 Ga0070661_100108999 Ga0070661_1001089993 125
86 3300005455 Ga0070663_100109839 Ga0070663_1001098392 125
87 3300005543 Ga0070672_100593160 Ga0070672_1005931602 125
88 3300005564 Ga0070664_100098391 Ga0070664_1000983912 125
89 3300005614 Ga0068856_100226794 Ga0068856_1002267942 125
90 3300006881 Ga0068865_100236463 Ga0068865_1002364632 125
91 3300009098 Ga0105245_10110816 Ga0105245_101108162 125
92 3300009174 Ga0105241_10583003 Ga0105241_105830032 125
93 3300009176 Ga0105242_10022993 Ga0105242_100229934 125
94 3300009545 Ga0105237_10280296 Ga0105237_102802963 125
95 3300009551 Ga0105238_10187663 Ga0105238_101876632 125
96 3300013102 Ga0157371_10502872 Ga0157371_105028722 125
97 3300013296 Ga0157374_10918875 Ga0157374_109188752 125
98 3300025911 Ga0207654_10061273 Ga0207654_100612732 125
99 3300025914 Ga0207671_10143141 Ga0207671_101431413 125
100 3300025919 Ga0207657_10032076 Ga0207657_100320766 125
101 3300025919 Ga0207657_10215831 Ga0207657_102158312 125
102 3300025924 Ga0207694_10106979 Ga0207694_101069793 125
103 3300025927 Ga0207687_10467552 Ga0207687_104675522 125
104 3300025932 Ga0207690_10104052 Ga0207690_101040522 125
105 3300025934 Ga0207686_10002979 Ga0207686_100029792 125
106 3300025938 Ga0207704_10159109 Ga0207704_101591092 125
107 3300026067 Ga0207678_10669588 Ga0207678_106695881 125
108 3300026078 Ga0207702_11169880 Ga0207702_111698802 125
109 3300026142 Ga0207698_10353097 Ga0207698_103530972 125
110 3300037312 Ga0395899_0078926 Ga0395899_0078926_558_1076 125
111 3300037418 Ga0395900_0382423 Ga0395900_0382423_212_730 125
112 3300037466 Ga0395898_0056317 Ga0395898_0056317_1880_2398 125
113 3300038443 Ga0395901_0053904 Ga0395901_0053904_1821_2339 125
114 3300038443 Ga0395901_1425133 Ga0395901_1425133_38_556 125
115 3300038443 Ga0395901_1645216 Ga0395901_1645216_38_556 125
116 3300039447 Ga0436361_0674642 Ga0436361_0674642_21_470 125
117 3300042157 Ga0439458_0134152 Ga0439458_0134152_124_642 125
118 3300044656 Ga0466969_0102468 Ga0466969_0102468_491_1009 125
119 3300044683 Ga0466965_0008112 Ga0466965_0008112_1008_1526 125
120 3300044684 Ga0466966_0053136 Ga0466966_0053136_877_1395 125
121 3300044684 Ga0466966_0058430 Ga0466966_0058430_867_1385 125
122 3300044693 Ga0466961_0116076 Ga0466961_0116076_529_1047 125
123 3300044706 Ga0466964_0000163 Ga0466964_0000163_35_553 125
124 3300044842 Ga0466957_0000007 Ga0466957_0000007_26146_26664 125
125 3300044842 Ga0466957_0098671 Ga0466957_0098671_271_789 125
126 3300044901 Ga0466960_0643677 Ga0466960_0643677_34_552 125
127 3300045049 Ga0466959_0029414 Ga0466959_0029414_1233_1751 125
128 3300046455 Ga0495603_0309309 Ga0495603_0309309_116_619 125
129 3300046501 Ga0495607_0001333 Ga0495607_0001333_18235_18753 125
130 3300046513 Ga0495616_0000634 Ga0495616_0000634_7277_7780 125
131 3300046513 Ga0495616_0003494 Ga0495616_0003494_1597_2115 125
132 3300046519 Ga0495632_0000225 Ga0495632_0000225_54076_54579 125
133 3300046522 Ga0495643_0059539 Ga0495643_0059539_241_759 125
134 3300046530 Ga0495654_0230825 Ga0495654_0230825_113_616 125
135 3300046538 Ga0495609_0000030 Ga0495609_0000030_150348_150866 125
136 3300046615 Ga0495656_0059155 Ga0495656_0059155_548_1066 125
137 3300046665 Ga0495661_0000209 Ga0495661_0000209_59210_59728 125
138 3300046674 Ga0495588_0051250 Ga0495588_0051250_892_1395 125
139 3300046680 Ga0495646_0329848 Ga0495646_0329848_84_587 125
140 3300046684 Ga0495669_0001810 Ga0495669_0001810_6698_7201 125
141 3300046794 Ga0495589_0000021 Ga0495589_0000021_150649_151167 125
142 3300047443 Ga0495687_000276 Ga0495687_000276_8065_8583 125
143 3300047445 Ga0495677_0000050 Ga0495677_0000050_59601_60119 125
144 3300048091 Ga0495626_0004146 Ga0495626_0004146_7966_8484 125
145 3300048904 Ga0496101_0602362 Ga0496101_0602362_206_724 125
146 3300048906 Ga0496103_0586246 Ga0496103_0586246_96_614 125
147 3300048907 Ga0496104_0186509 Ga0496104_0186509_426_944 125
148 3300048912 Ga0496109_1022764 Ga0496109_1022764_234_752 125
149 3300048912 Ga0496109_1528157 Ga0496109_1528157_13_531 125
150 3300048915 Ga0496112_0126727 Ga0496112_0126727_919_1437 125
151 3300061719 Ga0466962_0283775 Ga0466962_0283775_39_557 125
152 3300061719 Ga0466962_0374721 Ga0466962_0374721_55_573 125
153 3300031239 Ga0265328_10106892 Ga0265328_101068921 126
154 3300031251 Ga0265327_10000205 Ga0265327_10000205103 126
155 3300037418 Ga0395900_0179082 Ga0395900_0179082_1508_2011 126
156 3300037418 Ga0395900_0446947 Ga0395900_0446947_702_1208 126
157 3300037471 Ga0395905_0132405 Ga0395905_0132405_326_829 126
158 3300042005 Ga0439448_0088639 Ga0439448_0088639_346_852 126
159 3300042008 Ga0439450_093292 Ga0439450_093292_79_585 126
160 3300046460 Ga0495638_0084028 Ga0495638_0084028_807_1310 126
161 3300046460 Ga0495638_0115682 Ga0495638_0115682_507_1007 126
162 3300046491 Ga0495584_0000003 Ga0495584_0000003_301790_302293 126
163 3300046491 Ga0495584_0000657 Ga0495584_0000657_7470_7973 126
164 3300046492 Ga0495585_0000130 Ga0495585_0000130_70509_71012 126
165 3300046492 Ga0495585_0000655 Ga0495585_0000655_23267_23770 126
166 3300046492 Ga0495585_0001776 Ga0495585_0001776_4505_5008 126
167 3300046492 Ga0495585_0008154 Ga0495585_0008154_3636_4139 126
168 3300046501 Ga0495607_0037431 Ga0495607_0037431_1391_1897 126
169 3300046506 Ga0495583_0000235 Ga0495583_0000235_18023_18526 126
170 3300046506 Ga0495583_0007311 Ga0495583_0007311_5658_6158 126
171 3300046507 Ga0495606_0005020 Ga0495606_0005020_637_1140 126
172 3300046507 Ga0495606_0223020 Ga0495606_0223020_312_815 126
173 3300046513 Ga0495616_0000913 Ga0495616_0000913_18669_19172 126
174 3300046513 Ga0495616_0005288 Ga0495616_0005288_3262_3765 126
175 3300046522 Ga0495643_0000171 Ga0495643_0000171_39692_40192 126
176 3300046522 Ga0495643_0014827 Ga0495643_0014827_1561_2067 126
177 3300046524 Ga0495648_0000003 Ga0495648_0000003_360442_360945 126
178 3300046528 Ga0495642_0002169 Ga0495642_0002169_3793_4296 126
179 3300046530 Ga0495654_0070954 Ga0495654_0070954_241_741 126
180 3300046538 Ga0495609_0094040 Ga0495609_0094040_295_798 126
181 3300046558 Ga0495633_0002846 Ga0495633_0002846_879_1382 126
182 3300046558 Ga0495633_0053494 Ga0495633_0053494_553_1056 126
183 3300046616 Ga0495668_0001326 Ga0495668_0001326_730_1233 126
184 3300046665 Ga0495661_0000754 Ga0495661_0000754_18191_18697 126
185 3300046665 Ga0495661_0076015 Ga0495661_0076015_606_1109 126
186 3300046665 Ga0495661_0353460 Ga0495661_0353460_114_614 126
187 3300046691 Ga0495670_0002673 Ga0495670_0002673_7527_8030 126
188 3300046691 Ga0495670_0261024 Ga0495670_0261024_355_858 126
189 3300046810 Ga0495660_0061692 Ga0495660_0061692_568_1071 126
190 3300046810 Ga0495660_0070711 Ga0495660_0070711_586_1089 126
191 3300047323 Ga0495683_0000243 Ga0495683_0000243_25466_25969 126
192 3300047443 Ga0495687_121217 Ga0495687_121217_43_546 126
193 3300047443 Ga0495687_158639 Ga0495687_158639_98_604 126
194 3300047470 Ga0495681_0061130 Ga0495681_0061130_999_1502 126
195 3300047472 Ga0495686_0000474 Ga0495686_0000474_16427_16930 126
196 3300048091 Ga0495626_0074559 Ga0495626_0074559_402_905 126
197 3300059641 Ga0587068_015875 Ga0587068_015875_380_886 126
198 3300003163 Ga0006759J45824_1049560 Ga0006759J45824_10495602 127
199 3300037418 Ga0395900_0284786 Ga0395900_0284786_723_1226 127
200 3300037471 Ga0395905_0491859 Ga0395905_0491859_157_660 127
201 3300044683 Ga0466965_0001236 Ga0466965_0001236_786_1292 127
202 3300044706 Ga0466964_0043842 Ga0466964_0043842_943_1449 127
203 3300046453 Ga0495627_006218 Ga0495627_006218_3464_3967 127
204 3300046474 Ga0495605_0014617 Ga0495605_0014617_954_1457 127
205 3300046491 Ga0495584_0043264 Ga0495584_0043264_214_717 127
206 3300046491 Ga0495584_0299689 Ga0495584_0299689_43_546 127
207 3300046492 Ga0495585_0006830 Ga0495585_0006830_2874_3377 127
208 3300046500 Ga0495596_0029115 Ga0495596_0029115_734_1237 127
209 3300046501 Ga0495607_0056778 Ga0495607_0056778_1673_2176 127
210 3300046501 Ga0495607_0228469 Ga0495607_0228469_109_612 127
211 3300046506 Ga0495583_0014241 Ga0495583_0014241_807_1310 127
212 3300046507 Ga0495606_0015478 Ga0495606_0015478_211_714 127
213 3300046518 Ga0495631_0055205 Ga0495631_0055205_423_926 127
214 3300046519 Ga0495632_0005704 Ga0495632_0005704_1262_1765 127
215 3300046523 Ga0495644_0056827 Ga0495644_0056827_296_799 127
216 3300046528 Ga0495642_0009551 Ga0495642_0009551_742_1245 127
217 3300046528 Ga0495642_0066558 Ga0495642_0066558_365_868 127
218 3300046528 Ga0495642_0111907 Ga0495642_0111907_27_527 127
219 3300046538 Ga0495609_0014277 Ga0495609_0014277_1259_1762 127
220 3300046542 Ga0495597_0007929 Ga0495597_0007929_2193_2696 127
221 3300046542 Ga0495597_0068152 Ga0495597_0068152_429_929 127
222 3300046542 Ga0495597_0369615 Ga0495597_0369615_30_530 127
223 3300046558 Ga0495633_0105444 Ga0495633_0105444_509_1012 127
224 3300046615 Ga0495656_0073127 Ga0495656_0073127_493_996 127
225 3300046615 Ga0495656_0086260 Ga0495656_0086260_296_799 127
226 3300046615 Ga0495656_0366808 Ga0495656_0366808_204_704 127
227 3300046616 Ga0495668_0014413 Ga0495668_0014413_3668_4171 127
228 3300046648 Ga0495611_0008176 Ga0495611_0008176_1657_2160 127
229 3300046648 Ga0495611_0071471 Ga0495611_0071471_402_905 127
230 3300046660 Ga0495625_0080449 Ga0495625_0080449_304_807 127
231 3300046665 Ga0495661_0045380 Ga0495661_0045380_112_615 127
232 3300046691 Ga0495670_0005624 Ga0495670_0005624_2003_2506 127
233 3300046691 Ga0495670_0027250 Ga0495670_0027250_1757_2257 127
234 3300046692 Ga0495671_0071270 Ga0495671_0071270_681_1184 127
235 3300046794 Ga0495589_0016859 Ga0495589_0016859_448_951 127
236 3300046794 Ga0495589_0065818 Ga0495589_0065818_59_562 127
237 3300046810 Ga0495660_0031763 Ga0495660_0031763_1489_1995 127
238 3300047323 Ga0495683_0048631 Ga0495683_0048631_632_1135 127
239 3300047445 Ga0495677_0006637 Ga0495677_0006637_2683_3186 127
240 3300047445 Ga0495677_0092789 Ga0495677_0092789_473_976 127
241 3300047470 Ga0495681_0013429 Ga0495681_0013429_972_1475 127
242 3300048091 Ga0495626_0010493 Ga0495626_0010493_448_951 127
243 3300048091 Ga0495626_0031911 Ga0495626_0031911_1523_2023 127
244 3300048091 Ga0495626_0065292 Ga0495626_0065292_976_1476 127
245 3300048903 Ga0496100_0349669 Ga0496100_0349669_111_617 127
246 3300048911 Ga0496108_0589081 Ga0496108_0589081_407_925 127
247 3300048928 Ga0496125_0219557 Ga0496125_0219557_310_828 127
248 3300049459 Ga0495678_006351 Ga0495678_006351_4203_4706 127
249 3300049459 Ga0495678_165978 Ga0495678_165978_149_652 127
250 3300025919 Ga0207657_10272440 Ga0207657_102724402 128
251 3300044656 Ga0466969_0186935 Ga0466969_0186935_224_739 128
252 3300044765 Ga0466970_0048703 Ga0466970_0048703_489_1004 128
253 3300044765 Ga0466970_0192753 Ga0466970_0192753_147_662 128
254 3300044842 Ga0466957_0106670 Ga0466957_0106670_886_1401 128
255 3300045049 Ga0466959_0287050 Ga0466959_0287050_293_808 128
256 3300046471 Ga0495650_0048992 Ga0495650_0048992_48_551 128
257 3300046474 Ga0495605_0000236 Ga0495605_0000236_58002_58517 128
258 3300046491 Ga0495584_0009984 Ga0495584_0009984_3440_3955 128
259 3300046492 Ga0495585_0068838 Ga0495585_0068838_1394_1909 128
260 3300046501 Ga0495607_0001317 Ga0495607_0001317_19653_20168 128
261 3300046501 Ga0495607_0002811 Ga0495607_0002811_4459_4974 128
262 3300046506 Ga0495583_0000560 Ga0495583_0000560_832_1347 128
263 3300046507 Ga0495606_0213926 Ga0495606_0213926_38_553 128
264 3300046513 Ga0495616_0023002 Ga0495616_0023002_2296_2811 128
265 3300046513 Ga0495616_0084115 Ga0495616_0084115_426_950 128
266 3300046518 Ga0495631_0193837 Ga0495631_0193837_274_789 128
267 3300046519 Ga0495632_0009707 Ga0495632_0009707_1217_1732 128
268 3300046522 Ga0495643_0004286 Ga0495643_0004286_1561_2076 128
269 3300046523 Ga0495644_0006396 Ga0495644_0006396_3772_4287 128
270 3300046528 Ga0495642_0000065 Ga0495642_0000065_8607_9125 128
271 3300046528 Ga0495642_0074366 Ga0495642_0074366_730_1245 128
272 3300046530 Ga0495654_0026371 Ga0495654_0026371_1575_2078 128
273 3300046538 Ga0495609_0089068 Ga0495609_0089068_646_1161 128
274 3300046538 Ga0495609_0119236 Ga0495609_0119236_562_1065 128
275 3300046542 Ga0495597_0008345 Ga0495597_0008345_4561_5064 128
276 3300046542 Ga0495597_0125224 Ga0495597_0125224_394_897 128
277 3300046558 Ga0495633_0010022 Ga0495633_0010022_4118_4633 128
278 3300046616 Ga0495668_0010819 Ga0495668_0010819_1556_2059 128
279 3300046648 Ga0495611_0005947 Ga0495611_0005947_2215_2730 128
280 3300046665 Ga0495661_0034032 Ga0495661_0034032_2215_2730 128
281 3300046694 Ga0495649_0307516 Ga0495649_0307516_221_736 128
282 3300046794 Ga0495589_0011516 Ga0495589_0011516_3715_4230 128
283 3300046794 Ga0495589_0105649 Ga0495589_0105649_186_701 128
284 3300046810 Ga0495660_0000173 Ga0495660_0000173_10313_10828 128
285 3300047320 Ga0495672_0005516 Ga0495672_0005516_7104_7619 128
286 3300047320 Ga0495672_0056799 Ga0495672_0056799_1226_1741 128
287 3300047323 Ga0495683_0015027 Ga0495683_0015027_2872_3387 128
288 3300047323 Ga0495683_0036135 Ga0495683_0036135_798_1301 128
289 3300047323 Ga0495683_0068513 Ga0495683_0068513_520_1035 128
290 3300047443 Ga0495687_000279 Ga0495687_000279_8700_9215 128
291 3300047445 Ga0495677_0001535 Ga0495677_0001535_299_814 128
292 3300047445 Ga0495677_0001924 Ga0495677_0001924_7076_7594 128
293 3300047445 Ga0495677_0004877 Ga0495677_0004877_525_1040 128
294 3300047446 Ga0495679_007740 Ga0495679_007740_2477_2992 128
295 3300047470 Ga0495681_0005424 Ga0495681_0005424_679_1194 128
296 3300048091 Ga0495626_0000624 Ga0495626_0000624_12384_12899 128
297 3300048909 Ga0496106_0007451 Ga0496106_0007451_779_1297 128
298 3300048927 Ga0496124_0009567 Ga0496124_0009567_3593_4108 128
299 3300049459 Ga0495678_016414 Ga0495678_016414_645_1160 128
300 3300049460 Ga0495682_0110451 Ga0495682_0110451_119_634 128
301 3300003322 rootL2_10178613 rootL2_101786133 129
302 3300005457 Ga0070662_100215759 Ga0070662_1002157592 129
303 3300013100 Ga0157373_10231832 Ga0157373_102318322 129
304 3300013105 Ga0157369_10794764 Ga0157369_107947642 129
305 3300014497 Ga0182008_10006642 Ga0182008_100066424 129
306 3300044656 Ga0466969_0161251 Ga0466969_0161251_153_668 129
307 3300044683 Ga0466965_0083980 Ga0466965_0083980_202_717 129
308 3300044684 Ga0466966_0025511 Ga0466966_0025511_2804_3319 129
309 3300045836 Ga0466958_0223926 Ga0466958_0223926_108_623 129
310 3300045976 Ga0466967_0176830 Ga0466967_0176830_37_552 129
311 3300046491 Ga0495584_0000097 Ga0495584_0000097_363_881 129
312 3300046491 Ga0495584_0019199 Ga0495584_0019199_1918_2421 129
313 3300046491 Ga0495584_0027783 Ga0495584_0027783_20_523 129
314 3300046491 Ga0495584_0062019 Ga0495584_0062019_910_1416 129
315 3300046492 Ga0495585_0000807 Ga0495585_0000807_25769_26272 129
316 3300046492 Ga0495585_0037898 Ga0495585_0037898_1734_2237 129
317 3300046500 Ga0495596_0010212 Ga0495596_0010212_1667_2170 129
318 3300046507 Ga0495606_0118496 Ga0495606_0118496_453_971 129
319 3300046513 Ga0495616_0212917 Ga0495616_0212917_230_748 129
320 3300046518 Ga0495631_0005485 Ga0495631_0005485_5821_6324 129
321 3300046518 Ga0495631_0050090 Ga0495631_0050090_82_585 129
322 3300046522 Ga0495643_0063034 Ga0495643_0063034_941_1444 129
323 3300046522 Ga0495643_0170049 Ga0495643_0170049_41_556 129
324 3300046528 Ga0495642_0100954 Ga0495642_0100954_272_775 129
325 3300046531 Ga0495665_0142865 Ga0495665_0142865_691_1194 129
326 3300046533 Ga0495640_0046100 Ga0495640_0046100_515_1018 129
327 3300046538 Ga0495609_0001927 Ga0495609_0001927_1500_2003 129
328 3300046542 Ga0495597_0020828 Ga0495597_0020828_921_1427 129
329 3300046557 Ga0495622_0140563 Ga0495622_0140563_129_632 129
330 3300046615 Ga0495656_0159100 Ga0495656_0159100_55_570 129
331 3300046616 Ga0495668_0258870 Ga0495668_0258870_68_571 129
332 3300046648 Ga0495611_0067521 Ga0495611_0067521_1042_1545 129
333 3300046664 Ga0495659_0056455 Ga0495659_0056455_520_1023 129
334 3300046665 Ga0495661_0000949 Ga0495661_0000949_24849_25352 129
335 3300046665 Ga0495661_0025005 Ga0495661_0025005_3305_3823 129
336 3300046665 Ga0495661_0073542 Ga0495661_0073542_718_1233 129
337 3300046674 Ga0495588_0000062 Ga0495588_0000062_26585_27103 129
338 3300046691 Ga0495670_0001919 Ga0495670_0001919_1052_1555 129
339 3300046691 Ga0495670_0011073 Ga0495670_0011073_3380_3883 129
340 3300046794 Ga0495589_0017109 Ga0495589_0017109_2717_3220 129
341 3300046794 Ga0495589_0044688 Ga0495589_0044688_882_1385 129
342 3300047317 Ga0495604_0218463 Ga0495604_0218463_706_1209 129
343 3300047318 Ga0495636_0001814 Ga0495636_0001814_633_1136 129
344 3300047321 Ga0495676_0012785 Ga0495676_0012785_4733_5236 129
345 3300047443 Ga0495687_000319 Ga0495687_000319_8753_9271 129
346 3300047444 Ga0495675_0268788 Ga0495675_0268788_115_618 129
347 3300047445 Ga0495677_0002264 Ga0495677_0002264_6219_6722 129
348 3300047447 Ga0495685_105384 Ga0495685_105384_18_521 129
349 3300047469 Ga0495673_0018702 Ga0495673_0018702_2897_3400 129
350 3300048091 Ga0495626_0028494 Ga0495626_0028494_1009_1512 129
351 3300048926 Ga0496123_0001857 Ga0496123_0001857_20427_20942 129
352 3300048927 Ga0496124_0054261 Ga0496124_0054261_478_993 129
353 3300048928 Ga0496125_0159321 Ga0496125_0159321_726_1241 129
354 3300049571 Ga0501034_0765014 Ga0501034_0765014_271_786 129
355 3300006173 Ga0070716_100178177 Ga0070716_1001781771 130
356 3300017792 Ga0163161_10065577 Ga0163161_100655772 130
357 3300025933 Ga0207706_10005937 Ga0207706_100059372 130
358 3300025939 Ga0207665_10216039 Ga0207665_102160392 130
359 3300027876 Ga0209974_10002896 Ga0209974_100028963 130
360 3300037312 Ga0395899_0002576 Ga0395899_0002576_12618_13136 130
361 3300037418 Ga0395900_0190798 Ga0395900_0190798_12_530 130
362 3300037418 Ga0395900_0255632 Ga0395900_0255632_552_1070 130
363 3300037466 Ga0395898_0892230 Ga0395898_0892230_276_794 130
364 3300037471 Ga0395905_0072684 Ga0395905_0072684_2009_2527 130
365 3300037471 Ga0395905_0124627 Ga0395905_0124627_1279_1797 130
366 3300037471 Ga0395905_0242639 Ga0395905_0242639_563_1081 130
367 3300038443 Ga0395901_0000097 Ga0395901_0000097_90025_90543 130
368 3300038443 Ga0395901_0082617 Ga0395901_0082617_1629_2147 130
369 3300038443 Ga0395901_0145881 Ga0395901_0145881_594_1112 130
370 3300038443 Ga0395901_0318499 Ga0395901_0318499_240_758 130
371 3300038443 Ga0395901_0449224 Ga0395901_0449224_292_810 130
372 3300046453 Ga0495627_000255 Ga0495627_000255_53175_53678 130
373 3300046459 Ga0495629_0046219 Ga0495629_0046219_955_1458 130
374 3300046463 Ga0495653_0158082 Ga0495653_0158082_23_526 130
375 3300046474 Ga0495605_0000024 Ga0495605_0000024_128890_129393 130
376 3300046492 Ga0495585_0103274 Ga0495585_0103274_998_1501 130
377 3300046499 Ga0495594_0144113 Ga0495594_0144113_689_1192 130
378 3300046518 Ga0495631_0014378 Ga0495631_0014378_813_1316 130
379 3300046524 Ga0495648_0000290 Ga0495648_0000290_1012_1515 130
380 3300046528 Ga0495642_0000125 Ga0495642_0000125_32180_32683 130
381 3300046530 Ga0495654_0039194 Ga0495654_0039194_116_619 130
382 3300046531 Ga0495665_0519442 Ga0495665_0519442_50_553 130
383 3300046535 Ga0495586_0010261 Ga0495586_0010261_1891_2394 130
384 3300046558 Ga0495633_0362432 Ga0495633_0362432_49_558 130
385 3300046665 Ga0495661_0019946 Ga0495661_0019946_3295_3798 130
386 3300046674 Ga0495588_0024193 Ga0495588_0024193_1563_2066 130
387 3300046691 Ga0495670_0175268 Ga0495670_0175268_602_1105 130
388 3300046692 Ga0495671_0016092 Ga0495671_0016092_850_1353 130
389 3300046810 Ga0495660_0040819 Ga0495660_0040819_512_1015 130
390 3300047317 Ga0495604_0028553 Ga0495604_0028553_2916_3419 130
391 3300047322 Ga0495680_0011356 Ga0495680_0011356_2576_3079 130
392 3300047444 Ga0495675_0045991 Ga0495675_0045991_1468_1971 130
393 3300047445 Ga0495677_0017098 Ga0495677_0017098_1567_2070 130
394 3300047673 Ga0495593_0000781 Ga0495593_0000781_16591_17094 130
395 3300048089 Ga0495614_0000519 Ga0495614_0000519_14306_14809 130
396 3300048091 Ga0495626_0128833 Ga0495626_0128833_503_1006 130
397 3300048905 Ga0496102_0000343 Ga0496102_0000343_7374_7877 130
398 3300048918 Ga0496115_0218084 Ga0496115_0218084_843_1346 130
399 3300048924 Ga0496121_0005605 Ga0496121_0005605_1996_2505 130
400 3300048924 Ga0496121_0189393 Ga0496121_0189393_961_1464 130
401 3300049580 Ga0501046_0000226 Ga0501046_0000226_37812_38318 130
402 3300049581 Ga0501047_0000302 Ga0501047_0000302_18491_18997 130
403 3300049581 Ga0501047_0151277 Ga0501047_0151277_506_1024 130
404 3300049582 Ga0501048_0003939 Ga0501048_0003939_1297_1803 130
405 3300049822 Ga0501035_0003370 Ga0501035_0003370_6207_6725 130
406 3300045836 Ga0466958_0448723 Ga0466958_0448723_305_823 131
407 3300046491 Ga0495584_0082372 Ga0495584_0082372_879_1385 131
408 3300046513 Ga0495616_0134870 Ga0495616_0134870_46_552 131
409 3300046522 Ga0495643_0002430 Ga0495643_0002430_11893_12408 131
410 3300046694 Ga0495649_0016261 Ga0495649_0016261_926_1441 131
411 3300047320 Ga0495672_0101997 Ga0495672_0101997_335_841 131
412 3300048091 Ga0495626_0103979 Ga0495626_0103979_452_967 131
413 3300005288 Ga0065714_10119742 Ga0065714_101197422 132
414 3300017792 Ga0163161_10058471 Ga0163161_100584713 132
415 3300046616 Ga0495668_0000155 Ga0495668_0000155_42629_43093 132
416 3300048091 Ga0495626_0029371 Ga0495626_0029371_2113_2628 132
417 3300048924 Ga0496121_0001068 Ga0496121_0001068_40282_40791 132
418 3300049459 Ga0495678_106489 Ga0495678_106489_261_725 132
419 3300047318 Ga0495636_0217557 Ga0495636_0217557_306_815 133
420 3300046615 Ga0495656_0048541 Ga0495656_0048541_659_1168 135
421 3300048090 Ga0495615_0018392 Ga0495615_0018392_803_1312 135
422 3300049531 Ga0501315_068580 Ga0501315_068580_85_564 135
423 3300006178 Ga0075367_10151836 Ga0075367_101518362 136
424 3300028794 Ga0307515_10000381 Ga0307515_1000038135 136
425 3300028794 Ga0307515_10009310 Ga0307515_1000931015 136
426 3300030522 Ga0307512_10064991 Ga0307512_100649913 136
427 3300031456 Ga0307513_10009505 Ga0307513_100095052 136
428 3300031730 Ga0307516_10009770 Ga0307516_100097704 136
429 3300041443 Ga0451789_0916289 Ga0451789_0916289_971_1486 136
430 3300041451 Ga0451791_0523573 Ga0451791_0523573_316_831 136
431 3300041456 Ga0451795_0697288 Ga0451795_0697288_339_854 136
432 3300041458 Ga0451798_0428385 Ga0451798_0428385_550_1065 136
433 3300041459 Ga0451800_0130513 Ga0451800_0130513_218_733 136
434 3300041491 Ga0451833_0498765 Ga0451833_0498765_81_596 136
435 3300041498 Ga0451841_1119001 Ga0451841_1119001_1386_1901 136
436 3300041505 Ga0451849_0995850 Ga0451849_0995850_22_537 136
437 3300041509 Ga0451843_0325161 Ga0451843_0325161_141_656 136
438 3300041512 Ga0451853_0705861 Ga0451853_0705861_1826_2341 136
439 3300046519 Ga0495632_0016996 Ga0495632_0016996_2516_3031 136
440 3300046522 Ga0495643_0039456 Ga0495643_0039456_1643_2158 136
441 3300046616 Ga0495668_0281079 Ga0495668_0281079_303_818 136
442 3300046683 Ga0495658_0030410 Ga0495658_0030410_2331_2846 136
443 3300047472 Ga0495686_0021085 Ga0495686_0021085_3765_4280 136
444 3300050494 nmdc:mga06z11_205728_c1 nmdc:mga06z11_205728_c1_189_704 136
445 3300050496 nmdc:mga07m45_103067_c1 nmdc:mga07m45_103067_c1_275_790 136
446 3300053154 Ga0500619_000084 Ga0500619_000084_3279_3794 136
447 3300053739 Ga0500587_003214 Ga0500587_003214_1082_1597 136
448 3300048927 Ga0496124_0032442 Ga0496124_0032442_3621_4130 137
449 3300014497 Ga0182008_10000228 Ga0182008_1000022816 138
450 3300015261 Ga0182006_1000142 Ga0182006_100014216 138
451 3300015262 Ga0182007_10000231 Ga0182007_1000023113 138
452 3300015265 Ga0182005_1000090 Ga0182005_100009016 138
453 3300048914 Ga0496111_0022480 Ga0496111_0022480_2967_3476 138
454 3300048919 Ga0496116_0032098 Ga0496116_0032098_1066_1575 138
455 3300048920 Ga0496117_0000045 Ga0496117_0000045_273062_273571 138
456 3300048921 Ga0496118_0000041 Ga0496118_0000041_273062_273571 138
457 3300048924 Ga0496121_0002658 Ga0496121_0002658_22779_23288 138
458 3300048925 Ga0496122_0007303 Ga0496122_0007303_2243_2752 138
459 3300048926 Ga0496123_0054801 Ga0496123_0054801_1361_1870 138
460 3300048928 Ga0496125_0201002 Ga0496125_0201002_124_633 138
461 iso_pu_bacteria 2808606418 2809142778 139
462 iso_pu_bacteria 2842711865 2842712731 139
463 3300046559 Ga0495667_0178336 Ga0495667_0178336_520_1017 140
464 iso_pu_bacteria 2599185189 2599510253 140
465 iso_pu_bacteria 2857558681 2857564495 140
466 iso_pu_bacteria 2513237150 2513952380 141
467 iso_pu_bacteria 2585428062 2587754525 141
468 iso_pu_bacteria 2600255292 2601667459 141
469 iso_pu_bacteria 2643221664 2644355782 141
470 iso_pu_bacteria 2738541280 2738742156 141
471 iso_pu_bacteria 2738541300 2738841321 141
472 iso_pu_bacteria 2738541357 2739153887 141
473 iso_pu_bacteria 2738543003 2739195807 141
474 iso_pu_bacteria 2738543018 2739272191 141
475 iso_pu_bacteria 2738543026 2739322283 141
476 iso_pu_bacteria 2738543029 2739340524 141
477 iso_pu_bacteria 2738543030 2739341235 141
478 iso_pu_bacteria 2857547612 2857551316 141
479 iso_pu_bacteria 2857547612 2857551819 141
480 iso_pu_bacteria 2904424332 2904425200 141
481 iso_pu_bacteria 2904424332 2904426316 141
482 iso_pu_bacteria 2919476304 2919477898 141
483 iso_pu_bacteria 2932410948 2932411071 141
484 iso_pu_bacteria 2932410948 2932416460 141
485 iso_pu_bacteria 2932416698 2932417139 141
486 iso_pu_bacteria 2932416698 2932419362 141
487 3300002987 JGI25159J45721_1004405 JGI25159J45721_10044051 142
488 3300003771 Ga0055526_1003332 Ga0055526_10033325 142
489 3300003773 Ga0055537_1000248 Ga0055537_100024820 142
490 3300003775 Ga0055524_1005175 Ga0055524_10051752 142
491 3300003784 Ga0055534_1000318 Ga0055534_100031823 142
492 3300003790 Ga0055528_1000116 Ga0055528_10001165 142
493 3300004625 Ga0055543_1006681 Ga0055543_10066814 142
494 3300005262 Ga0065165_1000630 Ga0065165_100063022 142
495 3300009177 Ga0105248_11456117 Ga0105248_114561171 142
496 3300025208 Ga0209436_108583 Ga0209436_1085831 142
497 3300025263 Ga0209565_1000009 Ga0209565_100000978 142
498 3300025273 Ga0209673_1000019 Ga0209673_1000019305 142
499 3300025284 Ga0209130_1003480 Ga0209130_10034801 142
500 3300025291 Ga0209675_1000028 Ga0209675_100002852 142
501 3300025295 Ga0209564_1000058 Ga0209564_1000058243 142
502 3300025299 Ga0209256_1000093 Ga0209256_1000093104 142
503 3300025302 Ga0207426_1036634 Ga0207426_10366342 142
504 3300046491 Ga0495584_0021517 Ga0495584_0021517_1007_1501 142
505 3300046501 Ga0495607_0013597 Ga0495607_0013597_4251_4745 142
506 3300046506 Ga0495583_0015784 Ga0495583_0015784_2745_3239 142
507 3300046513 Ga0495616_0038749 Ga0495616_0038749_844_1338 142
508 3300046538 Ga0495609_0000140 Ga0495609_0000140_18905_19399 142
509 3300046616 Ga0495668_0014502 Ga0495668_0014502_1802_2296 142
510 3300046660 Ga0495625_0094653 Ga0495625_0094653_1544_2038 142
511 3300046664 Ga0495659_0115174 Ga0495659_0115174_90_584 142
512 3300046684 Ga0495669_0005892 Ga0495669_0005892_49_543 142
513 3300047318 Ga0495636_0007941 Ga0495636_0007941_2253_2747 142
514 3300047443 Ga0495687_082261 Ga0495687_082261_718_1212 142
515 3300047446 Ga0495679_013266 Ga0495679_013266_1902_2396 142
516 3300047447 Ga0495685_001691 Ga0495685_001691_4765_5259 142
517 3300048918 Ga0496115_0043328 Ga0496115_0043328_1932_2435 142
518 3300048918 Ga0496115_0423373 Ga0496115_0423373_102_605 143
519 3300053125 Ga0500618_029093 Ga0500618_029093_694_1188 143
520 3300003775 Ga0055524_1000021 Ga0055524_1000021206 144
521 3300005262 Ga0065165_1032915 Ga0065165_10329152 144
522 3300025295 Ga0209564_1021418 Ga0209564_10214182 144
523 3300025299 Ga0209256_1000044 Ga0209256_1000044289 144
524 3300047320 Ga0495672_0180540 Ga0495672_0180540_120_626 144
525 3300048914 Ga0496111_0715479 Ga0496111_0715479_53_568 144
526 3300002774 JGI25150J39212_1002686 JGI25150J39212_10026864 145
527 3300005337 Ga0070682_100577336 Ga0070682_1005773362 145
528 3300025245 Ga0207425_1000318 Ga0207425_100031826 145
529 3300025294 Ga0209025_1003609 Ga0209025_10036095 145
530 3300025297 Ga0209758_1000675 Ga0209758_10006755 145
531 3300031548 Ga0307408_100000735 Ga0307408_10000073519 145
532 3300035114 Ga0373939_0032490 Ga0373939_0032490_610_1110 145
533 3300046460 Ga0495638_0084275 Ga0495638_0084275_289_798 145
534 3300046471 Ga0495650_0000477 Ga0495650_0000477_22639_23139 145
535 3300046471 Ga0495650_0013865 Ga0495650_0013865_3244_3744 145
536 3300046474 Ga0495605_0000044 Ga0495605_0000044_97066_97566 145
537 3300046501 Ga0495607_0014224 Ga0495607_0014224_3946_4446 145
538 3300046501 Ga0495607_0093853 Ga0495607_0093853_112_612 145
539 3300046507 Ga0495606_0000229 Ga0495606_0000229_56834_57334 145
540 3300046507 Ga0495606_0000537 Ga0495606_0000537_45215_45724 145
541 3300046507 Ga0495606_0002327 Ga0495606_0002327_617_1117 145
542 3300046512 Ga0495610_0003072 Ga0495610_0003072_4223_4723 145
543 3300046558 Ga0495633_0027799 Ga0495633_0027799_1613_2113 145
544 3300046616 Ga0495668_0000118 Ga0495668_0000118_49791_50291 145
545 3300046616 Ga0495668_0002548 Ga0495668_0002548_155_655 145
546 3300046692 Ga0495671_0000001 Ga0495671_0000001_406160_406660 145
547 3300047320 Ga0495672_0000480 Ga0495672_0000480_13758_14267 145
548 3300047469 Ga0495673_0000006 Ga0495673_0000006_787659_788159 145
549 3300047472 Ga0495686_0010651 Ga0495686_0010651_489_989 145
550 3300048905 Ga0496102_0015304 Ga0496102_0015304_672_1187 145
551 3300048905 Ga0496102_0137485 Ga0496102_0137485_186_695 145
552 3300048919 Ga0496116_0037708 Ga0496116_0037708_1777_2277 145
553 3300048922 Ga0496119_0223290 Ga0496119_0223290_144_656 145
554 3300048927 Ga0496124_0109588 Ga0496124_0109588_1638_2138 145
555 3300048927 Ga0496124_0348345 Ga0496124_0348345_465_965 145
556 3300048927 Ga0496124_0795686 Ga0496124_0795686_49_549 145
557 3300049459 Ga0495678_000162 Ga0495678_000162_65574_66083 145
558 3300049529 Ga0501313_006245 Ga0501313_006245_516_1037 145
559 3300049531 Ga0501315_002804 Ga0501315_002804_516_1037 145
560 3300049532 Ga0501316_001139 Ga0501316_001139_648_1169 145
561 3300049680 Ga0501250_068550 Ga0501250_068550_47_559 145
562 3300049775 Ga0501279_006268 Ga0501279_006268_952_1473 145
563 3300059424 Ga0590075_100288 Ga0590075_100288_70_585 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05591

T6SS_VipA

Type VI secretion system, VipA, VC_A0107 or Hcp2

11

165

0.98

Feature Viewer

pLDDT pTM Quality
67.03 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map