F464065

General Info

Members Datasets Scaffolds Average Seq Length
563 310 514 270

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10022668|Ga0207428_100226686
Length 308
Sequence MLCAVSFNRYGRLYYFDAGDLSPSVGDKVLVPTDDGPEVAECVWAPQWVDDAGDPPRLVGLAGPDDLRRDELLRKRKAEAKVAAKKLIREHDLPMKVVAIDHVLDSGAGQGPRTTIYFTAPHRVDFRSLVRDLGATLHCRVELRQLSARDSARVQGGIGSCGRDLCCATFLTDFEPVTIRMAKDQDLPLNPLRISKYEHPLYQQFQASAPAVGSKVTTPEGAGRVVGHSVPRDAVIVRMDADGSRCACSRASVCGPRRSHASTTTPDRIGRIAPELHHHGYRTKPAEFLQLAAQPPHRDLGRLPARRR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
12 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
13 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
14 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
15 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
16 2855683550 Micromonospora sp. RP3T Isolate Unclassified
17 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
18 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
19 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
20 2858868258 Micromonospora sp. MH33 Isolate Unclassified
21 2858882152 Micromonospora noduli MED15 Isolate Nodule
22 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
23 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
24 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
25 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
26 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
27 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
28 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
29 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
30 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
31 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
32 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
33 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
34 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
35 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
36 2902582711 Micromonospora sp. AP08 Isolate Unclassified
37 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
38 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
39 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
40 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
227 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
295 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
296 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
301 649633069 Micromonospora sp. L5 Isolate Unclassified
302 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
303 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
304 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
305 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
306 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
307 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
308 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
309 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
310 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.7
Metatranscriptomes 1.6
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 1.24
Rhizoplane 4.26
Rhizosphere 83.66
Stem 0
Stem Tuber 0
Unclassified 9.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004885 3300002459 Bacteria 2729
2 JGI25406J46586_10040232 3300003203 Bacteria 1659
3 JGI25406J46586_10048764 3300003203 Bacteria 1433
4 JGI25405J52794_10005723 3300003911 Bacteria 2251
5 Ga0070658_10000219 3300005327 Bacteria 50822
6 Ga0070658_10010490 3300005327 Bacteria 7429
7 Ga0070658_10014920 3300005327 Bacteria 6224
8 Ga0070658_10061906 3300005327 Bacteria 3049
9 Ga0070658_10167350 3300005327 Bacteria 1846
10 Ga0070683_100023680 3300005329 Bacteria 5495
11 Ga0070683_100231291 3300005329 Bacteria 1757
12 Ga0070683_100284029 3300005329 Bacteria 1574
13 Ga0070670_100407499 3300005331 Bacteria 1201
14 Ga0068869_100002673 3300005334 Bacteria 10775
15 Ga0068869_100006852 3300005334 Bacteria 7248
16 Ga0070680_100000598 3300005336 Bacteria 24918
17 Ga0070682_100051576 3300005337 Bacteria 2571
18 Ga0068868_100028409 3300005338 Bacteria 4276
19 Ga0070660_100012378 3300005339 Bacteria 6090
20 Ga0070660_100175611 3300005339 Bacteria 1732
21 Ga0070691_10008421 3300005341 Bacteria 4721
22 Ga0070687_100148093 3300005343 Bacteria 1375
23 Ga0070661_100186002 3300005344 Bacteria 1582
24 Ga0070675_100017178 3300005354 Bacteria 5751
25 Ga0070675_100033965 3300005354 Bacteria 4137
26 Ga0070671_100020284 3300005355 Bacteria 5419
27 Ga0070673_100171767 3300005364 Bacteria 1851
28 Ga0070688_100045077 3300005365 Bacteria 2723
29 Ga0070659_100023220 3300005366 Bacteria 4744
30 Ga0070667_100003511 3300005367 Bacteria 13362
31 Ga0070709_10045946 3300005434 Bacteria 2713
32 Ga0070714_100285342 3300005435 Bacteria 1535
33 Ga0070713_100023572 3300005436 Bacteria 4778
34 Ga0070713_100206640 3300005436 Bacteria 1776
35 Ga0070710_10047482 3300005437 Bacteria 2395
36 Ga0070711_100033159 3300005439 Bacteria 3438
37 Ga0070711_100193319 3300005439 Bacteria 1565
38 Ga0070694_100119512 3300005444 Bacteria 1889
39 Ga0070663_100023909 3300005455 Bacteria 4102
40 Ga0070663_100058855 3300005455 Bacteria 2760
41 Ga0070678_100041576 3300005456 Bacteria 3260
42 Ga0070662_100011919 3300005457 Bacteria 5748
43 Ga0070681_10001670 3300005458 Bacteria 19802
44 Ga0070681_10071836 3300005458 Bacteria 3425
45 Ga0070681_10073233 3300005458 Bacteria 3387
46 Ga0070706_100364107 3300005467 Bacteria 1347
47 Ga0070679_100004190 3300005530 Bacteria 13300
48 Ga0070679_100266462 3300005530 Bacteria 1668
49 Ga0070679_100338578 3300005530 Bacteria 1452
50 Ga0070684_100063813 3300005535 Bacteria 3230
51 Ga0070684_100102844 3300005535 Bacteria 2554
52 Ga0070684_100184433 3300005535 Bacteria 1898
53 Ga0070684_100626849 3300005535 Bacteria 1000
54 Ga0068853_100123875 3300005539 Bacteria 2308
55 Ga0070686_100041704 3300005544 Bacteria 2870
56 Ga0070696_100220830 3300005546 Bacteria 1422
57 Ga0070693_100042318 3300005547 Bacteria 2566
58 Ga0070665_100083665 3300005548 Bacteria 3196
59 Ga0070665_100113354 3300005548 Bacteria 2714
60 Ga0068855_100017264 3300005563 Bacteria 8686
61 Ga0068855_100150709 3300005563 Bacteria 2645
62 Ga0068855_100174058 3300005563 Bacteria 2436
63 Ga0068855_100185522 3300005563 Bacteria 2349
64 Ga0068855_100246508 3300005563 Bacteria 1994
65 Ga0070664_100018698 3300005564 Bacteria 5699
66 Ga0070664_100072223 3300005564 Bacteria 2959
67 Ga0070664_100102720 3300005564 Bacteria 2487
68 Ga0070664_100174888 3300005564 Bacteria 1906
69 Ga0068857_100058690 3300005577 Bacteria 3418
70 Ga0068857_100085414 3300005577 Bacteria 2821
71 Ga0068857_100286997 3300005577 Bacteria 1515
72 Ga0068854_100269589 3300005578 Bacteria 1366
73 Ga0068856_100060731 3300005614 Bacteria 3734
74 Ga0070702_100007680 3300005615 Bacteria 5176
75 Ga0068859_100047612 3300005617 Bacteria 4308
76 Ga0068859_100165337 3300005617 Bacteria 2292
77 Ga0068864_100052366 3300005618 Bacteria 3518
78 Ga0068864_100105688 3300005618 Bacteria 2502
79 Ga0068864_100452422 3300005618 Bacteria 1228
80 Ga0068861_100326012 3300005719 Bacteria 1339
81 Ga0068851_10037250 3300005834 Bacteria 2437
82 Ga0068863_100030947 3300005841 Bacteria 5111
83 Ga0068863_100048574 3300005841 Bacteria 4024
84 Ga0068863_100288198 3300005841 Bacteria 1591
85 Ga0068858_100053829 3300005842 Bacteria 3722
86 Ga0068858_100076748 3300005842 Bacteria 3103
87 Ga0068858_100224169 3300005842 Bacteria 1781
88 Ga0068860_100109361 3300005843 Bacteria 2642
89 Ga0068860_100207786 3300005843 Bacteria 1899
90 Ga0081455_10000353 3300005937 Bacteria 60559
91 Ga0081455_10046586 3300005937 Bacteria 3760
92 Ga0081455_10385175 3300005937 Bacteria 978
93 Ga0081538_10000215 3300005981 Bacteria 64732
94 Ga0081538_10011100 3300005981 Bacteria 7324
95 Ga0081540_1073336 3300005983 Bacteria 1573
96 Ga0081539_10000543 3300005985 Bacteria 77988
97 Ga0081539_10001385 3300005985 Bacteria 41835
98 Ga0081539_10002545 3300005985 Bacteria 25328
99 Ga0081539_10004065 3300005985 Bacteria 16734
100 Ga0081539_10006354 3300005985 Bacteria 11381
101 Ga0081539_10018604 3300005985 Bacteria 4811
102 Ga0081539_10139867 3300005985 Bacteria 1178
103 Ga0070715_10037465 3300006163 Bacteria 2007
104 Ga0097621_100251691 3300006237 Bacteria 1547
105 Ga0075428_100000335 3300006844 Bacteria 46700
106 Ga0075428_100003501 3300006844 Bacteria 17194
107 Ga0075428_100010498 3300006844 Bacteria 10290
108 Ga0075428_100044685 3300006844 Bacteria 4867
109 Ga0075428_100072859 3300006844 Bacteria 3751
110 Ga0075428_100081704 3300006844 Bacteria 3526
111 Ga0075428_100260857 3300006844 Bacteria 1866
112 Ga0075430_100001160 3300006846 Bacteria 21051
113 Ga0075430_100006498 3300006846 Bacteria 9858
114 Ga0075430_100007865 3300006846 Bacteria 9013
115 Ga0075430_100019938 3300006846 Bacteria 5706
116 Ga0075430_100062683 3300006846 Bacteria 3122
117 Ga0075430_100100423 3300006846 Bacteria 2417
118 Ga0075431_100003793 3300006847 Bacteria 14691
119 Ga0075431_100013454 3300006847 Bacteria 8264
120 Ga0075431_100049266 3300006847 Bacteria 4343
121 Ga0075431_100078025 3300006847 Bacteria 3419
122 Ga0075431_100099761 3300006847 Bacteria 2996
123 Ga0075431_100145134 3300006847 Bacteria 2446
124 Ga0075431_100188392 3300006847 Bacteria 2114
125 Ga0075434_100035484 3300006871 Bacteria 4930
126 Ga0075434_100737635 3300006871 Bacteria 1002
127 Ga0075429_100000540 3300006880 Bacteria 28784
128 Ga0075429_100008733 3300006880 Bacteria 8813
129 Ga0075429_100008868 3300006880 Bacteria 8742
130 Ga0075429_100009201 3300006880 Bacteria 8577
131 Ga0075429_100026868 3300006880 Bacteria 4997
132 Ga0075429_100102387 3300006880 Bacteria 2500
133 Ga0075429_100196804 3300006880 Bacteria 1765
134 Ga0068865_100091031 3300006881 Bacteria 2213
135 Ga0075436_100050762 3300006914 Bacteria 2863
136 Ga0097620_100047610 3300006931 Bacteria 4308
137 Ga0097620_100165327 3300006931 Bacteria 2292
138 Ga0105240_10008947 3300009093 Bacteria 14238
139 Ga0105240_10240778 3300009093 Bacteria 2097
140 Ga0105240_10398112 3300009093 Bacteria 1551
141 Ga0111539_10002199 3300009094 Bacteria 26032
142 Ga0111539_10024976 3300009094 Bacteria 7323
143 Ga0105245_10021428 3300009098 Bacteria 5670
144 Ga0105245_10022401 3300009098 Bacteria 5546
145 Ga0105245_10288746 3300009098 Bacteria 1606
146 Ga0105247_10000036 3300009101 Bacteria 175073
147 Ga0105247_10105407 3300009101 Bacteria 1807
148 Ga0105247_10162786 3300009101 Bacteria 1478
149 Ga0114129_10000045 3300009147 Bacteria 105937
150 Ga0114129_10002627 3300009147 Bacteria 25013
151 Ga0114129_10003984 3300009147 Bacteria 20858
152 Ga0114129_10036904 3300009147 Bacteria 6899
153 Ga0114129_10102402 3300009147 Bacteria 3960
154 Ga0114129_10153681 3300009147 Bacteria 3149
155 Ga0114129_10290829 3300009147 Bacteria 2180
156 Ga0114129_10366625 3300009147 Bacteria 1905
157 Ga0114129_10416488 3300009147 Bacteria 1768
158 Ga0105243_10091939 3300009148 Bacteria 2500
159 Ga0105243_10426381 3300009148 Bacteria 1239
160 Ga0105243_10750758 3300009148 Bacteria 956
161 Ga0105248_10009609 3300009177 Bacteria 10647
162 Ga0105248_10053882 3300009177 Bacteria 4512
163 Ga0105248_10071117 3300009177 Bacteria 3908
164 Ga0105237_10293547 3300009545 Bacteria 1628
165 Ga0105239_10081563 3300010375 Bacteria 3560
166 Ga0105239_10318676 3300010375 Bacteria 1753
167 Ga0105239_10713189 3300010375 Bacteria 1147
168 Ga0105246_10141027 3300011119 Bacteria 1812
169 Ga0157373_10083805 3300013100 Bacteria 2247
170 Ga0157370_10057488 3300013104 Bacteria 3698
171 Ga0157369_10005491 3300013105 Bacteria 14730
172 Ga0157369_10095536 3300013105 Bacteria 3171
173 Ga0157369_10145119 3300013105 Bacteria 2510
174 Ga0157369_10189086 3300013105 Bacteria 2164
175 Ga0157369_10300688 3300013105 Bacteria 1669
176 Ga0157374_10180683 3300013296 Bacteria 2061
177 Ga0157372_10301238 3300013307 Bacteria 1865
178 Ga0157372_10440541 3300013307 Bacteria 1518
179 Ga0157372_10888304 3300013307 Bacteria 1034
180 Ga0157375_10092278 3300013308 Bacteria 3092
181 Ga0157375_10318054 3300013308 Bacteria 1721
182 Ga0163163_10022093 3300014325 Bacteria 6018
183 Ga0163163_10046962 3300014325 Bacteria 4242
184 Ga0163163_10050218 3300014325 Bacteria 4108
185 Ga0163163_10321771 3300014325 Bacteria 1600
186 Ga0163163_10323673 3300014325 Bacteria 1595
187 Ga0163163_10533633 3300014325 Bacteria 1236
188 Ga0157377_10009740 3300014745 Bacteria 4729
189 Ga0157377_10029880 3300014745 Bacteria 2947
190 Ga0157379_10072075 3300014968 Bacteria 3091
191 Ga0157379_10084903 3300014968 Bacteria 2837
192 Ga0157379_10105295 3300014968 Bacteria 2532
193 Ga0197907_10050264 3300020069 Bacteria 1351
194 Ga0197907_11297759 3300020069 Bacteria 1276
195 Ga0206356_11158473 3300020070 Bacteria 1348
196 Ga0206356_11835595 3300020070 Bacteria 2722
197 Ga0206354_10030602 3300020081 Bacteria 1180
198 Ga0206354_10040921 3300020081 Bacteria 3507
199 Ga0206354_11448996 3300020081 Bacteria 1275
200 Ga0206353_10916301 3300020082 Bacteria 4266
201 Ga0206353_11313427 3300020082 Bacteria 2970
202 Ga0213875_10190607 3300021388 Bacteria 964
203 Ga0207656_10051834 3300025321 Bacteria 1775
204 Ga0207713_1039965 3300025735 Bacteria 1973
205 Ga0207692_10060266 3300025898 Bacteria 1962
206 Ga0207710_10000040 3300025900 Bacteria 229443
207 Ga0207710_10094285 3300025900 Bacteria 1405
208 Ga0207688_10004224 3300025901 Bacteria 7836
209 Ga0207688_10265416 3300025901 Bacteria 1043
210 Ga0207680_10242205 3300025903 Bacteria 1243
211 Ga0207699_10020992 3300025906 Bacteria 3511
212 Ga0207699_10114260 3300025906 Bacteria 1736
213 Ga0207645_10146821 3300025907 Bacteria 1538
214 Ga0207643_10000053 3300025908 Bacteria 74738
215 Ga0207705_10009887 3300025909 Bacteria 6946
216 Ga0207705_10015045 3300025909 Bacteria 5561
217 Ga0207705_10015307 3300025909 Bacteria 5506
218 Ga0207705_10023752 3300025909 Bacteria 4374
219 Ga0207705_10067476 3300025909 Bacteria 2589
220 Ga0207705_10110851 3300025909 Bacteria 2027
221 Ga0207707_10000513 3300025912 Bacteria 39738
222 Ga0207695_10438553 3300025913 Bacteria 1190
223 Ga0207693_10313147 3300025915 Bacteria 1229
224 Ga0207663_10192400 3300025916 Bacteria 1465
225 Ga0207660_10000944 3300025917 Bacteria 19240
226 Ga0207660_10297629 3300025917 Bacteria 1284
227 Ga0207662_10170592 3300025918 Bacteria 1395
228 Ga0207657_10038670 3300025919 Bacteria 4245
229 Ga0207657_10061114 3300025919 Bacteria 3232
230 Ga0207657_10203550 3300025919 Bacteria 1591
231 Ga0207649_10068196 3300025920 Bacteria 2261
232 Ga0207649_10401480 3300025920 Bacteria 1026
233 Ga0207652_10044851 3300025921 Bacteria 3768
234 Ga0207652_10149054 3300025921 Bacteria 2094
235 Ga0207652_10153509 3300025921 Bacteria 2062
236 Ga0207652_10230566 3300025921 Bacteria 1669
237 Ga0207652_10442736 3300025921 Bacteria 1171
238 Ga0207659_10219050 3300025926 Bacteria 1529
239 Ga0207687_10007086 3300025927 Bacteria 7389
240 Ga0207687_10012027 3300025927 Bacteria 5659
241 Ga0207687_10012616 3300025927 Bacteria 5520
242 Ga0207700_10007220 3300025928 Bacteria 6775
243 Ga0207664_10104961 3300025929 Bacteria 2341
244 Ga0207644_10178593 3300025931 Bacteria 1662
245 Ga0207690_10119866 3300025932 Bacteria 1909
246 Ga0207706_10008112 3300025933 Bacteria 9691
247 Ga0207706_10116609 3300025933 Bacteria 2349
248 Ga0207709_10038033 3300025935 Bacteria 2862
249 Ga0207670_10264023 3300025936 Bacteria 1336
250 Ga0207704_10084502 3300025938 Bacteria 2063
251 Ga0207691_10074494 3300025940 Bacteria 3062
252 Ga0207711_10005568 3300025941 Bacteria 10649
253 Ga0207711_10088769 3300025941 Bacteria 2715
254 Ga0207689_10008415 3300025942 Bacteria 8985
255 Ga0207689_10035736 3300025942 Bacteria 4126
256 Ga0207661_10006016 3300025944 Bacteria 8571
257 Ga0207661_10025539 3300025944 Bacteria 4491
258 Ga0207661_10214564 3300025944 Bacteria 1698
259 Ga0207679_10014567 3300025945 Bacteria 5174
260 Ga0207679_10016182 3300025945 Bacteria 4946
261 Ga0207679_10020020 3300025945 Bacteria 4509
262 Ga0207679_10340923 3300025945 Bacteria 1303
263 Ga0207667_10115487 3300025949 Bacteria 2767
264 Ga0207651_10085598 3300025960 Bacteria 2288
265 Ga0207651_10340137 3300025960 Bacteria 1260
266 Ga0207668_10007753 3300025972 Bacteria 6387
267 Ga0207658_10007263 3300025986 Bacteria 7554
268 Ga0207658_10189260 3300025986 Bacteria 1709
269 Ga0207677_10133796 3300026023 Bacteria 1887
270 Ga0207703_10151051 3300026035 Bacteria 2025
271 Ga0207703_10236515 3300026035 Bacteria 1640
272 Ga0207703_10451162 3300026035 Bacteria 1201
273 Ga0207639_10047229 3300026041 Bacteria 3253
274 Ga0207678_10000099 3300026067 Bacteria 70673
275 Ga0207678_10035385 3300026067 Bacteria 4348
276 Ga0207708_10015752 3300026075 Bacteria 5673
277 Ga0207702_10015082 3300026078 Bacteria 6407
278 Ga0207702_10108042 3300026078 Bacteria 2468
279 Ga0207641_10014688 3300026088 Bacteria 6420
280 Ga0207641_10135843 3300026088 Bacteria 2213
281 Ga0207641_10245438 3300026088 Bacteria 1670
282 Ga0207641_10258086 3300026088 Bacteria 1631
283 Ga0207641_10639445 3300026088 Bacteria 1044
284 Ga0207676_10014125 3300026095 Bacteria 5736
285 Ga0207676_10050396 3300026095 Bacteria 3245
286 Ga0207676_10081721 3300026095 Bacteria 2626
287 Ga0207676_10194699 3300026095 Bacteria 1787
288 Ga0207674_10031996 3300026116 Bacteria 5520
289 Ga0207675_100142277 3300026118 Bacteria 2279
290 Ga0207683_10000434 3300026121 Bacteria 38688
291 Ga0207683_10157326 3300026121 Bacteria 2053
292 Ga0207698_10076082 3300026142 Bacteria 2685
293 Ga0207428_10008340 3300027907 Bacteria 9362
294 Ga0207428_10022668 3300027907 Bacteria 5295
295 Ga0268264_10087773 3300028381 Bacteria 2675
296 Ga0268264_10515990 3300028381 Bacteria 1167
297 Ga0307517_10059944 3300028786 Bacteria 3634
298 Ga0307515_10000038 3300028794 Bacteria 331376
299 Ga0307515_10003884 3300028794 Bacteria 31209
300 Ga0307515_10054394 3300028794 Bacteria 5878
301 Ga0265338_10021383 3300028800 Bacteria 6749
302 Ga0265338_10097786 3300028800 Bacteria 2403
303 Ga0307512_10001168 3300030522 Bacteria 38196
304 Ga0307512_10003072 3300030522 Bacteria 19993
305 Ga0307512_10219958 3300030522 Bacteria 994
306 Ga0265340_10004550 3300031247 Bacteria 7729
307 Ga0265340_10009198 3300031247 Bacteria 5310
308 Ga0265339_10094110 3300031249 Bacteria 1567
309 Ga0265316_10058296 3300031344 Bacteria 3009
310 Ga0307513_10003781 3300031456 Bacteria 20423
311 Ga0307513_10122352 3300031456 Bacteria 2566
312 Ga0307509_10003281 3300031507 Bacteria 24863
313 Ga0307509_10142805 3300031507 Bacteria 2326
314 Ga0307509_10211761 3300031507 Bacteria 1761
315 Ga0307508_10003410 3300031616 Bacteria 16081
316 Ga0307508_10021082 3300031616 Bacteria 5925
317 Ga0307508_10029881 3300031616 Bacteria 4925
318 Ga0307508_10100885 3300031616 Bacteria 2482
319 Ga0307508_10115570 3300031616 Bacteria 2285
320 Ga0265314_10279506 3300031711 Bacteria 945
321 Ga0265342_10022436 3300031712 Bacteria 4013
322 Ga0265342_10065609 3300031712 Bacteria 2127
323 Ga0316576_10165548 3300031727 Bacteria 1668
324 Ga0316578_10134145 3300031728 Bacteria 1490
325 Ga0307516_10004036 3300031730 Bacteria 18403
326 Ga0307516_10023726 3300031730 Bacteria 6277
327 Ga0307516_10084529 3300031730 Bacteria 3012
328 Ga0307405_10000967 3300031731 Bacteria 11535
329 Ga0307405_10016132 3300031731 Bacteria 4066
330 Ga0307405_10041878 3300031731 Bacteria 2784
331 Ga0307413_10007994 3300031824 Bacteria 4958
332 Ga0307413_10066919 3300031824 Bacteria 2244
333 Ga0307413_10133593 3300031824 Bacteria 1703
334 Ga0307413_10410222 3300031824 Bacteria 1064
335 Ga0307410_10353494 3300031852 Bacteria 1175
336 Ga0326468_10000783 3300031889 Bacteria 3193
337 Ga0307406_10009284 3300031901 Bacteria 5510
338 Ga0307406_10071794 3300031901 Bacteria 2270
339 Ga0307406_10101374 3300031901 Bacteria 1962
340 Ga0307407_10004852 3300031903 Bacteria 5769
341 Ga0307407_10116502 3300031903 Bacteria 1686
342 Ga0307412_10142694 3300031911 Bacteria 1756
343 Ga0307409_100033223 3300031995 Bacteria 3752
344 Ga0307409_100034617 3300031995 Bacteria 3691
345 Ga0307409_100069265 3300031995 Bacteria 2794
346 Ga0307409_100363099 3300031995 Bacteria 1370
347 Ga0307416_100001452 3300032002 Bacteria 12889
348 Ga0307416_100051951 3300032002 Bacteria 3278
349 Ga0307416_100086789 3300032002 Bacteria 2669
350 Ga0307416_100188304 3300032002 Bacteria 1943
351 Ga0307414_10384998 3300032004 Bacteria 1214
352 Ga0307415_100000054 3300032126 Bacteria 49124
353 Ga0307415_100048696 3300032126 Bacteria 2861
354 Ga0307415_100076653 3300032126 Bacteria 2371
355 Ga0307415_100135660 3300032126 Bacteria 1871
356 Ga0307415_100216607 3300032126 Bacteria 1532
357 Ga0307415_100370727 3300032126 Bacteria 1212
358 Ga0373934_0029513 3300035086 Bacteria 2142
359 Ga0373951_0000252 3300035091 Bacteria 17713
360 Ga0373932_0062965 3300035112 Bacteria 1132
361 Ga0373953_0016095 3300035117 Bacteria 2725
362 Ga0373956_0042953 3300035119 Bacteria 2011
363 Ga0373942_0058202 3300035207 Bacteria 1101
364 Ga0316574_0199234 3300035398 Bacteria 1286
365 Ga0373935_0058142 3300035692 Bacteria 2469
366 Ga0373947_0324698 3300035725 Bacteria 1030
367 Ga0373937_0205989 3300036401 Bacteria 1850
368 Ga0316584_0056827 3300036712 Bacteria 2929
369 Ga0395899_0247355 3300037312 Bacteria 1225
370 Ga0395900_0065420 3300037418 Bacteria 3735
371 Ga0395900_0292979 3300037418 Bacteria 1616
372 Ga0395898_0018644 3300037466 Bacteria 7075
373 Ga0395898_0021995 3300037466 Bacteria 6460
374 Ga0395898_0117572 3300037466 Bacteria 2547
375 Ga0395898_0399559 3300037466 Bacteria 1310
376 Ga0395898_0578929 3300037466 Bacteria 1065
377 Ga0395905_0009928 3300037471 Bacteria 9274
378 Ga0395905_0074083 3300037471 Bacteria 3191
379 Ga0395905_0110544 3300037471 Bacteria 2581
380 Ga0436364_0831882 3300037853 Bacteria 2096
381 Ga0395901_0131913 3300038443 Bacteria 2625
382 Ga0395901_0150536 3300038443 Bacteria 2445
383 Ga0451791_0953799 3300041451 Bacteria 5145
384 Ga0439448_0008116 3300042005 Bacteria 3067
385 Ga0439459_0019062 3300042438 Bacteria 1296
386 Ga0439440_0022533 3300042993 Bacteria 1428
387 Ga0466961_0029259 3300044693 Bacteria 3542
388 Ga0466963_0009467 3300044694 Bacteria 5867
389 Ga0466963_0021012 3300044694 Bacteria 4113
390 Ga0466971_0028240 3300044719 Bacteria 2511
391 Ga0466960_0010267 3300044901 Bacteria 3887
392 Ga0466958_0059436 3300045836 Bacteria 2326
393 Ga0466967_0018785 3300045976 Bacteria 5538
394 Ga0466967_0147323 3300045976 Bacteria 2197
395 Ga0466967_0224012 3300045976 Bacteria 1788
396 Ga0495627_034953 3300046453 Bacteria 1568
397 Ga0495629_0087909 3300046459 Bacteria 2168
398 Ga0495653_0219307 3300046463 Bacteria 1279
399 Ga0495606_0006212 3300046507 Bacteria 11104
400 Ga0495667_0071955 3300046559 Bacteria 2254
401 Ga0495668_0000395 3300046616 Bacteria 57512
402 Ga0495625_0001063 3300046660 Bacteria 35918
403 Ga0495600_0313882 3300046809 Bacteria 987
404 Ga0495593_0174905 3300047673 Bacteria 1081
405 Ga0495626_0000107 3300048091 Bacteria 109694
406 Ga0496100_0163829 3300048903 Bacteria 1596
407 Ga0496103_0077330 3300048906 Bacteria 2089
408 Ga0496104_0016169 3300048907 Bacteria 6772
409 Ga0496104_0084914 3300048907 Bacteria 3021
410 Ga0496105_0041152 3300048908 Bacteria 3809
411 Ga0496105_0055335 3300048908 Bacteria 3276
412 Ga0496107_0074714 3300048910 Bacteria 2466
413 Ga0496108_0000035 3300048911 Bacteria 154937
414 Ga0496108_0045818 3300048911 Bacteria 3652
415 Ga0496108_0074228 3300048911 Bacteria 2871
416 Ga0496108_0127938 3300048911 Bacteria 2182
417 Ga0496108_0301021 3300048911 Bacteria 1397
418 Ga0496109_0005749 3300048912 Bacteria 10377
419 Ga0496110_0012551 3300048913 Bacteria 6968
420 Ga0496110_0083319 3300048913 Bacteria 2853
421 Ga0496110_0116826 3300048913 Bacteria 2402
422 Ga0496110_0220917 3300048913 Bacteria 1723
423 Ga0496111_0002931 3300048914 Bacteria 10437
424 Ga0496111_0044374 3300048914 Bacteria 3195
425 Ga0496112_0022388 3300048915 Bacteria 6023
426 Ga0496112_0053635 3300048915 Bacteria 3961
427 Ga0496112_0122503 3300048915 Bacteria 2571
428 Ga0496113_0016991 3300048916 Bacteria 5039
429 Ga0496119_0000186 3300048922 Bacteria 87658
430 Ga0496120_0000304 3300048923 Bacteria 81997
431 Ga0496124_0393849 3300048927 Bacteria 964
432 Ga0496126_0152178 3300048929 Bacteria 1982
433 Ga0501032_0003578 3300049569 Bacteria 11848
434 Ga0501033_0265630 3300049570 Bacteria 1214
435 Ga0501034_0438639 3300049571 Bacteria 1225
436 Ga0501036_0574839 3300049572 Bacteria 936
437 Ga0501037_0096450 3300049573 Bacteria 2137
438 Ga0501038_0017880 3300049574 Bacteria 6405
439 Ga0501038_0023492 3300049574 Bacteria 5510
440 Ga0501038_0049926 3300049574 Bacteria 3616
441 Ga0501039_0004539 3300049575 Bacteria 10483
442 Ga0501039_0067023 3300049575 Bacteria 2788
443 Ga0501040_0024912 3300049576 Bacteria 4020
444 Ga0501042_0028397 3300049578 Bacteria 3941
445 Ga0501043_0047579 3300049579 Bacteria 3372
446 Ga0501046_0018478 3300049580 Bacteria 5800
447 Ga0501046_0185615 3300049580 Bacteria 1553
448 Ga0501047_0013129 3300049581 Bacteria 7846
449 Ga0501047_0049959 3300049581 Bacteria 4038
450 Ga0501047_0152481 3300049581 Bacteria 2186
451 Ga0501048_0000026 3300049582 Bacteria 66602
452 Ga0501069_0190817 3300049585 Bacteria 1186
453 Ga0501070_0057013 3300049586 Bacteria 3238
454 Ga0501074_0150288 3300049590 Bacteria 1665
455 Ga0501075_0042542 3300049591 Bacteria 3406
456 Ga0501076_0238479 3300049592 Bacteria 1487
457 Ga0501077_0124809 3300049593 Bacteria 1632
458 Ga0501079_0351801 3300049741 Bacteria 1154
459 Ga0501080_0164046 3300049742 Bacteria 2051
460 Ga0501035_0080495 3300049822 Bacteria 2876
461 Ga0501035_0261171 3300049822 Bacteria 1468
462 Ga0501044_0140710 3300049823 Bacteria 2402
463 Ga0501044_0189557 3300049823 Bacteria 2020
464 Ga0501044_0214942 3300049823 Bacteria 1875
465 nmdc:mga05p37_1002_c1 3300050507 Bacteria 32202
466 nmdc:mga05p37_1721_c1 3300050507 Bacteria 25522
467 nmdc:mga05p37_18034_c1 3300050507 Bacteria 8526
468 nmdc:mga05p37_259459_c1 3300050507 Bacteria 2081
469 nmdc:mga05p37_315356_c1 3300050507 Bacteria 1852
470 nmdc:mga05p37_394612_c1 3300050507 Bacteria 1617
471 nmdc:mga05p37_5306_c2 3300050507 Bacteria 11790
472 nmdc:mga05p37_781582_c1 3300050507 Bacteria 1047
473 nmdc:mga09592_194623_c1 3300050508 Bacteria 1755
474 nmdc:mga09592_215747_c1 3300050508 Bacteria 1663
475 nmdc:mga09592_250715_c1 3300050508 Bacteria 1534
476 nmdc:mga09592_4_c1 3300050508 Bacteria 133185
477 nmdc:mga09592_59855_c1 3300050508 Bacteria 3220
478 nmdc:mga09592_61576_c1 3300050508 Bacteria 2360
479 nmdc:mga09592_64983_c1 3300050508 Bacteria 3089
480 nmdc:mga09592_876_c1 3300050508 Bacteria 23553
481 nmdc:mga09592_97638_c1 3300050508 Bacteria 2514
482 nmdc:mga0qj67_3430_c1 3300050509 Bacteria 11422
483 nmdc:mga0qj67_3571_c1 3300050509 Bacteria 11223
484 nmdc:mga0qj67_3_c2 3300050509 Bacteria 152036
485 nmdc:mga0qj67_56102_c1 3300050509 Bacteria 3122
486 nmdc:mga0qj67_643_c1 3300050509 Bacteria 24061
487 nmdc:mga0qj67_65909_c1 3300050509 Bacteria 2883
488 nmdc:mga0qj67_79715_c1 3300050509 Bacteria 2623
489 nmdc:mga06r32_184_c1 3300050510 Bacteria 45432
490 nmdc:mga06r32_224372_c1 3300050510 Bacteria 1867
491 nmdc:mga06r32_283240_c1 3300050510 Bacteria 1644
492 nmdc:mga06r32_416260_c1 3300050510 Bacteria 1325
493 nmdc:mga06r32_4612_c1 3300050510 Bacteria 12356
494 nmdc:mga06r32_57411_c1 3300050510 Bacteria 3739
495 nmdc:mga06r32_66025_c1 3300050510 Bacteria 3491
496 nmdc:mga06r32_83879_c1 3300050510 Bacteria 3105
497 nmdc:mga06r32_8883_c1 3300050510 Bacteria 9056
498 nmdc:mga08y16_13145_c1 3300050511 Bacteria 8709
499 nmdc:mga08y16_4559_c1 3300050511 Bacteria 14444
500 nmdc:mga08y16_6848_c1 3300050511 Bacteria 11949
501 nmdc:mga0n895_652525_c1 3300050512 Bacteria 1051
502 nmdc:mga08x19_66487_c1 3300050514 Bacteria 2343
503 nmdc:mga0a205_5462_c1 3300050515 Bacteria 11450
504 Ga0495655_0024229 3300053083 Bacteria 1407
505 Ga0495619_0017961 3300053085 Bacteria 4485
506 Ga0500644_0017639 3300053088 Bacteria 2076
507 Ga0500646_0000078 3300053090 Bacteria 27458
508 Ga0500583_0012323 3300053092 Bacteria 3258
509 Ga0500650_0042446 3300053098 Bacteria 2101
510 Ga0500594_0019896 3300053118 Bacteria 1668
511 Ga0500652_006565 3300053131 Bacteria 3754
512 Ga0500588_0000401 3300053146 Bacteria 6788
513 Ga0501082_0115419 3300060353 Bacteria 2325
514 Ga0530510_0023353 3300061734 Bacteria 4407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0074083 Ga0395905_0074083_46_804 235
2 3300014325 Ga0163163_10046962 Ga0163163_100469625 241
3 3300061734 Ga0530510_0023353 Ga0530510_0023353_3467_4300 242
4 3300005327 Ga0070658_10061906 Ga0070658_100619062 244
5 3300025909 Ga0207705_10015045 Ga0207705_100150455 244
6 3300049569 Ga0501032_0003578 Ga0501032_0003578_4662_5483 244
7 3300049574 Ga0501038_0023492 Ga0501038_0023492_419_1240 244
8 3300049580 Ga0501046_0185615 Ga0501046_0185615_715_1536 244
9 3300049581 Ga0501047_0013129 Ga0501047_0013129_86_907 244
10 3300049582 Ga0501048_0000026 Ga0501048_0000026_26850_27671 244
11 3300005983 Ga0081540_1073336 Ga0081540_10733361 246
12 3300009101 Ga0105247_10000036 Ga0105247_1000003643 248
13 3300009177 Ga0105248_10009609 Ga0105248_100096097 248
14 3300025900 Ga0207710_10000040 Ga0207710_1000004091 248
15 3300025941 Ga0207711_10005568 Ga0207711_100055684 248
16 3300048922 Ga0496119_0000186 Ga0496119_0000186_5442_6365 248
17 3300048923 Ga0496120_0000304 Ga0496120_0000304_29023_29946 248
18 3300014325 Ga0163163_10533633 Ga0163163_105336332 249
19 3300044693 Ga0466961_0029259 Ga0466961_0029259_2148_2966 250
20 3300049576 Ga0501040_0024912 Ga0501040_0024912_2407_3273 251
21 3300049741 Ga0501079_0351801 Ga0501079_0351801_232_1098 251
22 3300037418 Ga0395900_0292979 Ga0395900_0292979_445_1416 252
23 3300044719 Ga0466971_0028240 Ga0466971_0028240_947_1747 253
24 3300049574 Ga0501038_0049926 Ga0501038_0049926_1934_2800 253
25 3300049575 Ga0501039_0067023 Ga0501039_0067023_180_1046 253
26 3300049578 Ga0501042_0028397 Ga0501042_0028397_1617_2483 253
27 3300049585 Ga0501069_0190817 Ga0501069_0190817_86_952 253
28 3300049591 Ga0501075_0042542 Ga0501075_0042542_1784_2650 253
29 3300049592 Ga0501076_0238479 Ga0501076_0238479_503_1369 253
30 3300049593 Ga0501077_0124809 Ga0501077_0124809_728_1594 253
31 3300049822 Ga0501035_0080495 Ga0501035_0080495_1580_2446 253
32 3300060353 Ga0501082_0115419 Ga0501082_0115419_1223_2089 253
33 iso_pu_bacteria 2515154088 2515497840 254
34 iso_pu_bacteria 2515154137 2515759573 254
35 iso_pu_bacteria 2515154202 2516085773 254
36 iso_pu_bacteria 2515154203 2516090629 254
37 3300006847 Ga0075431_100049266 Ga0075431_1000492662 255
38 iso_pu_bacteria 2816332119 2816422861 255
39 3300003203 JGI25406J46586_10048764 JGI25406J46586_100487642 256
40 3300005985 Ga0081539_10001385 Ga0081539_1000138511 256
41 3300035117 Ga0373953_0016095 Ga0373953_0016095_1399_2223 256
42 3300037466 Ga0395898_0578929 Ga0395898_0578929_187_996 256
43 3300045836 Ga0466958_0059436 Ga0466958_0059436_1364_2173 256
44 3300047673 Ga0495593_0174905 Ga0495593_0174905_40_864 256
45 3300053085 Ga0495619_0017961 Ga0495619_0017961_1957_2781 256
46 iso_pu_bacteria 2515154129 2515720836 256
47 iso_pu_bacteria 8003870546 8003878280 256
48 iso_pu_bacteria 8055157932 8055159426 256
49 3300005367 Ga0070667_100003511 Ga0070667_10000351111 257
50 3300006844 Ga0075428_100044685 Ga0075428_1000446854 257
51 3300006880 Ga0075429_100026868 Ga0075429_1000268684 257
52 3300009147 Ga0114129_10002627 Ga0114129_1000262715 257
53 3300025986 Ga0207658_10007263 Ga0207658_100072634 257
54 3300037466 Ga0395898_0021995 Ga0395898_0021995_216_1040 257
55 3300050507 nmdc:mga05p37_1002_c1 nmdc:mga05p37_1002_c1_15629_16516 257
56 3300050508 nmdc:mga09592_4_c1 nmdc:mga09592_4_c1_116650_117537 257
57 3300050509 nmdc:mga0qj67_3_c2 nmdc:mga0qj67_3_c2_135384_136271 257
58 3300050510 nmdc:mga06r32_184_c1 nmdc:mga06r32_184_c1_24412_25299 257
59 3300050510 nmdc:mga06r32_66025_c1 nmdc:mga06r32_66025_c1_1899_2771 257
60 iso_pu_bacteria 2675903059 2676484120 257
61 iso_pu_bacteria 2832004796 2832009778 257
62 iso_pu_bacteria 2866065130 2866066776 257
63 3300005344 Ga0070661_100186002 Ga0070661_1001860022 258
64 3300005577 Ga0068857_100085414 Ga0068857_1000854142 258
65 3300005842 Ga0068858_100224169 Ga0068858_1002241692 258
66 3300010375 Ga0105239_10713189 Ga0105239_107131892 258
67 3300013105 Ga0157369_10189086 Ga0157369_101890862 258
68 3300013308 Ga0157375_10318054 Ga0157375_103180542 258
69 3300025909 Ga0207705_10023752 Ga0207705_100237522 258
70 3300026035 Ga0207703_10236515 Ga0207703_102365152 258
71 3300026088 Ga0207641_10258086 Ga0207641_102580862 258
72 3300026095 Ga0207676_10081721 Ga0207676_100817213 258
73 3300045976 Ga0466967_0224012 Ga0466967_0224012_185_1003 258
74 3300048911 Ga0496108_0127938 Ga0496108_0127938_987_1820 258
75 3300049570 Ga0501033_0265630 Ga0501033_0265630_267_1106 258
76 3300049581 Ga0501047_0049959 Ga0501047_0049959_2533_3357 258
77 3300049823 Ga0501044_0140710 Ga0501044_0140710_1228_2052 258
78 iso_pu_bacteria 2501939600 2501942908 258
79 iso_pu_bacteria 2751185782 2753269582 258
80 iso_pu_bacteria 2856858025 2856860115 258
81 iso_pu_bacteria 2858902515 2858905363 258
82 iso_pu_bacteria 2902582711 2902587418 258
83 iso_pu_bacteria 649633069 649810599 258
84 3300005327 Ga0070658_10000219 Ga0070658_100002194 259
85 3300005327 Ga0070658_10014920 Ga0070658_100149205 259
86 3300005336 Ga0070680_100000598 Ga0070680_1000005986 259
87 3300005458 Ga0070681_10001670 Ga0070681_1000167022 259
88 3300005530 Ga0070679_100004190 Ga0070679_1000041909 259
89 3300005530 Ga0070679_100338578 Ga0070679_1003385782 259
90 3300005563 Ga0068855_100017264 Ga0068855_1000172646 259
91 3300005563 Ga0068855_100150709 Ga0068855_1001507092 259
92 3300005563 Ga0068855_100174058 Ga0068855_1001740582 259
93 3300005578 Ga0068854_100269589 Ga0068854_1002695892 259
94 3300009093 Ga0105240_10008947 Ga0105240_100089472 259
95 3300009093 Ga0105240_10240778 Ga0105240_102407782 259
96 3300009098 Ga0105245_10021428 Ga0105245_100214284 259
97 3300009101 Ga0105247_10162786 Ga0105247_101627861 259
98 3300009148 Ga0105243_10091939 Ga0105243_100919392 259
99 3300011119 Ga0105246_10141027 Ga0105246_101410272 259
100 3300013104 Ga0157370_10057488 Ga0157370_100574882 259
101 3300013105 Ga0157369_10005491 Ga0157369_100054912 259
102 3300013105 Ga0157369_10145119 Ga0157369_101451192 259
103 3300013307 Ga0157372_10888304 Ga0157372_108883041 259
104 3300014325 Ga0163163_10323673 Ga0163163_103236731 259
105 3300020069 Ga0197907_10050264 Ga0197907_100502642 259
106 3300020081 Ga0206354_10040921 Ga0206354_100409212 259
107 3300020082 Ga0206353_11313427 Ga0206353_113134273 259
108 3300025909 Ga0207705_10009887 Ga0207705_100098873 259
109 3300025912 Ga0207707_10000513 Ga0207707_1000051340 259
110 3300025913 Ga0207695_10438553 Ga0207695_104385531 259
111 3300025917 Ga0207660_10000944 Ga0207660_100009442 259
112 3300025919 Ga0207657_10061114 Ga0207657_100611142 259
113 3300025921 Ga0207652_10149054 Ga0207652_101490542 259
114 3300025921 Ga0207652_10442736 Ga0207652_104427362 259
115 3300025936 Ga0207670_10264023 Ga0207670_102640232 259
116 3300035086 Ga0373934_0029513 Ga0373934_0029513_1090_1911 259
117 3300037312 Ga0395899_0247355 Ga0395899_0247355_217_1059 259
118 3300037418 Ga0395900_0065420 Ga0395900_0065420_1579_2421 259
119 3300037466 Ga0395898_0399559 Ga0395898_0399559_355_1197 259
120 3300044694 Ga0466963_0009467 Ga0466963_0009467_257_1075 259
121 3300048911 Ga0496108_0301021 Ga0496108_0301021_352_1173 259
122 3300048913 Ga0496110_0116826 Ga0496110_0116826_1284_2108 259
123 3300049579 Ga0501043_0047579 Ga0501043_0047579_2142_2963 259
124 3300049586 Ga0501070_0057013 Ga0501070_0057013_270_1109 259
125 3300050508 nmdc:mga09592_64983_c1 nmdc:mga09592_64983_c1_1207_2052 259
126 iso_pu_bacteria 2622736626 2623586218 259
127 iso_pu_bacteria 2772190715 2772641408 259
128 iso_pu_bacteria 2831935698 2831937217 259
129 iso_pu_bacteria 2855670206 2855676614 259
130 iso_pu_bacteria 2855676851 2855683340 259
131 iso_pu_bacteria 2855683550 2855685079 259
132 iso_pu_bacteria 2857288857 2857292756 259
133 iso_pu_bacteria 2858848962 2858852208 259
134 iso_pu_bacteria 2858868258 2858869028 259
135 iso_pu_bacteria 2858882152 2858888275 259
136 iso_pu_bacteria 2858888857 2858890320 259
137 iso_pu_bacteria 2858895516 2858899025 259
138 iso_pu_bacteria 2867302475 2867304247 259
139 iso_pu_bacteria 2867312974 2867313576 259
140 iso_pu_bacteria 2867319477 2867322601 259
141 iso_pu_bacteria 2867507094 2867509636 259
142 iso_pu_bacteria 2869048445 2869055096 259
143 iso_pu_bacteria 2869061728 2869064838 259
144 iso_pu_bacteria 2869068681 2869073758 259
145 iso_pu_bacteria 2880489317 2880494037 259
146 iso_pu_bacteria 2880495981 2880498294 259
147 iso_pu_bacteria 2887478801 2887483609 259
148 iso_pu_bacteria 2929219909 2929220334 259
149 iso_pu_bacteria 2929226422 2929226878 259
150 iso_pu_bacteria 2996221748 2996225518 259
151 iso_pu_bacteria 8001781756 8001789340 259
152 iso_pu_bacteria 8003830390 8003834806 259
153 iso_pu_bacteria 8003856774 8003860312 259
154 iso_pu_bacteria 8054704163 8054707140 259
155 iso_pu_bacteria 8054727385 8054728225 259
156 iso_pu_bacteria 8054734606 8054736418 259
157 iso_pu_bacteria 8055412473 8055415958 259
158 3300005329 Ga0070683_100023680 Ga0070683_1000236805 260
159 3300005329 Ga0070683_100231291 Ga0070683_1002312912 260
160 3300005334 Ga0068869_100002673 Ga0068869_1000026739 260
161 3300005339 Ga0070660_100012378 Ga0070660_1000123782 260
162 3300005343 Ga0070687_100148093 Ga0070687_1001480932 260
163 3300005354 Ga0070675_100017178 Ga0070675_1000171782 260
164 3300005366 Ga0070659_100023220 Ga0070659_1000232202 260
165 3300005436 Ga0070713_100206640 Ga0070713_1002066402 260
166 3300005444 Ga0070694_100119512 Ga0070694_1001195121 260
167 3300005455 Ga0070663_100023909 Ga0070663_1000239093 260
168 3300005456 Ga0070678_100041576 Ga0070678_1000415761 260
169 3300005457 Ga0070662_100011919 Ga0070662_1000119195 260
170 3300005458 Ga0070681_10073233 Ga0070681_100732335 260
171 3300005530 Ga0070679_100266462 Ga0070679_1002664622 260
172 3300005535 Ga0070684_100102844 Ga0070684_1001028442 260
173 3300005563 Ga0068855_100246508 Ga0068855_1002465082 260
174 3300005564 Ga0070664_100018698 Ga0070664_1000186986 260
175 3300005564 Ga0070664_100102720 Ga0070664_1001027202 260
176 3300005577 Ga0068857_100058690 Ga0068857_1000586902 260
177 3300005577 Ga0068857_100286997 Ga0068857_1002869972 260
178 3300005618 Ga0068864_100452422 Ga0068864_1004524222 260
179 3300005937 Ga0081455_10000353 Ga0081455_1000035321 260
180 3300005981 Ga0081538_10000215 Ga0081538_1000021552 260
181 3300006844 Ga0075428_100003501 Ga0075428_1000035014 260
182 3300006844 Ga0075428_100072859 Ga0075428_1000728593 260
183 3300006846 Ga0075430_100007865 Ga0075430_1000078658 260
184 3300006846 Ga0075430_100019938 Ga0075430_1000199386 260
185 3300006846 Ga0075430_100100423 Ga0075430_1001004231 260
186 3300006847 Ga0075431_100003793 Ga0075431_1000037935 260
187 3300006847 Ga0075431_100013454 Ga0075431_1000134545 260
188 3300006847 Ga0075431_100188392 Ga0075431_1001883922 260
189 3300006880 Ga0075429_100000540 Ga0075429_10000054032 260
190 3300006880 Ga0075429_100008733 Ga0075429_1000087332 260
191 3300006880 Ga0075429_100008868 Ga0075429_1000088684 260
192 3300006881 Ga0068865_100091031 Ga0068865_1000910312 260
193 3300009094 Ga0111539_10002199 Ga0111539_100021992 260
194 3300009094 Ga0111539_10024976 Ga0111539_100249767 260
195 3300009098 Ga0105245_10022401 Ga0105245_100224018 260
196 3300009147 Ga0114129_10000045 Ga0114129_100000454 260
197 3300009147 Ga0114129_10036904 Ga0114129_100369042 260
198 3300009147 Ga0114129_10102402 Ga0114129_101024022 260
199 3300009147 Ga0114129_10153681 Ga0114129_101536812 260
200 3300010375 Ga0105239_10318676 Ga0105239_103186762 260
201 3300013307 Ga0157372_10301238 Ga0157372_103012382 260
202 3300020070 Ga0206356_11835595 Ga0206356_118355952 260
203 3300020081 Ga0206354_10030602 Ga0206354_100306022 260
204 3300020082 Ga0206353_10916301 Ga0206353_109163012 260
205 3300025901 Ga0207688_10265416 Ga0207688_102654161 260
206 3300025909 Ga0207705_10110851 Ga0207705_101108512 260
207 3300025917 Ga0207660_10297629 Ga0207660_102976292 260
208 3300025918 Ga0207662_10170592 Ga0207662_101705921 260
209 3300025919 Ga0207657_10038670 Ga0207657_100386702 260
210 3300025920 Ga0207649_10068196 Ga0207649_100681962 260
211 3300025921 Ga0207652_10153509 Ga0207652_101535091 260
212 3300025921 Ga0207652_10230566 Ga0207652_102305662 260
213 3300025926 Ga0207659_10219050 Ga0207659_102190502 260
214 3300025927 Ga0207687_10012027 Ga0207687_100120278 260
215 3300025933 Ga0207706_10008112 Ga0207706_100081125 260
216 3300025938 Ga0207704_10084502 Ga0207704_100845022 260
217 3300025942 Ga0207689_10035736 Ga0207689_100357363 260
218 3300025944 Ga0207661_10025539 Ga0207661_100255392 260
219 3300025945 Ga0207679_10016182 Ga0207679_100161822 260
220 3300025960 Ga0207651_10085598 Ga0207651_100855981 260
221 3300026067 Ga0207678_10035385 Ga0207678_100353853 260
222 3300026095 Ga0207676_10194699 Ga0207676_101946993 260
223 3300026116 Ga0207674_10031996 Ga0207674_100319967 260
224 3300026121 Ga0207683_10157326 Ga0207683_101573262 260
225 3300027907 Ga0207428_10008340 Ga0207428_100083403 260
226 3300027907 Ga0207428_10022668 Ga0207428_100226686 260
227 3300031727 Ga0316576_10165548 Ga0316576_101655482 260
228 3300031728 Ga0316578_10134145 Ga0316578_101341452 260
229 3300032004 Ga0307414_10384998 Ga0307414_103849982 260
230 3300032126 Ga0307415_100216607 Ga0307415_1002166072 260
231 3300035207 Ga0373942_0058202 Ga0373942_0058202_95_952 260
232 3300035398 Ga0316574_0199234 Ga0316574_0199234_294_1136 260
233 3300036712 Ga0316584_0056827 Ga0316584_0056827_1950_2792 260
234 3300049571 Ga0501034_0438639 Ga0501034_0438639_129_974 260
235 3300049573 Ga0501037_0096450 Ga0501037_0096450_1028_1873 260
236 3300049574 Ga0501038_0017880 Ga0501038_0017880_4873_5718 260
237 3300049575 Ga0501039_0004539 Ga0501039_0004539_2284_3129 260
238 3300049580 Ga0501046_0018478 Ga0501046_0018478_1080_1925 260
239 3300049581 Ga0501047_0152481 Ga0501047_0152481_737_1582 260
240 3300049590 Ga0501074_0150288 Ga0501074_0150288_180_1025 260
241 3300049742 Ga0501080_0164046 Ga0501080_0164046_914_1759 260
242 3300049822 Ga0501035_0261171 Ga0501035_0261171_475_1320 260
243 3300049823 Ga0501044_0214942 Ga0501044_0214942_624_1469 260
244 3300050507 nmdc:mga05p37_1721_c1 nmdc:mga05p37_1721_c1_3602_4462 260
245 3300050507 nmdc:mga05p37_18034_c1 nmdc:mga05p37_18034_c1_5590_6417 260
246 3300050507 nmdc:mga05p37_259459_c1 nmdc:mga05p37_259459_c1_488_1336 260
247 3300050508 nmdc:mga09592_215747_c1 nmdc:mga09592_215747_c1_399_1247 260
248 3300050508 nmdc:mga09592_59855_c1 nmdc:mga09592_59855_c1_690_1523 260
249 3300050508 nmdc:mga09592_61576_c1 nmdc:mga09592_61576_c1_1499_2338 260
250 3300050508 nmdc:mga09592_876_c1 nmdc:mga09592_876_c1_10827_11687 260
251 3300050509 nmdc:mga0qj67_3430_c1 nmdc:mga0qj67_3430_c1_7370_8230 260
252 3300050509 nmdc:mga0qj67_65909_c1 nmdc:mga0qj67_65909_c1_1959_2804 260
253 3300050509 nmdc:mga0qj67_79715_c1 nmdc:mga0qj67_79715_c1_345_1193 260
254 3300050510 nmdc:mga06r32_416260_c1 nmdc:mga06r32_416260_c1_119_946 260
255 3300050510 nmdc:mga06r32_4612_c1 nmdc:mga06r32_4612_c1_8924_9784 260
256 3300050510 nmdc:mga06r32_57411_c1 nmdc:mga06r32_57411_c1_1032_1877 260
257 3300050511 nmdc:mga08y16_4559_c1 nmdc:mga08y16_4559_c1_4194_5054 260
258 3300050511 nmdc:mga08y16_6848_c1 nmdc:mga08y16_6848_c1_4815_5645 260
259 3300005439 Ga0070711_100193319 Ga0070711_1001933191 261
260 3300005467 Ga0070706_100364107 Ga0070706_1003641072 261
261 3300005535 Ga0070684_100063813 Ga0070684_1000638132 261
262 3300005548 Ga0070665_100113354 Ga0070665_1001133543 261
263 3300005937 Ga0081455_10046586 Ga0081455_100465864 261
264 3300006163 Ga0070715_10037465 Ga0070715_100374652 261
265 3300006844 Ga0075428_100000335 Ga0075428_10000033520 261
266 3300006844 Ga0075428_100010498 Ga0075428_1000104987 261
267 3300006844 Ga0075428_100081704 Ga0075428_1000817042 261
268 3300006846 Ga0075430_100006498 Ga0075430_1000064989 261
269 3300006846 Ga0075430_100062683 Ga0075430_1000626833 261
270 3300006847 Ga0075431_100099761 Ga0075431_1000997612 261
271 3300006847 Ga0075431_100145134 Ga0075431_1001451342 261
272 3300006880 Ga0075429_100009201 Ga0075429_1000092012 261
273 3300006880 Ga0075429_100102387 Ga0075429_1001023872 261
274 3300009147 Ga0114129_10003984 Ga0114129_100039844 261
275 3300009147 Ga0114129_10290829 Ga0114129_102908292 261
276 3300009147 Ga0114129_10366625 Ga0114129_103666252 261
277 3300009147 Ga0114129_10416488 Ga0114129_104164882 261
278 3300009545 Ga0105237_10293547 Ga0105237_102935472 261
279 3300014968 Ga0157379_10072075 Ga0157379_100720753 261
280 3300025909 Ga0207705_10067476 Ga0207705_100674762 261
281 3300025927 Ga0207687_10007086 Ga0207687_100070862 261
282 3300025935 Ga0207709_10038033 Ga0207709_100380332 261
283 3300025949 Ga0207667_10115487 Ga0207667_101154872 261
284 3300026023 Ga0207677_10133796 Ga0207677_101337962 261
285 3300026035 Ga0207703_10151051 Ga0207703_101510512 261
286 3300028800 Ga0265338_10021383 Ga0265338_100213833 261
287 3300028800 Ga0265338_10097786 Ga0265338_100977862 261
288 3300031247 Ga0265340_10004550 Ga0265340_100045508 261
289 3300031247 Ga0265340_10009198 Ga0265340_100091986 261
290 3300031249 Ga0265339_10094110 Ga0265339_100941101 261
291 3300031344 Ga0265316_10058296 Ga0265316_100582962 261
292 3300031711 Ga0265314_10279506 Ga0265314_102795061 261
293 3300031712 Ga0265342_10022436 Ga0265342_100224362 261
294 3300031712 Ga0265342_10065609 Ga0265342_100656092 261
295 3300032126 Ga0307415_100135660 Ga0307415_1001356602 261
296 3300035119 Ga0373956_0042953 Ga0373956_0042953_944_1810 261
297 3300044694 Ga0466963_0021012 Ga0466963_0021012_1664_2521 261
298 3300044901 Ga0466960_0010267 Ga0466960_0010267_551_1375 261
299 3300045976 Ga0466967_0018785 Ga0466967_0018785_555_1394 261
300 3300046453 Ga0495627_034953 Ga0495627_034953_19_1110 261
301 3300046463 Ga0495653_0219307 Ga0495653_0219307_278_1144 261
302 3300046559 Ga0495667_0071955 Ga0495667_0071955_184_1050 261
303 3300046809 Ga0495600_0313882 Ga0495600_0313882_121_951 261
304 3300048913 Ga0496110_0220917 Ga0496110_0220917_580_1605 261
305 3300049572 Ga0501036_0574839 Ga0501036_0574839_18_845 261
306 3300049823 Ga0501044_0189557 Ga0501044_0189557_671_1702 261
307 3300050507 nmdc:mga05p37_315356_c1 nmdc:mga05p37_315356_c1_661_1503 261
308 3300050507 nmdc:mga05p37_394612_c1 nmdc:mga05p37_394612_c1_282_1100 261
309 3300050507 nmdc:mga05p37_5306_c2 nmdc:mga05p37_5306_c2_335_1270 261
310 3300050508 nmdc:mga09592_250715_c1 nmdc:mga09592_250715_c1_343_1185 261
311 3300050508 nmdc:mga09592_97638_c1 nmdc:mga09592_97638_c1_1542_2450 261
312 3300050509 nmdc:mga0qj67_3571_c1 nmdc:mga0qj67_3571_c1_8253_9188 261
313 3300050509 nmdc:mga0qj67_56102_c1 nmdc:mga0qj67_56102_c1_274_1182 261
314 3300050510 nmdc:mga06r32_8883_c1 nmdc:mga06r32_8883_c1_2533_3468 261
315 3300053083 Ga0495655_0024229 Ga0495655_0024229_320_1309 261
316 3300053090 Ga0500646_0000078 Ga0500646_0000078_22973_23815 261
317 3300053092 Ga0500583_0012323 Ga0500583_0012323_1726_2568 261
318 3300053146 Ga0500588_0000401 Ga0500588_0000401_5846_6688 261
319 3300003911 JGI25405J52794_10005723 JGI25405J52794_100057232 262
320 3300005329 Ga0070683_100284029 Ga0070683_1002840292 262
321 3300005535 Ga0070684_100184433 Ga0070684_1001844332 262
322 3300005564 Ga0070664_100072223 Ga0070664_1000722232 262
323 3300005564 Ga0070664_100174888 Ga0070664_1001748882 262
324 3300005618 Ga0068864_100052366 Ga0068864_1000523664 262
325 3300005841 Ga0068863_100288198 Ga0068863_1002881982 262
326 3300005842 Ga0068858_100076748 Ga0068858_1000767482 262
327 3300005843 Ga0068860_100207786 Ga0068860_1002077861 262
328 3300005981 Ga0081538_10011100 Ga0081538_100111002 262
329 3300005985 Ga0081539_10002545 Ga0081539_1000254514 262
330 3300006237 Ga0097621_100251691 Ga0097621_1002516912 262
331 3300006844 Ga0075428_100260857 Ga0075428_1002608572 262
332 3300009148 Ga0105243_10750758 Ga0105243_107507581 262
333 3300009177 Ga0105248_10053882 Ga0105248_100538825 262
334 3300013105 Ga0157369_10300688 Ga0157369_103006882 262
335 3300014325 Ga0163163_10022093 Ga0163163_100220935 262
336 3300014745 Ga0157377_10009740 Ga0157377_100097408 262
337 3300014968 Ga0157379_10105295 Ga0157379_101052954 262
338 3300020081 Ga0206354_11448996 Ga0206354_114489962 262
339 3300021388 Ga0213875_10190607 Ga0213875_101906071 262
340 3300025906 Ga0207699_10114260 Ga0207699_101142602 262
341 3300025915 Ga0207693_10313147 Ga0207693_103131472 262
342 3300025920 Ga0207649_10401480 Ga0207649_104014801 262
343 3300025941 Ga0207711_10088769 Ga0207711_100887692 262
344 3300025944 Ga0207661_10006016 Ga0207661_100060167 262
345 3300025944 Ga0207661_10214564 Ga0207661_102145642 262
346 3300025945 Ga0207679_10020020 Ga0207679_100200203 262
347 3300025945 Ga0207679_10340923 Ga0207679_103409232 262
348 3300025986 Ga0207658_10189260 Ga0207658_101892602 262
349 3300026035 Ga0207703_10451162 Ga0207703_104511622 262
350 3300026088 Ga0207641_10135843 Ga0207641_101358433 262
351 3300026095 Ga0207676_10014125 Ga0207676_100141252 262
352 3300028381 Ga0268264_10515990 Ga0268264_105159901 262
353 3300028794 Ga0307515_10000038 Ga0307515_1000003874 262
354 3300031507 Ga0307509_10003281 Ga0307509_1000328125 262
355 3300031507 Ga0307509_10142805 Ga0307509_101428052 262
356 3300031616 Ga0307508_10029881 Ga0307508_100298816 262
357 3300031616 Ga0307508_10100885 Ga0307508_101008852 262
358 3300031730 Ga0307516_10004036 Ga0307516_100040368 262
359 3300031730 Ga0307516_10023726 Ga0307516_100237263 262
360 3300031731 Ga0307405_10016132 Ga0307405_100161322 262
361 3300031731 Ga0307405_10041878 Ga0307405_100418782 262
362 3300031824 Ga0307413_10133593 Ga0307413_101335932 262
363 3300031852 Ga0307410_10353494 Ga0307410_103534941 262
364 3300031889 Ga0326468_10000783 Ga0326468_100007832 262
365 3300031901 Ga0307406_10071794 Ga0307406_100717942 262
366 3300031995 Ga0307409_100033223 Ga0307409_1000332232 262
367 3300031995 Ga0307409_100363099 Ga0307409_1003630992 262
368 3300032002 Ga0307416_100086789 Ga0307416_1000867892 262
369 3300032126 Ga0307415_100076653 Ga0307415_1000766532 262
370 3300032126 Ga0307415_100370727 Ga0307415_1003707272 262
371 3300035112 Ga0373932_0062965 Ga0373932_0062965_249_1085 262
372 3300037466 Ga0395898_0018644 Ga0395898_0018644_2575_3420 262
373 3300037471 Ga0395905_0009928 Ga0395905_0009928_8053_8898 262
374 3300037853 Ga0436364_0831882 Ga0436364_0831882_837_1673 262
375 3300038443 Ga0395901_0131913 Ga0395901_0131913_506_1351 262
376 3300041451 Ga0451791_0953799 Ga0451791_0953799_201_1037 262
377 3300046459 Ga0495629_0087909 Ga0495629_0087909_568_1416 262
378 3300048907 Ga0496104_0084914 Ga0496104_0084914_962_1810 262
379 3300048908 Ga0496105_0055335 Ga0496105_0055335_1929_2777 262
380 3300048911 Ga0496108_0000035 Ga0496108_0000035_148308_149144 262
381 3300048911 Ga0496108_0045818 Ga0496108_0045818_934_1782 262
382 3300048912 Ga0496109_0005749 Ga0496109_0005749_4155_5003 262
383 3300048913 Ga0496110_0012551 Ga0496110_0012551_3606_4454 262
384 3300048914 Ga0496111_0002931 Ga0496111_0002931_5286_6134 262
385 3300048915 Ga0496112_0022388 Ga0496112_0022388_4546_5394 262
386 3300048915 Ga0496112_0122503 Ga0496112_0122503_63_911 262
387 3300048916 Ga0496113_0016991 Ga0496113_0016991_286_1134 262
388 3300048929 Ga0496126_0152178 Ga0496126_0152178_270_1112 262
389 3300050508 nmdc:mga09592_194623_c1 nmdc:mga09592_194623_c1_331_1164 262
390 3300002459 JGI24751J29686_10004885 JGI24751J29686_100048853 263
391 3300003203 JGI25406J46586_10040232 JGI25406J46586_100402322 263
392 3300005327 Ga0070658_10010490 Ga0070658_100104902 263
393 3300005327 Ga0070658_10167350 Ga0070658_101673501 263
394 3300005331 Ga0070670_100407499 Ga0070670_1004074992 263
395 3300005334 Ga0068869_100006852 Ga0068869_1000068522 263
396 3300005337 Ga0070682_100051576 Ga0070682_1000515762 263
397 3300005338 Ga0068868_100028409 Ga0068868_1000284093 263
398 3300005339 Ga0070660_100175611 Ga0070660_1001756114 263
399 3300005341 Ga0070691_10008421 Ga0070691_100084216 263
400 3300005354 Ga0070675_100033965 Ga0070675_1000339654 263
401 3300005355 Ga0070671_100020284 Ga0070671_1000202843 263
402 3300005364 Ga0070673_100171767 Ga0070673_1001717674 263
403 3300005365 Ga0070688_100045077 Ga0070688_1000450773 263
404 3300005434 Ga0070709_10045946 Ga0070709_100459462 263
405 3300005435 Ga0070714_100285342 Ga0070714_1002853422 263
406 3300005436 Ga0070713_100023572 Ga0070713_1000235725 263
407 3300005437 Ga0070710_10047482 Ga0070710_100474822 263
408 3300005439 Ga0070711_100033159 Ga0070711_1000331595 263
409 3300005455 Ga0070663_100058855 Ga0070663_1000588552 263
410 3300005458 Ga0070681_10071836 Ga0070681_100718366 263
411 3300005535 Ga0070684_100626849 Ga0070684_1006268491 263
412 3300005539 Ga0068853_100123875 Ga0068853_1001238752 263
413 3300005544 Ga0070686_100041704 Ga0070686_1000417043 263
414 3300005546 Ga0070696_100220830 Ga0070696_1002208302 263
415 3300005547 Ga0070693_100042318 Ga0070693_1000423182 263
416 3300005548 Ga0070665_100083665 Ga0070665_1000836652 263
417 3300005563 Ga0068855_100185522 Ga0068855_1001855222 263
418 3300005614 Ga0068856_100060731 Ga0068856_1000607312 263
419 3300005615 Ga0070702_100007680 Ga0070702_1000076803 263
420 3300005617 Ga0068859_100047612 Ga0068859_1000476123 263
421 3300005617 Ga0068859_100165337 Ga0068859_1001653372 263
422 3300005618 Ga0068864_100105688 Ga0068864_1001056882 263
423 3300005719 Ga0068861_100326012 Ga0068861_1003260122 263
424 3300005834 Ga0068851_10037250 Ga0068851_100372505 263
425 3300005841 Ga0068863_100030947 Ga0068863_1000309473 263
426 3300005841 Ga0068863_100048574 Ga0068863_1000485743 263
427 3300005842 Ga0068858_100053829 Ga0068858_1000538293 263
428 3300005843 Ga0068860_100109361 Ga0068860_1001093612 263
429 3300005937 Ga0081455_10385175 Ga0081455_103851752 263
430 3300005985 Ga0081539_10000543 Ga0081539_1000054333 263
431 3300005985 Ga0081539_10004065 Ga0081539_1000406516 263
432 3300005985 Ga0081539_10006354 Ga0081539_100063542 263
433 3300005985 Ga0081539_10018604 Ga0081539_100186042 263
434 3300005985 Ga0081539_10139867 Ga0081539_101398671 263
435 3300006846 Ga0075430_100001160 Ga0075430_1000011606 263
436 3300006847 Ga0075431_100078025 Ga0075431_1000780252 263
437 3300006871 Ga0075434_100035484 Ga0075434_1000354843 263
438 3300006871 Ga0075434_100737635 Ga0075434_1007376351 263
439 3300006880 Ga0075429_100196804 Ga0075429_1001968042 263
440 3300006914 Ga0075436_100050762 Ga0075436_1000507623 263
441 3300006931 Ga0097620_100047610 Ga0097620_1000476103 263
442 3300006931 Ga0097620_100165327 Ga0097620_1001653272 263
443 3300009093 Ga0105240_10398112 Ga0105240_103981122 263
444 3300009098 Ga0105245_10288746 Ga0105245_102887461 263
445 3300009101 Ga0105247_10105407 Ga0105247_101054072 263
446 3300009148 Ga0105243_10426381 Ga0105243_104263812 263
447 3300009177 Ga0105248_10071117 Ga0105248_100711173 263
448 3300010375 Ga0105239_10081563 Ga0105239_100815633 263
449 3300013100 Ga0157373_10083805 Ga0157373_100838052 263
450 3300013105 Ga0157369_10095536 Ga0157369_100955363 263
451 3300013296 Ga0157374_10180683 Ga0157374_101806832 263
452 3300013307 Ga0157372_10440541 Ga0157372_104405412 263
453 3300013308 Ga0157375_10092278 Ga0157375_100922783 263
454 3300014325 Ga0163163_10050218 Ga0163163_100502183 263
455 3300014325 Ga0163163_10321771 Ga0163163_103217712 263
456 3300014745 Ga0157377_10029880 Ga0157377_100298805 263
457 3300014968 Ga0157379_10084903 Ga0157379_100849035 263
458 3300020069 Ga0197907_11297759 Ga0197907_112977592 263
459 3300020070 Ga0206356_11158473 Ga0206356_111584733 263
460 3300025321 Ga0207656_10051834 Ga0207656_100518342 263
461 3300025735 Ga0207713_1039965 Ga0207713_10399653 263
462 3300025898 Ga0207692_10060266 Ga0207692_100602662 263
463 3300025900 Ga0207710_10094285 Ga0207710_100942853 263
464 3300025901 Ga0207688_10004224 Ga0207688_100042247 263
465 3300025903 Ga0207680_10242205 Ga0207680_102422052 263
466 3300025906 Ga0207699_10020992 Ga0207699_100209924 263
467 3300025907 Ga0207645_10146821 Ga0207645_101468212 263
468 3300025908 Ga0207643_10000053 Ga0207643_1000005336 263
469 3300025909 Ga0207705_10015307 Ga0207705_100153073 263
470 3300025916 Ga0207663_10192400 Ga0207663_101924002 263
471 3300025919 Ga0207657_10203550 Ga0207657_102035502 263
472 3300025921 Ga0207652_10044851 Ga0207652_100448515 263
473 3300025927 Ga0207687_10012616 Ga0207687_100126168 263
474 3300025928 Ga0207700_10007220 Ga0207700_100072204 263
475 3300025929 Ga0207664_10104961 Ga0207664_101049614 263
476 3300025931 Ga0207644_10178593 Ga0207644_101785932 263
477 3300025932 Ga0207690_10119866 Ga0207690_101198662 263
478 3300025933 Ga0207706_10116609 Ga0207706_101166092 263
479 3300025940 Ga0207691_10074494 Ga0207691_100744944 263
480 3300025942 Ga0207689_10008415 Ga0207689_1000841511 263
481 3300025945 Ga0207679_10014567 Ga0207679_100145679 263
482 3300025960 Ga0207651_10340137 Ga0207651_103401372 263
483 3300025972 Ga0207668_10007753 Ga0207668_100077532 263
484 3300026041 Ga0207639_10047229 Ga0207639_100472291 263
485 3300026067 Ga0207678_10000099 Ga0207678_1000009925 263
486 3300026075 Ga0207708_10015752 Ga0207708_100157523 263
487 3300026078 Ga0207702_10015082 Ga0207702_100150822 263
488 3300026078 Ga0207702_10108042 Ga0207702_101080422 263
489 3300026088 Ga0207641_10014688 Ga0207641_100146885 263
490 3300026088 Ga0207641_10245438 Ga0207641_102454383 263
491 3300026088 Ga0207641_10639445 Ga0207641_106394451 263
492 3300026095 Ga0207676_10050396 Ga0207676_100503962 263
493 3300026118 Ga0207675_100142277 Ga0207675_1001422774 263
494 3300026121 Ga0207683_10000434 Ga0207683_1000043436 263
495 3300026142 Ga0207698_10076082 Ga0207698_100760823 263
496 3300028381 Ga0268264_10087773 Ga0268264_100877734 263
497 3300028786 Ga0307517_10059944 Ga0307517_100599444 263
498 3300028794 Ga0307515_10003884 Ga0307515_1000388416 263
499 3300028794 Ga0307515_10054394 Ga0307515_100543942 263
500 3300030522 Ga0307512_10001168 Ga0307512_1000116829 263
501 3300030522 Ga0307512_10003072 Ga0307512_100030721 263
502 3300030522 Ga0307512_10219958 Ga0307512_102199581 263
503 3300031456 Ga0307513_10003781 Ga0307513_100037816 263
504 3300031456 Ga0307513_10122352 Ga0307513_101223521 263
505 3300031507 Ga0307509_10211761 Ga0307509_102117612 263
506 3300031616 Ga0307508_10003410 Ga0307508_1000341012 263
507 3300031616 Ga0307508_10021082 Ga0307508_100210823 263
508 3300031616 Ga0307508_10115570 Ga0307508_101155702 263
509 3300031730 Ga0307516_10084529 Ga0307516_100845292 263
510 3300031731 Ga0307405_10000967 Ga0307405_1000096712 263
511 3300031824 Ga0307413_10007994 Ga0307413_100079944 263
512 3300031824 Ga0307413_10066919 Ga0307413_100669192 263
513 3300031824 Ga0307413_10410222 Ga0307413_104102221 263
514 3300031901 Ga0307406_10009284 Ga0307406_100092842 263
515 3300031901 Ga0307406_10101374 Ga0307406_101013742 263
516 3300031903 Ga0307407_10004852 Ga0307407_100048524 263
517 3300031903 Ga0307407_10116502 Ga0307407_101165022 263
518 3300031911 Ga0307412_10142694 Ga0307412_101426943 263
519 3300031995 Ga0307409_100034617 Ga0307409_1000346172 263
520 3300031995 Ga0307409_100069265 Ga0307409_1000692652 263
521 3300032002 Ga0307416_100001452 Ga0307416_1000014525 263
522 3300032002 Ga0307416_100051951 Ga0307416_1000519512 263
523 3300032002 Ga0307416_100188304 Ga0307416_1001883041 263
524 3300032126 Ga0307415_100000054 Ga0307415_10000005414 263
525 3300032126 Ga0307415_100048696 Ga0307415_1000486962 263
526 3300035091 Ga0373951_0000252 Ga0373951_0000252_10021_10884 263
527 3300035692 Ga0373935_0058142 Ga0373935_0058142_711_1553 263
528 3300035725 Ga0373947_0324698 Ga0373947_0324698_43_867 263
529 3300036401 Ga0373937_0205989 Ga0373937_0205989_35_874 263
530 3300037466 Ga0395898_0117572 Ga0395898_0117572_49_888 263
531 3300037471 Ga0395905_0110544 Ga0395905_0110544_637_1476 263
532 3300038443 Ga0395901_0150536 Ga0395901_0150536_170_1009 263
533 3300042005 Ga0439448_0008116 Ga0439448_0008116_806_1630 263
534 3300042438 Ga0439459_0019062 Ga0439459_0019062_81_905 263
535 3300042993 Ga0439440_0022533 Ga0439440_0022533_155_979 263
536 3300045976 Ga0466967_0147323 Ga0466967_0147323_1181_2020 263
537 3300046507 Ga0495606_0006212 Ga0495606_0006212_10087_10941 263
538 3300046616 Ga0495668_0000395 Ga0495668_0000395_27754_28608 263
539 3300046660 Ga0495625_0001063 Ga0495625_0001063_33249_34103 263
540 3300048091 Ga0495626_0000107 Ga0495626_0000107_101768_102622 263
541 3300048903 Ga0496100_0163829 Ga0496100_0163829_408_1232 263
542 3300048906 Ga0496103_0077330 Ga0496103_0077330_896_1720 263
543 3300048907 Ga0496104_0016169 Ga0496104_0016169_2892_3716 263
544 3300048908 Ga0496105_0041152 Ga0496105_0041152_2483_3307 263
545 3300048910 Ga0496107_0074714 Ga0496107_0074714_782_1606 263
546 3300048911 Ga0496108_0074228 Ga0496108_0074228_1937_2761 263
547 3300048913 Ga0496110_0083319 Ga0496110_0083319_1534_2358 263
548 3300048914 Ga0496111_0044374 Ga0496111_0044374_922_1746 263
549 3300048915 Ga0496112_0053635 Ga0496112_0053635_81_905 263
550 3300048927 Ga0496124_0393849 Ga0496124_0393849_11_874 263
551 3300050507 nmdc:mga05p37_781582_c1 nmdc:mga05p37_781582_c1_123_959 263
552 3300050509 nmdc:mga0qj67_643_c1 nmdc:mga0qj67_643_c1_11563_12465 263
553 3300050510 nmdc:mga06r32_224372_c1 nmdc:mga06r32_224372_c1_286_1158 263
554 3300050510 nmdc:mga06r32_283240_c1 nmdc:mga06r32_283240_c1_88_957 263
555 3300050510 nmdc:mga06r32_83879_c1 nmdc:mga06r32_83879_c1_37_882 263
556 3300050511 nmdc:mga08y16_13145_c1 nmdc:mga08y16_13145_c1_1352_2176 263
557 3300050512 nmdc:mga0n895_652525_c1 nmdc:mga0n895_652525_c1_111_968 263
558 3300050514 nmdc:mga08x19_66487_c1 nmdc:mga08x19_66487_c1_612_1436 263
559 3300050515 nmdc:mga0a205_5462_c1 nmdc:mga0a205_5462_c1_2473_3297 263
560 3300053088 Ga0500644_0017639 Ga0500644_0017639_299_1162 263
561 3300053098 Ga0500650_0042446 Ga0500650_0042446_362_1225 263
562 3300053118 Ga0500594_0019896 Ga0500594_0019896_274_1137 263
563 3300053131 Ga0500652_006565 Ga0500652_006565_1429_2292 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04468

PSP1

PSP1 C-terminal conserved region

56

146

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eqx-assembly1.cif.gz_B crystal structure of the c43s mutant of staphylococcus aureus coadr 0.9239 221 246
4eqr-assembly1.cif.gz_B crystal structure of the y361f mutant of staphylococcus aureus coadr 0.9186 221 246
4eqw-assembly1.cif.gz_B crystal structure of the y361f, y419f mutant of staphylococcus aureus coadr 0.9159 221 246
4eqs-assembly1.cif.gz_B crystal structure of the y419f mutant of staphylococcus aureus coadr 0.9003 222 246
4a4e-assembly1.cif.gz_A solution structure of smn tudor domain in complex with symmetrically dimethylated arginine 0.8793 208 251
ID Description Score Start End Superfamily
af_Q4DEV0_471_557_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9491 67 144 3.30.300.20
1yqzB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9215 221 246 3.50.50.60
af_Q2G2W9_61_146_3.30.70.790 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.9175 62 144 3.30.70.790
af_O94284_27_435_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9169 220 247 1.25.10.10
af_Q9VV74_63_121_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.9025 208 250 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A357X1L9-F1-model_v4 Stage 0 sporulation protein 0.9582 87 145 GO:0005737
AF-A0A357X1L9-F1-model_v4 Stage 0 sporulation protein 0.9133 87 145 GO:0005737
AF-A0A7V0TTD4-F1-model_v4 Stage 0 sporulation protein 0.8881 1 142 GO:0005737
AF-A0A2G5B362-F1-model_v4 PSP1 C-terminal domain-containing protein 0.8843 65 142 GO:0005737
AF-A0A356M2T0-F1-model_v4 Stage 0 sporulation protein 0.8727 1 128 GO:0005737

Feature Viewer

pLDDT pTM Quality
79.25 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map