F464014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 563 | 255 | 559 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300005340|Ga0070689_100127231|Ga0070689_1001272313 |
| Length | 294 |
| Sequence | MHRGCVGTTTSGVFIAAGAIPVALWGSNRDHPRHSSIRRRLAGQGERREAARVTYCVGMKVDEGMIFASDSRTNAGLDNIAKFCKMTLFERAGDRVMVLLSSGNLAGTQAIISLLSQRGDDPDNPGSLWKARTMFDAVNLVSDAMRDIERRDGPSLQASEVTFNASFILGGQIRGEEMRLFRIYAEGNFIESGALTPYIQTGETKYGKPIIDRVITTTTNLADAAKCVLVSFDSTMRSNVSVGMPIDLICYERDSLQVQMRRRFDDGDPYFTSLHRSWSEGTRRVFRELPELLW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 3 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 4 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 172 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 176 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 177 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 190 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 193 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 200 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 231 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 232 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 235 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 236 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 246 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 253 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 254 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 0.36 |
| Isolates | 0.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.26 |
| Nodule | 0 |
| Rhizoplane | 4.26 |
| Rhizosphere | 87.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1000231 | 3300003792 | Bacteria | 51661 |
| 2 | Ga0065707_10049975 | 3300005295 | Bacteria | 1011 |
| 3 | Ga0070676_10225468 | 3300005328 | Bacteria | 1240 |
| 4 | Ga0070670_100028390 | 3300005331 | Bacteria | 4815 |
| 5 | Ga0070670_100077873 | 3300005331 | Bacteria | 2848 |
| 6 | Ga0070677_10000382 | 3300005333 | Bacteria | 15572 |
| 7 | Ga0070677_10057419 | 3300005333 | Bacteria | 1595 |
| 8 | Ga0068869_100000865 | 3300005334 | Bacteria | 17407 |
| 9 | Ga0070666_10000758 | 3300005335 | Bacteria | 19568 |
| 10 | Ga0070666_10058312 | 3300005335 | Bacteria | 2611 |
| 11 | Ga0070680_100027471 | 3300005336 | Bacteria | 4557 |
| 12 | Ga0070682_100036759 | 3300005337 | Bacteria | 2995 |
| 13 | Ga0070682_100141760 | 3300005337 | Bacteria | 1639 |
| 14 | Ga0068868_100013034 | 3300005338 | Bacteria | 6086 |
| 15 | Ga0068868_100019465 | 3300005338 | Bacteria | 5087 |
| 16 | Ga0068868_100023141 | 3300005338 | Bacteria | 4699 |
| 17 | Ga0068868_100043514 | 3300005338 | Bacteria | 3508 |
| 18 | Ga0068868_100464418 | 3300005338 | Bacteria | 1103 |
| 19 | Ga0070689_100127231 | 3300005340 | Bacteria | 2040 |
| 20 | Ga0070687_100104610 | 3300005343 | Bacteria | 1591 |
| 21 | Ga0070687_100213866 | 3300005343 | Bacteria | 1176 |
| 22 | Ga0070661_100695694 | 3300005344 | Bacteria | 828 |
| 23 | Ga0070668_100001436 | 3300005347 | Bacteria | 17192 |
| 24 | Ga0070668_100003834 | 3300005347 | Bacteria | 11107 |
| 25 | Ga0070668_100005761 | 3300005347 | Bacteria | 9189 |
| 26 | Ga0070668_100183826 | 3300005347 | Bacteria | 1709 |
| 27 | Ga0070669_100009853 | 3300005353 | Bacteria | 6806 |
| 28 | Ga0070669_100061188 | 3300005353 | Bacteria | 2766 |
| 29 | Ga0070669_100068664 | 3300005353 | Bacteria | 2616 |
| 30 | Ga0070675_100000463 | 3300005354 | Bacteria | 27714 |
| 31 | Ga0070675_100001023 | 3300005354 | Bacteria | 20128 |
| 32 | Ga0070675_100008274 | 3300005354 | Bacteria | 8069 |
| 33 | Ga0070675_100167959 | 3300005354 | Bacteria | 1890 |
| 34 | Ga0070671_100010891 | 3300005355 | Bacteria | 7303 |
| 35 | Ga0070671_100021662 | 3300005355 | Bacteria | 5249 |
| 36 | Ga0070671_100074683 | 3300005355 | Bacteria | 2832 |
| 37 | Ga0070671_100130406 | 3300005355 | Bacteria | 2117 |
| 38 | Ga0070674_100000094 | 3300005356 | Bacteria | 41372 |
| 39 | Ga0070674_100008211 | 3300005356 | Bacteria | 6200 |
| 40 | Ga0070674_100407246 | 3300005356 | Bacteria | 1113 |
| 41 | Ga0070674_100636891 | 3300005356 | Bacteria | 905 |
| 42 | Ga0070673_100000753 | 3300005364 | Bacteria | 17978 |
| 43 | Ga0070673_100002697 | 3300005364 | Bacteria | 10877 |
| 44 | Ga0070673_100195151 | 3300005364 | Bacteria | 1741 |
| 45 | Ga0070673_100212399 | 3300005364 | Bacteria | 1672 |
| 46 | Ga0070673_100625613 | 3300005364 | Bacteria | 984 |
| 47 | Ga0070688_100041715 | 3300005365 | Bacteria | 2819 |
| 48 | Ga0070659_100179555 | 3300005366 | Bacteria | 1737 |
| 49 | Ga0070659_100688934 | 3300005366 | Bacteria | 883 |
| 50 | Ga0070667_100001746 | 3300005367 | Bacteria | 19433 |
| 51 | Ga0070667_100006402 | 3300005367 | Bacteria | 9784 |
| 52 | Ga0070667_100013445 | 3300005367 | Bacteria | 6767 |
| 53 | Ga0070667_100017690 | 3300005367 | Bacteria | 5907 |
| 54 | Ga0070667_100040533 | 3300005367 | Bacteria | 3905 |
| 55 | Ga0070667_100044461 | 3300005367 | Bacteria | 3730 |
| 56 | Ga0070713_100000020 | 3300005436 | Bacteria | 108930 |
| 57 | Ga0070713_100381694 | 3300005436 | Bacteria | 1313 |
| 58 | Ga0070711_100240581 | 3300005439 | Bacteria | 1415 |
| 59 | Ga0070700_100040098 | 3300005441 | Bacteria | 2865 |
| 60 | Ga0070700_100076953 | 3300005441 | Bacteria | 2144 |
| 61 | Ga0070700_100179573 | 3300005441 | Bacteria | 1472 |
| 62 | Ga0070708_100038472 | 3300005445 | Bacteria | 4179 |
| 63 | Ga0070663_100304410 | 3300005455 | Bacteria | 1277 |
| 64 | Ga0070678_100000409 | 3300005456 | Bacteria | 20280 |
| 65 | Ga0070678_100103717 | 3300005456 | Bacteria | 2210 |
| 66 | Ga0070678_100217398 | 3300005456 | Bacteria | 1587 |
| 67 | Ga0070662_100157711 | 3300005457 | Bacteria | 1773 |
| 68 | Ga0070662_100326084 | 3300005457 | Bacteria | 1253 |
| 69 | Ga0070681_10118114 | 3300005458 | Bacteria | 2588 |
| 70 | Ga0068867_100006509 | 3300005459 | Bacteria | 8254 |
| 71 | Ga0068867_100008769 | 3300005459 | Bacteria | 7139 |
| 72 | Ga0068867_100079353 | 3300005459 | Bacteria | 2470 |
| 73 | Ga0068867_100290235 | 3300005459 | Bacteria | 1345 |
| 74 | Ga0070685_10050616 | 3300005466 | Bacteria | 2400 |
| 75 | Ga0070706_100017714 | 3300005467 | Bacteria | 6573 |
| 76 | Ga0070707_100077286 | 3300005468 | Bacteria | 3212 |
| 77 | Ga0070698_100071307 | 3300005471 | Bacteria | 3484 |
| 78 | Ga0070699_100338673 | 3300005518 | Bacteria | 1354 |
| 79 | Ga0070684_100702359 | 3300005535 | Bacteria | 943 |
| 80 | Ga0070684_100740714 | 3300005535 | Bacteria | 917 |
| 81 | Ga0068853_100000300 | 3300005539 | Bacteria | 34560 |
| 82 | Ga0068853_100005616 | 3300005539 | Bacteria | 9851 |
| 83 | Ga0068853_100005626 | 3300005539 | Bacteria | 9843 |
| 84 | Ga0068853_100021946 | 3300005539 | Bacteria | 5326 |
| 85 | Ga0068853_100069540 | 3300005539 | Bacteria | 3063 |
| 86 | Ga0070672_100000552 | 3300005543 | Bacteria | 22019 |
| 87 | Ga0070672_100001803 | 3300005543 | Bacteria | 13392 |
| 88 | Ga0070672_100029609 | 3300005543 | Bacteria | 4107 |
| 89 | Ga0070672_100089043 | 3300005543 | Bacteria | 2486 |
| 90 | Ga0070672_100129261 | 3300005543 | Bacteria | 2075 |
| 91 | Ga0070672_100152446 | 3300005543 | Bacteria | 1912 |
| 92 | Ga0070672_100166921 | 3300005543 | Bacteria | 1829 |
| 93 | Ga0070686_100057560 | 3300005544 | Bacteria | 2497 |
| 94 | Ga0070665_100002419 | 3300005548 | Bacteria | 20581 |
| 95 | Ga0070665_100009078 | 3300005548 | Bacteria | 10071 |
| 96 | Ga0070665_100020178 | 3300005548 | Bacteria | 6690 |
| 97 | Ga0070665_100025134 | 3300005548 | Bacteria | 6001 |
| 98 | Ga0070665_100382044 | 3300005548 | Bacteria | 1416 |
| 99 | Ga0070665_100383054 | 3300005548 | Bacteria | 1414 |
| 100 | Ga0070665_100395323 | 3300005548 | Bacteria | 1390 |
| 101 | Ga0070665_100724347 | 3300005548 | Bacteria | 1008 |
| 102 | Ga0070704_100097565 | 3300005549 | Bacteria | 2206 |
| 103 | Ga0068855_100276821 | 3300005563 | Bacteria | 1865 |
| 104 | Ga0070664_100224438 | 3300005564 | Bacteria | 1682 |
| 105 | Ga0068857_100008978 | 3300005577 | Bacteria | 8663 |
| 106 | Ga0068857_100030542 | 3300005577 | Bacteria | 4758 |
| 107 | Ga0068857_100110444 | 3300005577 | Bacteria | 2471 |
| 108 | Ga0068856_100122077 | 3300005614 | Bacteria | 2607 |
| 109 | Ga0070702_100084926 | 3300005615 | Bacteria | 1905 |
| 110 | Ga0068852_100019333 | 3300005616 | Bacteria | 5388 |
| 111 | Ga0068852_100270969 | 3300005616 | Bacteria | 1633 |
| 112 | Ga0068852_100571108 | 3300005616 | Bacteria | 1133 |
| 113 | Ga0068852_100695960 | 3300005616 | Bacteria | 1026 |
| 114 | Ga0068859_100001747 | 3300005617 | Bacteria | 22150 |
| 115 | Ga0068859_100052895 | 3300005617 | Bacteria | 4084 |
| 116 | Ga0068859_100209850 | 3300005617 | Bacteria | 2034 |
| 117 | Ga0068864_100008836 | 3300005618 | Bacteria | 8306 |
| 118 | Ga0068864_100009680 | 3300005618 | Bacteria | 7951 |
| 119 | Ga0068864_100014755 | 3300005618 | Bacteria | 6491 |
| 120 | Ga0068864_100156525 | 3300005618 | Bacteria | 2068 |
| 121 | Ga0068866_10153168 | 3300005718 | Bacteria | 1337 |
| 122 | Ga0068866_10246877 | 3300005718 | Bacteria | 1090 |
| 123 | Ga0068861_100000564 | 3300005719 | Bacteria | 21995 |
| 124 | Ga0068861_100029241 | 3300005719 | Bacteria | 4030 |
| 125 | Ga0068861_100086200 | 3300005719 | Bacteria | 2468 |
| 126 | Ga0068861_100123958 | 3300005719 | Bacteria | 2088 |
| 127 | Ga0068851_10000941 | 3300005834 | Bacteria | 12604 |
| 128 | Ga0068851_10099000 | 3300005834 | Bacteria | 1545 |
| 129 | Ga0068870_10042210 | 3300005840 | Bacteria | 2374 |
| 130 | Ga0068870_10055677 | 3300005840 | Bacteria | 2108 |
| 131 | Ga0068870_10127155 | 3300005840 | Bacteria | 1476 |
| 132 | Ga0068863_100004874 | 3300005841 | Bacteria | 13221 |
| 133 | Ga0068863_100022879 | 3300005841 | Bacteria | 5973 |
| 134 | Ga0068863_100045403 | 3300005841 | Bacteria | 4170 |
| 135 | Ga0068863_100061670 | 3300005841 | Bacteria | 3546 |
| 136 | Ga0068863_100127749 | 3300005841 | Bacteria | 2426 |
| 137 | Ga0068863_100305860 | 3300005841 | Bacteria | 1543 |
| 138 | Ga0068863_100490523 | 3300005841 | Bacteria | 1209 |
| 139 | Ga0068858_100011382 | 3300005842 | Bacteria | 8401 |
| 140 | Ga0068858_100021251 | 3300005842 | Bacteria | 6062 |
| 141 | Ga0068858_100058894 | 3300005842 | Bacteria | 3551 |
| 142 | Ga0068858_100111244 | 3300005842 | Bacteria | 2558 |
| 143 | Ga0068858_100284925 | 3300005842 | Bacteria | 1574 |
| 144 | Ga0068858_100750236 | 3300005842 | Bacteria | 951 |
| 145 | Ga0068860_100025029 | 3300005843 | Bacteria | 5762 |
| 146 | Ga0068860_100115312 | 3300005843 | Bacteria | 2569 |
| 147 | Ga0068860_100147446 | 3300005843 | Bacteria | 2265 |
| 148 | Ga0068860_100158482 | 3300005843 | Bacteria | 2181 |
| 149 | Ga0068862_100031354 | 3300005844 | Bacteria | 4486 |
| 150 | Ga0068862_100144529 | 3300005844 | Bacteria | 2113 |
| 151 | Ga0068862_100145317 | 3300005844 | Bacteria | 2107 |
| 152 | Ga0070717_10029680 | 3300006028 | Bacteria | 4390 |
| 153 | Ga0075364_10181337 | 3300006051 | Bacteria | 1425 |
| 154 | Ga0075367_10183240 | 3300006178 | Bacteria | 1306 |
| 155 | Ga0075369_10000833 | 3300006186 | Bacteria | 10168 |
| 156 | Ga0075369_10038299 | 3300006186 | Bacteria | 2045 |
| 157 | Ga0075366_10073931 | 3300006195 | Bacteria | 2032 |
| 158 | Ga0075366_10377159 | 3300006195 | Bacteria | 872 |
| 159 | Ga0097621_100018068 | 3300006237 | Bacteria | 5377 |
| 160 | Ga0097621_100231089 | 3300006237 | Bacteria | 1615 |
| 161 | Ga0075370_10019556 | 3300006353 | Bacteria | 3690 |
| 162 | Ga0075370_10021653 | 3300006353 | Bacteria | 3522 |
| 163 | Ga0075370_10134635 | 3300006353 | Bacteria | 1443 |
| 164 | Ga0068871_100004702 | 3300006358 | Bacteria | 9546 |
| 165 | Ga0068871_100032120 | 3300006358 | Bacteria | 4144 |
| 166 | Ga0068865_100535886 | 3300006881 | Bacteria | 981 |
| 167 | Ga0097620_100001747 | 3300006931 | Bacteria | 22150 |
| 168 | Ga0097620_100052895 | 3300006931 | Bacteria | 4084 |
| 169 | Ga0097620_100209860 | 3300006931 | Bacteria | 2034 |
| 170 | Ga0105240_10001580 | 3300009093 | Bacteria | 38653 |
| 171 | Ga0105240_10055003 | 3300009093 | Bacteria | 4985 |
| 172 | Ga0105240_10080523 | 3300009093 | Bacteria | 4005 |
| 173 | Ga0111539_10017990 | 3300009094 | Bacteria | 8754 |
| 174 | Ga0111539_10176415 | 3300009094 | Bacteria | 2496 |
| 175 | Ga0105245_10016254 | 3300009098 | Bacteria | 6488 |
| 176 | Ga0105245_10114570 | 3300009098 | Bacteria | 2511 |
| 177 | Ga0105247_10107572 | 3300009101 | Bacteria | 1791 |
| 178 | Ga0105247_10160628 | 3300009101 | Bacteria | 1487 |
| 179 | Ga0105243_10179041 | 3300009148 | Bacteria | 1842 |
| 180 | Ga0105243_10791060 | 3300009148 | Bacteria | 934 |
| 181 | Ga0105242_10043620 | 3300009176 | Bacteria | 3628 |
| 182 | Ga0105242_10671956 | 3300009176 | Bacteria | 1010 |
| 183 | Ga0105248_10016230 | 3300009177 | Bacteria | 8198 |
| 184 | Ga0105248_10111238 | 3300009177 | Bacteria | 3089 |
| 185 | Ga0105248_10316026 | 3300009177 | Bacteria | 1759 |
| 186 | Ga0105248_10387261 | 3300009177 | Bacteria | 1574 |
| 187 | Ga0105237_10001046 | 3300009545 | Bacteria | 37146 |
| 188 | Ga0105237_10241639 | 3300009545 | Bacteria | 1807 |
| 189 | Ga0105237_10264731 | 3300009545 | Unclassified | 1722 |
| 190 | Ga0105238_10007419 | 3300009551 | Bacteria | 10984 |
| 191 | Ga0105238_10246661 | 3300009551 | Bacteria | 1764 |
| 192 | Ga0105238_10507360 | 3300009551 | Bacteria | 1208 |
| 193 | Ga0105249_10108176 | 3300009553 | Bacteria | 2624 |
| 194 | Ga0105249_10192611 | 3300009553 | Bacteria | 1991 |
| 195 | Ga0105249_10277108 | 3300009553 | Bacteria | 1673 |
| 196 | Ga0105249_10443358 | 3300009553 | Bacteria | 1336 |
| 197 | Ga0105249_10793917 | 3300009553 | Bacteria | 1010 |
| 198 | Ga0105239_10001284 | 3300010375 | Bacteria | 33916 |
| 199 | Ga0105239_10366887 | 3300010375 | Bacteria | 1627 |
| 200 | Ga0105239_10742594 | 3300010375 | Bacteria | 1123 |
| 201 | Ga0157374_10063917 | 3300013296 | Bacteria | 3452 |
| 202 | Ga0157374_10102567 | 3300013296 | Bacteria | 2744 |
| 203 | Ga0157374_10284991 | 3300013296 | Bacteria | 1631 |
| 204 | Ga0157374_10420358 | 3300013296 | Bacteria | 1335 |
| 205 | Ga0157374_10440469 | 3300013296 | Bacteria | 1303 |
| 206 | Ga0157378_10010166 | 3300013297 | Bacteria | 8208 |
| 207 | Ga0157378_10016847 | 3300013297 | Bacteria | 6407 |
| 208 | Ga0157378_10051384 | 3300013297 | Bacteria | 3668 |
| 209 | Ga0157378_10275785 | 3300013297 | Bacteria | 1619 |
| 210 | Ga0163162_10014935 | 3300013306 | Bacteria | 7583 |
| 211 | Ga0163162_10041082 | 3300013306 | Bacteria | 4627 |
| 212 | Ga0163162_10054481 | 3300013306 | Bacteria | 4023 |
| 213 | Ga0163162_10216437 | 3300013306 | Bacteria | 2045 |
| 214 | Ga0163162_10219098 | 3300013306 | Bacteria | 2033 |
| 215 | Ga0157372_10241435 | 3300013307 | Bacteria | 2096 |
| 216 | Ga0157375_10004106 | 3300013308 | Bacteria | 12629 |
| 217 | Ga0157375_10011287 | 3300013308 | Bacteria | 7887 |
| 218 | Ga0157375_10086690 | 3300013308 | Bacteria | 3182 |
| 219 | Ga0157375_10105221 | 3300013308 | Bacteria | 2912 |
| 220 | Ga0157375_10115214 | 3300013308 | Bacteria | 2790 |
| 221 | Ga0157375_10138475 | 3300013308 | Bacteria | 2559 |
| 222 | Ga0157375_10152956 | 3300013308 | Bacteria | 2444 |
| 223 | Ga0157375_10180916 | 3300013308 | Bacteria | 2259 |
| 224 | Ga0157375_10420408 | 3300013308 | Bacteria | 1503 |
| 225 | Ga0157375_10442300 | 3300013308 | Bacteria | 1466 |
| 226 | Ga0157375_11416751 | 3300013308 | Bacteria | 819 |
| 227 | Ga0163163_10078621 | 3300014325 | Bacteria | 3295 |
| 228 | Ga0163163_10365842 | 3300014325 | Bacteria | 1499 |
| 229 | Ga0163163_10507632 | 3300014325 | Bacteria | 1268 |
| 230 | Ga0157380_10052009 | 3300014326 | Bacteria | 3242 |
| 231 | Ga0157380_10061653 | 3300014326 | Bacteria | 3002 |
| 232 | Ga0157380_10063192 | 3300014326 | Bacteria | 2968 |
| 233 | Ga0157380_10185677 | 3300014326 | Bacteria | 1831 |
| 234 | Ga0157380_10445550 | 3300014326 | Bacteria | 1242 |
| 235 | Ga0157380_10797396 | 3300014326 | Bacteria | 961 |
| 236 | Ga0157379_10001057 | 3300014968 | Bacteria | 22428 |
| 237 | Ga0157379_10002624 | 3300014968 | Bacteria | 15116 |
| 238 | Ga0157379_10942414 | 3300014968 | Bacteria | 821 |
| 239 | Ga0157376_10038509 | 3300014969 | Bacteria | 3891 |
| 240 | Ga0157376_10069703 | 3300014969 | Bacteria | 2982 |
| 241 | Ga0157376_10289135 | 3300014969 | Bacteria | 1547 |
| 242 | Ga0157376_10365782 | 3300014969 | Bacteria | 1385 |
| 243 | Ga0157376_10658637 | 3300014969 | Bacteria | 1048 |
| 244 | Ga0163161_10049193 | 3300017792 | Bacteria | 3046 |
| 245 | Ga0163161_10117090 | 3300017792 | Bacteria | 1998 |
| 246 | Ga0163161_10126069 | 3300017792 | Bacteria | 1928 |
| 247 | Ga0163161_10244336 | 3300017792 | Bacteria | 1397 |
| 248 | Ga0163161_10817916 | 3300017792 | Bacteria | 784 |
| 249 | Ga0209051_1000048 | 3300025303 | Bacteria | 292755 |
| 250 | Ga0209257_1026414 | 3300025304 | Bacteria | 1958 |
| 251 | Ga0207697_10014167 | 3300025315 | Bacteria | 3314 |
| 252 | Ga0207656_10003408 | 3300025321 | Bacteria | 5460 |
| 253 | Ga0207682_10002512 | 3300025893 | Bacteria | 8199 |
| 254 | Ga0207642_10095909 | 3300025899 | Bacteria | 1477 |
| 255 | Ga0207680_10041527 | 3300025903 | Bacteria | 2684 |
| 256 | Ga0207645_10004706 | 3300025907 | Bacteria | 10041 |
| 257 | Ga0207645_10007637 | 3300025907 | Bacteria | 7620 |
| 258 | Ga0207645_10086099 | 3300025907 | Bacteria | 2018 |
| 259 | Ga0207645_10178523 | 3300025907 | Bacteria | 1393 |
| 260 | Ga0207645_10262855 | 3300025907 | Bacteria | 1143 |
| 261 | Ga0207643_10041542 | 3300025908 | Bacteria | 2592 |
| 262 | Ga0207643_10043562 | 3300025908 | Bacteria | 2533 |
| 263 | Ga0207684_10003448 | 3300025910 | Bacteria | 15423 |
| 264 | Ga0207684_10155772 | 3300025910 | Bacteria | 1966 |
| 265 | Ga0207654_10091887 | 3300025911 | Bacteria | 1852 |
| 266 | Ga0207707_10195205 | 3300025912 | Bacteria | 1766 |
| 267 | Ga0207695_10013552 | 3300025913 | Bacteria | 9714 |
| 268 | Ga0207671_10002719 | 3300025914 | Bacteria | 18528 |
| 269 | Ga0207671_10127247 | 3300025914 | Bacteria | 1952 |
| 270 | Ga0207660_10042148 | 3300025917 | Bacteria | 3202 |
| 271 | Ga0207660_10318319 | 3300025917 | Bacteria | 1242 |
| 272 | Ga0207662_10142365 | 3300025918 | Bacteria | 1520 |
| 273 | Ga0207646_10333505 | 3300025922 | Bacteria | 1370 |
| 274 | Ga0207681_10011126 | 3300025923 | Bacteria | 5527 |
| 275 | Ga0207681_10014702 | 3300025923 | Bacteria | 4872 |
| 276 | Ga0207694_10014747 | 3300025924 | Bacteria | 5893 |
| 277 | Ga0207694_10024439 | 3300025924 | Bacteria | 4589 |
| 278 | Ga0207694_10034092 | 3300025924 | Bacteria | 3902 |
| 279 | Ga0207694_10114621 | 3300025924 | Bacteria | 2147 |
| 280 | Ga0207694_10537259 | 3300025924 | Bacteria | 981 |
| 281 | Ga0207650_10016788 | 3300025925 | Bacteria | 5120 |
| 282 | Ga0207650_10017344 | 3300025925 | Bacteria | 5040 |
| 283 | Ga0207650_10018525 | 3300025925 | Bacteria | 4886 |
| 284 | Ga0207650_10023927 | 3300025925 | Bacteria | 4336 |
| 285 | Ga0207650_10095306 | 3300025925 | Bacteria | 2281 |
| 286 | Ga0207659_10010777 | 3300025926 | Bacteria | 5752 |
| 287 | Ga0207659_10016864 | 3300025926 | Bacteria | 4762 |
| 288 | Ga0207659_10069050 | 3300025926 | Bacteria | 2572 |
| 289 | Ga0207687_10004824 | 3300025927 | Bacteria | 8967 |
| 290 | Ga0207687_10022894 | 3300025927 | Bacteria | 4161 |
| 291 | Ga0207700_10000086 | 3300025928 | Bacteria | 58118 |
| 292 | Ga0207700_10304540 | 3300025928 | Bacteria | 1377 |
| 293 | Ga0207644_10001344 | 3300025931 | Bacteria | 15805 |
| 294 | Ga0207644_10012267 | 3300025931 | Bacteria | 5689 |
| 295 | Ga0207644_10083288 | 3300025931 | Bacteria | 2368 |
| 296 | Ga0207644_10163159 | 3300025931 | Bacteria | 1734 |
| 297 | Ga0207644_10165021 | 3300025931 | Bacteria | 1725 |
| 298 | Ga0207706_10023984 | 3300025933 | Bacteria | 5474 |
| 299 | Ga0207706_10136364 | 3300025933 | Bacteria | 2159 |
| 300 | Ga0207706_10152693 | 3300025933 | Bacteria | 2031 |
| 301 | Ga0207686_10580369 | 3300025934 | Bacteria | 880 |
| 302 | Ga0207709_10025299 | 3300025935 | Bacteria | 3397 |
| 303 | Ga0207670_10010745 | 3300025936 | Bacteria | 5285 |
| 304 | Ga0207669_10003485 | 3300025937 | Bacteria | 6803 |
| 305 | Ga0207669_10008259 | 3300025937 | Bacteria | 4880 |
| 306 | Ga0207669_10415108 | 3300025937 | Bacteria | 1058 |
| 307 | Ga0207704_10242419 | 3300025938 | Bacteria | 1348 |
| 308 | Ga0207704_10535206 | 3300025938 | Bacteria | 950 |
| 309 | Ga0207691_10000018 | 3300025940 | Bacteria | 134343 |
| 310 | Ga0207691_10000509 | 3300025940 | Bacteria | 38750 |
| 311 | Ga0207691_10003508 | 3300025940 | Bacteria | 15262 |
| 312 | Ga0207691_10014158 | 3300025940 | Bacteria | 7610 |
| 313 | Ga0207691_10033514 | 3300025940 | Bacteria | 4781 |
| 314 | Ga0207691_10139309 | 3300025940 | Bacteria | 2138 |
| 315 | Ga0207711_10073235 | 3300025941 | Bacteria | 2977 |
| 316 | Ga0207711_10081316 | 3300025941 | Bacteria | 2831 |
| 317 | Ga0207689_10000174 | 3300025942 | Bacteria | 56242 |
| 318 | Ga0207689_10004337 | 3300025942 | Bacteria | 12921 |
| 319 | Ga0207689_10421192 | 3300025942 | Bacteria | 1114 |
| 320 | Ga0207661_10068898 | 3300025944 | Bacteria | 2883 |
| 321 | Ga0207679_10206178 | 3300025945 | Bacteria | 1646 |
| 322 | Ga0207651_10002164 | 3300025960 | Bacteria | 9298 |
| 323 | Ga0207651_10002176 | 3300025960 | Bacteria | 9280 |
| 324 | Ga0207651_10282497 | 3300025960 | Bacteria | 1372 |
| 325 | Ga0207712_10313407 | 3300025961 | Bacteria | 1292 |
| 326 | Ga0207668_10002010 | 3300025972 | Bacteria | 11871 |
| 327 | Ga0207668_10002470 | 3300025972 | Bacteria | 10799 |
| 328 | Ga0207668_10016568 | 3300025972 | Bacteria | 4601 |
| 329 | Ga0207668_10029303 | 3300025972 | Bacteria | 3607 |
| 330 | Ga0207668_10100816 | 3300025972 | Bacteria | 2145 |
| 331 | Ga0207658_10008875 | 3300025986 | Bacteria | 6823 |
| 332 | Ga0207658_10013016 | 3300025986 | Bacteria | 5682 |
| 333 | Ga0207658_10016070 | 3300025986 | Bacteria | 5140 |
| 334 | Ga0207658_10034666 | 3300025986 | Bacteria | 3609 |
| 335 | Ga0207658_10051891 | 3300025986 | Bacteria | 3024 |
| 336 | Ga0207658_10078755 | 3300025986 | Bacteria | 2519 |
| 337 | Ga0207658_10082139 | 3300025986 | Bacteria | 2474 |
| 338 | Ga0207658_10339222 | 3300025986 | Bacteria | 1306 |
| 339 | Ga0207677_10003221 | 3300026023 | Bacteria | 8613 |
| 340 | Ga0207677_10013142 | 3300026023 | Bacteria | 4786 |
| 341 | Ga0207703_10193637 | 3300026035 | Bacteria | 1802 |
| 342 | Ga0207703_10644804 | 3300026035 | Bacteria | 1004 |
| 343 | Ga0207639_10000508 | 3300026041 | Bacteria | 26945 |
| 344 | Ga0207639_10009051 | 3300026041 | Bacteria | 6860 |
| 345 | Ga0207639_10090056 | 3300026041 | Bacteria | 2453 |
| 346 | Ga0207639_10093910 | 3300026041 | Bacteria | 2407 |
| 347 | Ga0207678_10006420 | 3300026067 | Bacteria | 10433 |
| 348 | Ga0207708_10006963 | 3300026075 | Bacteria | 8361 |
| 349 | Ga0207708_10080620 | 3300026075 | Bacteria | 2501 |
| 350 | Ga0207708_10202874 | 3300026075 | Bacteria | 1582 |
| 351 | Ga0207702_10278949 | 3300026078 | Bacteria | 1579 |
| 352 | Ga0207641_10014012 | 3300026088 | Bacteria | 6573 |
| 353 | Ga0207641_10027403 | 3300026088 | Bacteria | 4705 |
| 354 | Ga0207641_10057332 | 3300026088 | Bacteria | 3312 |
| 355 | Ga0207641_10099950 | 3300026088 | Bacteria | 2554 |
| 356 | Ga0207641_10165395 | 3300026088 | Bacteria | 2014 |
| 357 | Ga0207648_10001922 | 3300026089 | Bacteria | 22701 |
| 358 | Ga0207648_10015731 | 3300026089 | Bacteria | 6940 |
| 359 | Ga0207648_10033203 | 3300026089 | Bacteria | 4552 |
| 360 | Ga0207648_10189296 | 3300026089 | Bacteria | 1823 |
| 361 | Ga0207648_10220267 | 3300026089 | Bacteria | 1686 |
| 362 | Ga0207648_10334797 | 3300026089 | Bacteria | 1362 |
| 363 | Ga0207676_10010076 | 3300026095 | Bacteria | 6725 |
| 364 | Ga0207676_10013354 | 3300026095 | Bacteria | 5899 |
| 365 | Ga0207676_10034639 | 3300026095 | Bacteria | 3824 |
| 366 | Ga0207676_10130273 | 3300026095 | Bacteria | 2137 |
| 367 | Ga0207674_10041103 | 3300026116 | Bacteria | 4784 |
| 368 | Ga0207674_10090058 | 3300026116 | Bacteria | 3059 |
| 369 | Ga0207674_10581134 | 3300026116 | Unclassified | 1082 |
| 370 | Ga0207675_100000847 | 3300026118 | Bacteria | 30430 |
| 371 | Ga0207675_100021000 | 3300026118 | Bacteria | 6087 |
| 372 | Ga0207675_100033377 | 3300026118 | Bacteria | 4796 |
| 373 | Ga0207675_100058168 | 3300026118 | Bacteria | 3608 |
| 374 | Ga0207683_10000020 | 3300026121 | Bacteria | 118805 |
| 375 | Ga0207683_10002464 | 3300026121 | Bacteria | 16138 |
| 376 | Ga0207683_10029090 | 3300026121 | Bacteria | 4782 |
| 377 | Ga0207683_10137516 | 3300026121 | Bacteria | 2199 |
| 378 | Ga0207698_10007168 | 3300026142 | Bacteria | 6981 |
| 379 | Ga0207698_10208502 | 3300026142 | Bacteria | 1756 |
| 380 | Ga0207428_10371703 | 3300027907 | Bacteria | 1050 |
| 381 | Ga0268266_10013368 | 3300028379 | Bacteria | 7071 |
| 382 | Ga0268266_10063383 | 3300028379 | Bacteria | 3191 |
| 383 | Ga0268266_10078638 | 3300028379 | Bacteria | 2870 |
| 384 | Ga0268266_10173632 | 3300028379 | Bacteria | 1958 |
| 385 | Ga0268266_10335395 | 3300028379 | Bacteria | 1418 |
| 386 | Ga0268266_10388485 | 3300028379 | Bacteria | 1318 |
| 387 | Ga0268265_10028173 | 3300028380 | Bacteria | 4019 |
| 388 | Ga0268265_10030373 | 3300028380 | Bacteria | 3891 |
| 389 | Ga0268265_10134089 | 3300028380 | Bacteria | 2063 |
| 390 | Ga0268265_10142539 | 3300028380 | Bacteria | 2008 |
| 391 | Ga0268265_10631954 | 3300028380 | Bacteria | 1027 |
| 392 | Ga0268264_10002310 | 3300028381 | Bacteria | 16863 |
| 393 | Ga0268264_10152755 | 3300028381 | Bacteria | 2072 |
| 394 | Ga0268264_10229254 | 3300028381 | Bacteria | 1714 |
| 395 | Ga0268264_10254749 | 3300028381 | Bacteria | 1632 |
| 396 | Ga0268264_10338371 | 3300028381 | Bacteria | 1429 |
| 397 | Ga0268264_10388798 | 3300028381 | Bacteria | 1338 |
| 398 | Ga0265319_1047676 | 3300028563 | Bacteria | 1425 |
| 399 | Ga0265318_10000108 | 3300028577 | Bacteria | 77334 |
| 400 | Ga0265318_10000878 | 3300028577 | Bacteria | 19643 |
| 401 | Ga0265336_10002346 | 3300028666 | Bacteria | 7871 |
| 402 | Ga0307517_10272545 | 3300028786 | Bacteria | 972 |
| 403 | Ga0265338_10004756 | 3300028800 | Bacteria | 18161 |
| 404 | Ga0265338_10192985 | 3300028800 | Bacteria | 1542 |
| 405 | Ga0265330_10000201 | 3300031235 | Bacteria | 46135 |
| 406 | Ga0265330_10002606 | 3300031235 | Bacteria | 9801 |
| 407 | Ga0265330_10005212 | 3300031235 | Bacteria | 6492 |
| 408 | Ga0265332_10000255 | 3300031238 | Bacteria | 42422 |
| 409 | Ga0265332_10000447 | 3300031238 | Bacteria | 29010 |
| 410 | Ga0265332_10002933 | 3300031238 | Bacteria | 8391 |
| 411 | Ga0265328_10000254 | 3300031239 | Bacteria | 24536 |
| 412 | Ga0265328_10001319 | 3300031239 | Bacteria | 11456 |
| 413 | Ga0265328_10002130 | 3300031239 | Bacteria | 8936 |
| 414 | Ga0265328_10010589 | 3300031239 | Bacteria | 3705 |
| 415 | Ga0265320_10000085 | 3300031240 | Bacteria | 78884 |
| 416 | Ga0265320_10001256 | 3300031240 | Bacteria | 18602 |
| 417 | Ga0265320_10002076 | 3300031240 | Bacteria | 14103 |
| 418 | Ga0265320_10011178 | 3300031240 | Bacteria | 5294 |
| 419 | Ga0265320_10061572 | 3300031240 | Bacteria | 1789 |
| 420 | Ga0265325_10031821 | 3300031241 | Bacteria | 2820 |
| 421 | Ga0265329_10003349 | 3300031242 | Bacteria | 7009 |
| 422 | Ga0265329_10005103 | 3300031242 | Bacteria | 5355 |
| 423 | Ga0265339_10003541 | 3300031249 | Bacteria | 10916 |
| 424 | Ga0265339_10008026 | 3300031249 | Bacteria | 6753 |
| 425 | Ga0265339_10084862 | 3300031249 | Bacteria | 1668 |
| 426 | Ga0265331_10000179 | 3300031250 | Bacteria | 77238 |
| 427 | Ga0265331_10000354 | 3300031250 | Bacteria | 48614 |
| 428 | Ga0265331_10000762 | 3300031250 | Bacteria | 26873 |
| 429 | Ga0265327_10028928 | 3300031251 | Bacteria | 3160 |
| 430 | Ga0265316_10003342 | 3300031344 | Bacteria | 16262 |
| 431 | Ga0265316_10003383 | 3300031344 | Bacteria | 16155 |
| 432 | Ga0265316_10152207 | 3300031344 | Bacteria | 1732 |
| 433 | Ga0265313_10000103 | 3300031595 | Bacteria | 85452 |
| 434 | Ga0265313_10017259 | 3300031595 | Bacteria | 4110 |
| 435 | Ga0265313_10018126 | 3300031595 | Bacteria | 3966 |
| 436 | Ga0316579_10014904 | 3300031691 | Bacteria | 3369 |
| 437 | Ga0316579_10269876 | 3300031691 | Bacteria | 822 |
| 438 | Ga0265314_10000235 | 3300031711 | Bacteria | 82170 |
| 439 | Ga0265314_10002694 | 3300031711 | Bacteria | 17787 |
| 440 | Ga0265314_10017420 | 3300031711 | Bacteria | 5640 |
| 441 | Ga0265314_10031242 | 3300031711 | Bacteria | 3935 |
| 442 | Ga0265342_10000463 | 3300031712 | Bacteria | 44008 |
| 443 | Ga0265342_10001967 | 3300031712 | Bacteria | 18369 |
| 444 | Ga0265342_10003566 | 3300031712 | Bacteria | 12730 |
| 445 | Ga0265342_10009235 | 3300031712 | Bacteria | 6974 |
| 446 | Ga0265342_10025498 | 3300031712 | Bacteria | 3715 |
| 447 | Ga0265342_10086579 | 3300031712 | Bacteria | 1801 |
| 448 | Ga0316578_10025420 | 3300031728 | Bacteria | 3329 |
| 449 | Ga0307516_10006932 | 3300031730 | Bacteria | 13155 |
| 450 | Ga0316577_10149253 | 3300031733 | Bacteria | 1317 |
| 451 | Ga0307518_10381583 | 3300031838 | Bacteria | 799 |
| 452 | Ga0307414_10033653 | 3300032004 | Bacteria | 3390 |
| 453 | Ga0307411_10000039 | 3300032005 | Bacteria | 40183 |
| 454 | Ga0316583_10054956 | 3300032133 | Bacteria | 1400 |
| 455 | Ga0316583_10135685 | 3300032133 | Bacteria | 857 |
| 456 | Ga0316585_10026141 | 3300032137 | Bacteria | 1813 |
| 457 | Ga0316593_10012065 | 3300032168 | Bacteria | 2528 |
| 458 | Ga0316596_1007743 | 3300033541 | Bacteria | 2544 |
| 459 | Ga0373945_0154736 | 3300035116 | Bacteria | 931 |
| 460 | Ga0373956_0191930 | 3300035119 | Bacteria | 967 |
| 461 | Ga0373943_0262802 | 3300035170 | Bacteria | 972 |
| 462 | Ga0316574_0050562 | 3300035398 | Bacteria | 2587 |
| 463 | Ga0316574_0103129 | 3300035398 | Bacteria | 1826 |
| 464 | Ga0373931_0186196 | 3300035691 | Bacteria | 1232 |
| 465 | Ga0373931_0189163 | 3300035691 | Bacteria | 1224 |
| 466 | Ga0373935_0024014 | 3300035692 | Bacteria | 3748 |
| 467 | Ga0373927_0013717 | 3300035695 | Bacteria | 5380 |
| 468 | Ga0373933_0326290 | 3300035724 | Bacteria | 996 |
| 469 | Ga0373947_0011346 | 3300035725 | Bacteria | 5115 |
| 470 | Ga0373937_0302455 | 3300036401 | Bacteria | 1512 |
| 471 | Ga0373937_0395001 | 3300036401 | Bacteria | 1312 |
| 472 | Ga0373937_0946341 | 3300036401 | Bacteria | 810 |
| 473 | Ga0316582_0077427 | 3300036647 | Bacteria | 2164 |
| 474 | Ga0316584_0214441 | 3300036712 | Bacteria | 1416 |
| 475 | Ga0373925_0023031 | 3300037068 | Bacteria | 4545 |
| 476 | Ga0316581_0092571 | 3300037588 | Bacteria | 930 |
| 477 | Ga0451791_1069114 | 3300041451 | Bacteria | 961 |
| 478 | Ga0451793_1183674 | 3300041452 | Bacteria | 926 |
| 479 | Ga0451798_0182565 | 3300041458 | Bacteria | 1595 |
| 480 | Ga0451800_1048118 | 3300041459 | Bacteria | 1042 |
| 481 | Ga0451802_0675091 | 3300041460 | Bacteria | 1019 |
| 482 | Ga0451807_0545829 | 3300041486 | Bacteria | 1270 |
| 483 | Ga0451837_0610918 | 3300041494 | Bacteria | 1104 |
| 484 | Ga0451843_1081050 | 3300041509 | Unclassified | 766 |
| 485 | Ga0439448_0008586 | 3300042005 | Bacteria | 2994 |
| 486 | Ga0439450_023743 | 3300042008 | Unclassified | 1333 |
| 487 | Ga0451577_0000168 | 3300042876 | Bacteria | 144187 |
| 488 | Ga0451577_0004136 | 3300042876 | Bacteria | 15551 |
| 489 | Ga0451577_0056986 | 3300042876 | Bacteria | 3484 |
| 490 | Ga0453684_0000642 | 3300044712 | Bacteria | 126116 |
| 491 | Ga0453684_0078329 | 3300044712 | Bacteria | 4136 |
| 492 | Ga0453684_0081004 | 3300044712 | Bacteria | 4051 |
| 493 | Ga0453684_0082276 | 3300044712 | Bacteria | 4012 |
| 494 | Ga0453684_0102584 | 3300044712 | Bacteria | 3497 |
| 495 | Ga0451576_0185013 | 3300045051 | Bacteria | 2175 |
| 496 | Ga0451576_0328737 | 3300045051 | Bacteria | 1600 |
| 497 | Ga0495580_0123890 | 3300046472 | Bacteria | 1794 |
| 498 | Ga0495630_0114451 | 3300046517 | Bacteria | 2044 |
| 499 | Ga0495648_0070545 | 3300046524 | Bacteria | 2030 |
| 500 | Ga0495658_0178633 | 3300046683 | Bacteria | 1316 |
| 501 | Ga0495658_0246490 | 3300046683 | Bacteria | 1123 |
| 502 | Ga0495624_0009675 | 3300046690 | Bacteria | 6674 |
| 503 | Ga0495671_0125560 | 3300046692 | Bacteria | 1251 |
| 504 | Ga0495674_0241349 | 3300047319 | Bacteria | 1489 |
| 505 | Ga0495676_0010954 | 3300047321 | Bacteria | 8199 |
| 506 | Ga0495602_0172370 | 3300048088 | Bacteria | 1678 |
| 507 | Ga0496100_0000133 | 3300048903 | Bacteria | 41506 |
| 508 | Ga0496101_0000661 | 3300048904 | Bacteria | 20755 |
| 509 | Ga0496102_0205966 | 3300048905 | Bacteria | 1854 |
| 510 | Ga0496103_0012076 | 3300048906 | Bacteria | 5130 |
| 511 | Ga0496104_0616238 | 3300048907 | Bacteria | 995 |
| 512 | Ga0496105_0332438 | 3300048908 | Bacteria | 1216 |
| 513 | Ga0496105_0534599 | 3300048908 | Bacteria | 917 |
| 514 | Ga0496106_0000992 | 3300048909 | Bacteria | 20718 |
| 515 | Ga0496106_0114597 | 3300048909 | Bacteria | 2102 |
| 516 | Ga0496107_0501879 | 3300048910 | Bacteria | 900 |
| 517 | Ga0496108_0279919 | 3300048911 | Bacteria | 1452 |
| 518 | Ga0496109_0000529 | 3300048912 | Bacteria | 32345 |
| 519 | Ga0496109_0573604 | 3300048912 | Bacteria | 1064 |
| 520 | Ga0496110_0013633 | 3300048913 | Bacteria | 6729 |
| 521 | Ga0496110_0141582 | 3300048913 | Bacteria | 2174 |
| 522 | Ga0496111_0006650 | 3300048914 | Bacteria | 7521 |
| 523 | Ga0496113_0023631 | 3300048916 | Bacteria | 4359 |
| 524 | Ga0496114_0001244 | 3300048917 | Bacteria | 19276 |
| 525 | Ga0496116_0031538 | 3300048919 | Bacteria | 3792 |
| 526 | Ga0496117_0000752 | 3300048920 | Bacteria | 51072 |
| 527 | Ga0496118_0038785 | 3300048921 | Bacteria | 3812 |
| 528 | Ga0496119_0014870 | 3300048922 | Bacteria | 6051 |
| 529 | Ga0496121_0000027 | 3300048924 | Bacteria | 444747 |
| 530 | Ga0496122_0000611 | 3300048925 | Bacteria | 73411 |
| 531 | Ga0496123_0003205 | 3300048926 | Bacteria | 18661 |
| 532 | Ga0496123_0063787 | 3300048926 | Bacteria | 2351 |
| 533 | Ga0496124_0000016 | 3300048927 | Bacteria | 444747 |
| 534 | Ga0496125_0000008 | 3300048928 | Bacteria | 704677 |
| 535 | Ga0496126_0000025 | 3300048929 | Bacteria | 444747 |
| 536 | Ga0496126_0017258 | 3300048929 | Bacteria | 7193 |
| 537 | Ga0501069_0153713 | 3300049585 | Bacteria | 1323 |
| 538 | Ga0501070_0000007 | 3300049586 | Bacteria | 219869 |
| 539 | Ga0501079_0031117 | 3300049741 | Bacteria | 4101 |
| 540 | Ga0501081_0116894 | 3300049743 | Bacteria | 1896 |
| 541 | Ga0501083_0002000 | 3300049744 | Bacteria | 14027 |
| 542 | nmdc:mga00v17_239889_c1 | 3300050491 | Bacteria | 1175 |
| 543 | nmdc:mga0k408_19618_c1 | 3300050493 | Bacteria | 3781 |
| 544 | nmdc:mga0k408_50155_c1 | 3300050493 | Bacteria | 2416 |
| 545 | nmdc:mga0k408_85703_c1 | 3300050493 | Bacteria | 1849 |
| 546 | nmdc:mga06z11_110865_c1 | 3300050494 | Bacteria | 1519 |
| 547 | nmdc:mga07m45_176366_c1 | 3300050496 | Bacteria | 1243 |
| 548 | nmdc:mga07m45_208756_c1 | 3300050496 | Bacteria | 1136 |
| 549 | nmdc:mga07m45_5468_c1 | 3300050496 | Bacteria | 6325 |
| 550 | nmdc:mga0qj67_361777_c1 | 3300050509 | Bacteria | 1172 |
| 551 | nmdc:mga08y16_210431_c1 | 3300050511 | Bacteria | 2014 |
| 552 | nmdc:mga08y16_61528_c1 | 3300050511 | Bacteria | 3920 |
| 553 | Ga0495612_0177941 | 3300053078 | Bacteria | 933 |
| 554 | Ga0495619_0017309 | 3300053085 | Bacteria | 4565 |
| 555 | Ga0500641_0014674 | 3300053096 | Bacteria | 2894 |
| 556 | Ga0500641_0043432 | 3300053096 | Bacteria | 1824 |
| 557 | Ga0500588_0119327 | 3300053146 | Bacteria | 929 |
| 558 | Ga0500645_027882 | 3300053730 | Bacteria | 1711 |
| 559 | Ga0501082_0042165 | 3300060353 | Bacteria | 3934 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037588 | Ga0316581_0092571 | Ga0316581_0092571_11_700 | 229 |
| 2 | 3300005328 | Ga0070676_10225468 | Ga0070676_102254682 | 235 |
| 3 | 3300009176 | Ga0105242_10043620 | Ga0105242_100436202 | 235 |
| 4 | 3300009176 | Ga0105242_10671956 | Ga0105242_106719561 | 235 |
| 5 | 3300009177 | Ga0105248_10016230 | Ga0105248_100162304 | 235 |
| 6 | 3300013296 | Ga0157374_10440469 | Ga0157374_104404692 | 235 |
| 7 | 3300013297 | Ga0157378_10010166 | Ga0157378_100101664 | 235 |
| 8 | 3300013306 | Ga0163162_10041082 | Ga0163162_100410826 | 235 |
| 9 | 3300013306 | Ga0163162_10054481 | Ga0163162_100544814 | 235 |
| 10 | 3300013308 | Ga0157375_10420408 | Ga0157375_104204082 | 235 |
| 11 | 3300014325 | Ga0163163_10078621 | Ga0163163_100786212 | 235 |
| 12 | 3300014325 | Ga0163163_10365842 | Ga0163163_103658422 | 235 |
| 13 | 3300014326 | Ga0157380_10052009 | Ga0157380_100520093 | 235 |
| 14 | 3300014326 | Ga0157380_10063192 | Ga0157380_100631923 | 235 |
| 15 | 3300014326 | Ga0157380_10185677 | Ga0157380_101856773 | 235 |
| 16 | 3300014968 | Ga0157379_10001057 | Ga0157379_1000105712 | 235 |
| 17 | 3300036401 | Ga0373937_0946341 | Ga0373937_0946341_62_793 | 235 |
| 18 | 3300005354 | Ga0070675_100167959 | Ga0070675_1001679592 | 236 |
| 19 | 3300013308 | Ga0157375_10115214 | Ga0157375_101152142 | 236 |
| 20 | 3300014326 | Ga0157380_10797396 | Ga0157380_107973962 | 236 |
| 21 | 3300005617 | Ga0068859_100052895 | Ga0068859_1000528954 | 237 |
| 22 | 3300006931 | Ga0097620_100052895 | Ga0097620_1000528954 | 237 |
| 23 | 3300025924 | Ga0207694_10024439 | Ga0207694_100244398 | 237 |
| 24 | 3300041494 | Ga0451837_0610918 | Ga0451837_0610918_322_1035 | 237 |
| 25 | iso_pu_bacteria | 2643221654 | 2644305181 | 237 |
| 26 | iso_pu_bacteria | 2989392574 | 2989392834 | 237 |
| 27 | 3300009093 | Ga0105240_10055003 | Ga0105240_100550036 | 238 |
| 28 | 3300041460 | Ga0451802_0675091 | Ga0451802_0675091_261_983 | 238 |
| 29 | 3300049586 | Ga0501070_0000007 | Ga0501070_0000007_53073_53795 | 238 |
| 30 | 3300049741 | Ga0501079_0031117 | Ga0501079_0031117_2058_2780 | 238 |
| 31 | 3300049743 | Ga0501081_0116894 | Ga0501081_0116894_960_1682 | 238 |
| 32 | iso_pu_bacteria | 2738541264 | 2738668811 | 238 |
| 33 | iso_pu_bacteria | 2738541356 | 2739148003 | 238 |
| 34 | 3300005331 | Ga0070670_100077873 | Ga0070670_1000778733 | 240 |
| 35 | 3300005333 | Ga0070677_10057419 | Ga0070677_100574191 | 240 |
| 36 | 3300005338 | Ga0068868_100023141 | Ga0068868_1000231412 | 240 |
| 37 | 3300005338 | Ga0068868_100043514 | Ga0068868_1000435143 | 240 |
| 38 | 3300005355 | Ga0070671_100021662 | Ga0070671_1000216623 | 240 |
| 39 | 3300005355 | Ga0070671_100074683 | Ga0070671_1000746833 | 240 |
| 40 | 3300005364 | Ga0070673_100002697 | Ga0070673_1000026973 | 240 |
| 41 | 3300005445 | Ga0070708_100038472 | Ga0070708_1000384726 | 240 |
| 42 | 3300005457 | Ga0070662_100157711 | Ga0070662_1001577113 | 240 |
| 43 | 3300005459 | Ga0068867_100006509 | Ga0068867_1000065098 | 240 |
| 44 | 3300005467 | Ga0070706_100017714 | Ga0070706_1000177146 | 240 |
| 45 | 3300005518 | Ga0070699_100338673 | Ga0070699_1003386732 | 240 |
| 46 | 3300005539 | Ga0068853_100069540 | Ga0068853_1000695402 | 240 |
| 47 | 3300005543 | Ga0070672_100001803 | Ga0070672_1000018034 | 240 |
| 48 | 3300005548 | Ga0070665_100009078 | Ga0070665_1000090788 | 240 |
| 49 | 3300005548 | Ga0070665_100724347 | Ga0070665_1007243471 | 240 |
| 50 | 3300005577 | Ga0068857_100030542 | Ga0068857_1000305424 | 240 |
| 51 | 3300005616 | Ga0068852_100571108 | Ga0068852_1005711082 | 240 |
| 52 | 3300005617 | Ga0068859_100209850 | Ga0068859_1002098502 | 240 |
| 53 | 3300005618 | Ga0068864_100008836 | Ga0068864_1000088367 | 240 |
| 54 | 3300005840 | Ga0068870_10055677 | Ga0068870_100556772 | 240 |
| 55 | 3300005841 | Ga0068863_100490523 | Ga0068863_1004905232 | 240 |
| 56 | 3300006178 | Ga0075367_10183240 | Ga0075367_101832402 | 240 |
| 57 | 3300006195 | Ga0075366_10377159 | Ga0075366_103771591 | 240 |
| 58 | 3300006353 | Ga0075370_10019556 | Ga0075370_100195564 | 240 |
| 59 | 3300006353 | Ga0075370_10021653 | Ga0075370_100216532 | 240 |
| 60 | 3300006353 | Ga0075370_10134635 | Ga0075370_101346351 | 240 |
| 61 | 3300006931 | Ga0097620_100209860 | Ga0097620_1002098602 | 240 |
| 62 | 3300009093 | Ga0105240_10001580 | Ga0105240_1000158026 | 240 |
| 63 | 3300009098 | Ga0105245_10016254 | Ga0105245_100162545 | 240 |
| 64 | 3300009098 | Ga0105245_10114570 | Ga0105245_101145702 | 240 |
| 65 | 3300009148 | Ga0105243_10179041 | Ga0105243_101790413 | 240 |
| 66 | 3300009545 | Ga0105237_10001046 | Ga0105237_1000104610 | 240 |
| 67 | 3300009551 | Ga0105238_10007419 | Ga0105238_100074196 | 240 |
| 68 | 3300009551 | Ga0105238_10507360 | Ga0105238_105073601 | 240 |
| 69 | 3300010375 | Ga0105239_10001284 | Ga0105239_1000128410 | 240 |
| 70 | 3300010375 | Ga0105239_10742594 | Ga0105239_107425941 | 240 |
| 71 | 3300013296 | Ga0157374_10420358 | Ga0157374_104203582 | 240 |
| 72 | 3300013297 | Ga0157378_10051384 | Ga0157378_100513844 | 240 |
| 73 | 3300013308 | Ga0157375_10086690 | Ga0157375_100866903 | 240 |
| 74 | 3300013308 | Ga0157375_10442300 | Ga0157375_104423002 | 240 |
| 75 | 3300014325 | Ga0163163_10507632 | Ga0163163_105076321 | 240 |
| 76 | 3300025304 | Ga0209257_1026414 | Ga0209257_10264142 | 240 |
| 77 | 3300025907 | Ga0207645_10007637 | Ga0207645_100076373 | 240 |
| 78 | 3300025908 | Ga0207643_10043562 | Ga0207643_100435623 | 240 |
| 79 | 3300025910 | Ga0207684_10003448 | Ga0207684_1000344811 | 240 |
| 80 | 3300025913 | Ga0207695_10013552 | Ga0207695_1001355210 | 240 |
| 81 | 3300025914 | Ga0207671_10002719 | Ga0207671_100027194 | 240 |
| 82 | 3300025924 | Ga0207694_10034092 | Ga0207694_100340924 | 240 |
| 83 | 3300025924 | Ga0207694_10114621 | Ga0207694_101146213 | 240 |
| 84 | 3300025925 | Ga0207650_10018525 | Ga0207650_100185253 | 240 |
| 85 | 3300025927 | Ga0207687_10004824 | Ga0207687_100048242 | 240 |
| 86 | 3300025927 | Ga0207687_10022894 | Ga0207687_100228942 | 240 |
| 87 | 3300025931 | Ga0207644_10012267 | Ga0207644_100122673 | 240 |
| 88 | 3300025931 | Ga0207644_10083288 | Ga0207644_100832882 | 240 |
| 89 | 3300025933 | Ga0207706_10152693 | Ga0207706_101526933 | 240 |
| 90 | 3300025940 | Ga0207691_10014158 | Ga0207691_100141584 | 240 |
| 91 | 3300025960 | Ga0207651_10002164 | Ga0207651_100021642 | 240 |
| 92 | 3300025986 | Ga0207658_10078755 | Ga0207658_100787553 | 240 |
| 93 | 3300026023 | Ga0207677_10013142 | Ga0207677_100131422 | 240 |
| 94 | 3300026088 | Ga0207641_10099950 | Ga0207641_100999503 | 240 |
| 95 | 3300026089 | Ga0207648_10033203 | Ga0207648_100332034 | 240 |
| 96 | 3300026095 | Ga0207676_10130273 | Ga0207676_101302731 | 240 |
| 97 | 3300026142 | Ga0207698_10208502 | Ga0207698_102085022 | 240 |
| 98 | 3300028379 | Ga0268266_10078638 | Ga0268266_100786382 | 240 |
| 99 | 3300028786 | Ga0307517_10272545 | Ga0307517_102725451 | 240 |
| 100 | 3300031730 | Ga0307516_10006932 | Ga0307516_1000693213 | 240 |
| 101 | 3300031838 | Ga0307518_10381583 | Ga0307518_103815831 | 240 |
| 102 | 3300032004 | Ga0307414_10033653 | Ga0307414_100336532 | 240 |
| 103 | 3300032005 | Ga0307411_10000039 | Ga0307411_1000003913 | 240 |
| 104 | 3300036401 | Ga0373937_0302455 | Ga0373937_0302455_591_1313 | 240 |
| 105 | 3300041452 | Ga0451793_1183674 | Ga0451793_1183674_21_743 | 240 |
| 106 | 3300041458 | Ga0451798_0182565 | Ga0451798_0182565_604_1326 | 240 |
| 107 | 3300041459 | Ga0451800_1048118 | Ga0451800_1048118_216_938 | 240 |
| 108 | 3300041486 | Ga0451807_0545829 | Ga0451807_0545829_170_892 | 240 |
| 109 | 3300042876 | Ga0451577_0004136 | Ga0451577_0004136_5414_6157 | 240 |
| 110 | 3300042876 | Ga0451577_0056986 | Ga0451577_0056986_1515_2237 | 240 |
| 111 | 3300044712 | Ga0453684_0081004 | Ga0453684_0081004_3080_3823 | 240 |
| 112 | 3300044712 | Ga0453684_0102584 | Ga0453684_0102584_731_1453 | 240 |
| 113 | 3300045051 | Ga0451576_0185013 | Ga0451576_0185013_723_1445 | 240 |
| 114 | 3300045051 | Ga0451576_0328737 | Ga0451576_0328737_159_881 | 240 |
| 115 | 3300046517 | Ga0495630_0114451 | Ga0495630_0114451_1150_1872 | 240 |
| 116 | 3300046524 | Ga0495648_0070545 | Ga0495648_0070545_1116_1838 | 240 |
| 117 | 3300046690 | Ga0495624_0009675 | Ga0495624_0009675_401_1123 | 240 |
| 118 | 3300046692 | Ga0495671_0125560 | Ga0495671_0125560_472_1194 | 240 |
| 119 | 3300047319 | Ga0495674_0241349 | Ga0495674_0241349_702_1424 | 240 |
| 120 | 3300047321 | Ga0495676_0010954 | Ga0495676_0010954_5137_5859 | 240 |
| 121 | 3300048088 | Ga0495602_0172370 | Ga0495602_0172370_367_1089 | 240 |
| 122 | 3300048909 | Ga0496106_0114597 | Ga0496106_0114597_1072_1794 | 240 |
| 123 | 3300050493 | nmdc:mga0k408_19618_c1 | nmdc:mga0k408_19618_c1_169_894 | 240 |
| 124 | 3300050493 | nmdc:mga0k408_85703_c1 | nmdc:mga0k408_85703_c1_462_1184 | 240 |
| 125 | 3300050494 | nmdc:mga06z11_110865_c1 | nmdc:mga06z11_110865_c1_248_973 | 240 |
| 126 | 3300050496 | nmdc:mga07m45_176366_c1 | nmdc:mga07m45_176366_c1_248_973 | 240 |
| 127 | 3300050496 | nmdc:mga07m45_208756_c1 | nmdc:mga07m45_208756_c1_331_1053 | 240 |
| 128 | 3300050496 | nmdc:mga07m45_5468_c1 | nmdc:mga07m45_5468_c1_4148_4870 | 240 |
| 129 | 3300053078 | Ga0495612_0177941 | Ga0495612_0177941_133_855 | 240 |
| 130 | 3300053096 | Ga0500641_0043432 | Ga0500641_0043432_616_1338 | 240 |
| 131 | 3300053730 | Ga0500645_027882 | Ga0500645_027882_154_876 | 240 |
| 132 | 3300005295 | Ga0065707_10049975 | Ga0065707_100499752 | 241 |
| 133 | 3300005366 | Ga0070659_100179555 | Ga0070659_1001795552 | 241 |
| 134 | 3300005458 | Ga0070681_10118114 | Ga0070681_101181142 | 241 |
| 135 | 3300005535 | Ga0070684_100740714 | Ga0070684_1007407141 | 241 |
| 136 | 3300005539 | Ga0068853_100005626 | Ga0068853_1000056263 | 241 |
| 137 | 3300005577 | Ga0068857_100110444 | Ga0068857_1001104443 | 241 |
| 138 | 3300009545 | Ga0105237_10241639 | Ga0105237_102416392 | 241 |
| 139 | 3300009551 | Ga0105238_10246661 | Ga0105238_102466612 | 241 |
| 140 | 3300010375 | Ga0105239_10366887 | Ga0105239_103668872 | 241 |
| 141 | 3300013307 | Ga0157372_10241435 | Ga0157372_102414353 | 241 |
| 142 | 3300014326 | Ga0157380_10061653 | Ga0157380_100616533 | 241 |
| 143 | 3300014326 | Ga0157380_10445550 | Ga0157380_104455501 | 241 |
| 144 | 3300025911 | Ga0207654_10091887 | Ga0207654_100918872 | 241 |
| 145 | 3300025912 | Ga0207707_10195205 | Ga0207707_101952052 | 241 |
| 146 | 3300025914 | Ga0207671_10127247 | Ga0207671_101272472 | 241 |
| 147 | 3300025917 | Ga0207660_10318319 | Ga0207660_103183192 | 241 |
| 148 | 3300025924 | Ga0207694_10537259 | Ga0207694_105372591 | 241 |
| 149 | 3300025938 | Ga0207704_10535206 | Ga0207704_105352061 | 241 |
| 150 | 3300026041 | Ga0207639_10093910 | Ga0207639_100939102 | 241 |
| 151 | 3300026078 | Ga0207702_10278949 | Ga0207702_102789492 | 241 |
| 152 | 3300026116 | Ga0207674_10090058 | Ga0207674_100900581 | 241 |
| 153 | 3300028380 | Ga0268265_10142539 | Ga0268265_101425392 | 241 |
| 154 | 3300031235 | Ga0265330_10005212 | Ga0265330_100052122 | 241 |
| 155 | 3300031238 | Ga0265332_10000255 | Ga0265332_1000025521 | 241 |
| 156 | 3300031239 | Ga0265328_10010589 | Ga0265328_100105893 | 241 |
| 157 | 3300031242 | Ga0265329_10003349 | Ga0265329_100033493 | 241 |
| 158 | 3300031250 | Ga0265331_10000354 | Ga0265331_1000035435 | 241 |
| 159 | 3300031251 | Ga0265327_10028928 | Ga0265327_100289283 | 241 |
| 160 | 3300031344 | Ga0265316_10152207 | Ga0265316_101522072 | 241 |
| 161 | 3300031691 | Ga0316579_10014904 | Ga0316579_100149042 | 241 |
| 162 | 3300031691 | Ga0316579_10269876 | Ga0316579_102698761 | 241 |
| 163 | 3300031711 | Ga0265314_10002694 | Ga0265314_1000269416 | 241 |
| 164 | 3300031712 | Ga0265342_10025498 | Ga0265342_100254984 | 241 |
| 165 | 3300031728 | Ga0316578_10025420 | Ga0316578_100254203 | 241 |
| 166 | 3300031733 | Ga0316577_10149253 | Ga0316577_101492532 | 241 |
| 167 | 3300032133 | Ga0316583_10054956 | Ga0316583_100549561 | 241 |
| 168 | 3300032133 | Ga0316583_10135685 | Ga0316583_101356851 | 241 |
| 169 | 3300032137 | Ga0316585_10026141 | Ga0316585_100261412 | 241 |
| 170 | 3300032168 | Ga0316593_10012065 | Ga0316593_100120652 | 241 |
| 171 | 3300033541 | Ga0316596_1007743 | Ga0316596_10077433 | 241 |
| 172 | 3300035398 | Ga0316574_0050562 | Ga0316574_0050562_1382_2107 | 241 |
| 173 | 3300035398 | Ga0316574_0103129 | Ga0316574_0103129_774_1499 | 241 |
| 174 | 3300036647 | Ga0316582_0077427 | Ga0316582_0077427_1357_2082 | 241 |
| 175 | 3300036712 | Ga0316584_0214441 | Ga0316584_0214441_72_797 | 241 |
| 176 | 3300042876 | Ga0451577_0000168 | Ga0451577_0000168_26131_26895 | 241 |
| 177 | 3300044712 | Ga0453684_0000642 | Ga0453684_0000642_45162_45926 | 241 |
| 178 | 3300044712 | Ga0453684_0078329 | Ga0453684_0078329_321_1085 | 241 |
| 179 | 3300044712 | Ga0453684_0082276 | Ga0453684_0082276_670_1437 | 241 |
| 180 | 3300048907 | Ga0496104_0616238 | Ga0496104_0616238_67_795 | 241 |
| 181 | 3300048908 | Ga0496105_0332438 | Ga0496105_0332438_380_1108 | 241 |
| 182 | 3300048908 | Ga0496105_0534599 | Ga0496105_0534599_44_769 | 241 |
| 183 | 3300053085 | Ga0495619_0017309 | Ga0495619_0017309_330_1055 | 241 |
| 184 | 3300005331 | Ga0070670_100028390 | Ga0070670_1000283904 | 242 |
| 185 | 3300005334 | Ga0068869_100000865 | Ga0068869_10000086517 | 242 |
| 186 | 3300005336 | Ga0070680_100027471 | Ga0070680_1000274716 | 242 |
| 187 | 3300005337 | Ga0070682_100036759 | Ga0070682_1000367593 | 242 |
| 188 | 3300005337 | Ga0070682_100141760 | Ga0070682_1001417602 | 242 |
| 189 | 3300005338 | Ga0068868_100019465 | Ga0068868_1000194653 | 242 |
| 190 | 3300005338 | Ga0068868_100464418 | Ga0068868_1004644182 | 242 |
| 191 | 3300005343 | Ga0070687_100104610 | Ga0070687_1001046102 | 242 |
| 192 | 3300005343 | Ga0070687_100213866 | Ga0070687_1002138662 | 242 |
| 193 | 3300005344 | Ga0070661_100695694 | Ga0070661_1006956941 | 242 |
| 194 | 3300005347 | Ga0070668_100001436 | Ga0070668_10000143610 | 242 |
| 195 | 3300005347 | Ga0070668_100005761 | Ga0070668_1000057614 | 242 |
| 196 | 3300005347 | Ga0070668_100183826 | Ga0070668_1001838262 | 242 |
| 197 | 3300005353 | Ga0070669_100009853 | Ga0070669_1000098537 | 242 |
| 198 | 3300005353 | Ga0070669_100061188 | Ga0070669_1000611883 | 242 |
| 199 | 3300005353 | Ga0070669_100068664 | Ga0070669_1000686643 | 242 |
| 200 | 3300005354 | Ga0070675_100000463 | Ga0070675_10000046313 | 242 |
| 201 | 3300005354 | Ga0070675_100008274 | Ga0070675_1000082749 | 242 |
| 202 | 3300005355 | Ga0070671_100130406 | Ga0070671_1001304062 | 242 |
| 203 | 3300005356 | Ga0070674_100407246 | Ga0070674_1004072462 | 242 |
| 204 | 3300005356 | Ga0070674_100636891 | Ga0070674_1006368911 | 242 |
| 205 | 3300005364 | Ga0070673_100195151 | Ga0070673_1001951512 | 242 |
| 206 | 3300005364 | Ga0070673_100212399 | Ga0070673_1002123992 | 242 |
| 207 | 3300005364 | Ga0070673_100625613 | Ga0070673_1006256131 | 242 |
| 208 | 3300005365 | Ga0070688_100041715 | Ga0070688_1000417152 | 242 |
| 209 | 3300005366 | Ga0070659_100688934 | Ga0070659_1006889341 | 242 |
| 210 | 3300005367 | Ga0070667_100013445 | Ga0070667_1000134457 | 242 |
| 211 | 3300005367 | Ga0070667_100017690 | Ga0070667_1000176905 | 242 |
| 212 | 3300005367 | Ga0070667_100040533 | Ga0070667_1000405337 | 242 |
| 213 | 3300005436 | Ga0070713_100000020 | Ga0070713_1000000207 | 242 |
| 214 | 3300005436 | Ga0070713_100381694 | Ga0070713_1003816942 | 242 |
| 215 | 3300005439 | Ga0070711_100240581 | Ga0070711_1002405811 | 242 |
| 216 | 3300005441 | Ga0070700_100040098 | Ga0070700_1000400983 | 242 |
| 217 | 3300005441 | Ga0070700_100076953 | Ga0070700_1000769532 | 242 |
| 218 | 3300005441 | Ga0070700_100179573 | Ga0070700_1001795732 | 242 |
| 219 | 3300005455 | Ga0070663_100304410 | Ga0070663_1003044103 | 242 |
| 220 | 3300005456 | Ga0070678_100000409 | Ga0070678_10000040912 | 242 |
| 221 | 3300005456 | Ga0070678_100103717 | Ga0070678_1001037172 | 242 |
| 222 | 3300005456 | Ga0070678_100217398 | Ga0070678_1002173982 | 242 |
| 223 | 3300005457 | Ga0070662_100326084 | Ga0070662_1003260842 | 242 |
| 224 | 3300005459 | Ga0068867_100079353 | Ga0068867_1000793533 | 242 |
| 225 | 3300005459 | Ga0068867_100290235 | Ga0068867_1002902352 | 242 |
| 226 | 3300005468 | Ga0070707_100077286 | Ga0070707_1000772863 | 242 |
| 227 | 3300005471 | Ga0070698_100071307 | Ga0070698_1000713071 | 242 |
| 228 | 3300005535 | Ga0070684_100702359 | Ga0070684_1007023591 | 242 |
| 229 | 3300005539 | Ga0068853_100000300 | Ga0068853_10000030026 | 242 |
| 230 | 3300005539 | Ga0068853_100021946 | Ga0068853_1000219462 | 242 |
| 231 | 3300005543 | Ga0070672_100029609 | Ga0070672_1000296092 | 242 |
| 232 | 3300005543 | Ga0070672_100089043 | Ga0070672_1000890433 | 242 |
| 233 | 3300005543 | Ga0070672_100129261 | Ga0070672_1001292612 | 242 |
| 234 | 3300005543 | Ga0070672_100152446 | Ga0070672_1001524462 | 242 |
| 235 | 3300005544 | Ga0070686_100057560 | Ga0070686_1000575602 | 242 |
| 236 | 3300005548 | Ga0070665_100025134 | Ga0070665_1000251347 | 242 |
| 237 | 3300005548 | Ga0070665_100382044 | Ga0070665_1003820442 | 242 |
| 238 | 3300005548 | Ga0070665_100383054 | Ga0070665_1003830541 | 242 |
| 239 | 3300005548 | Ga0070665_100395323 | Ga0070665_1003953232 | 242 |
| 240 | 3300005549 | Ga0070704_100097565 | Ga0070704_1000975654 | 242 |
| 241 | 3300005563 | Ga0068855_100276821 | Ga0068855_1002768211 | 242 |
| 242 | 3300005564 | Ga0070664_100224438 | Ga0070664_1002244382 | 242 |
| 243 | 3300005577 | Ga0068857_100008978 | Ga0068857_1000089788 | 242 |
| 244 | 3300005614 | Ga0068856_100122077 | Ga0068856_1001220773 | 242 |
| 245 | 3300005615 | Ga0070702_100084926 | Ga0070702_1000849262 | 242 |
| 246 | 3300005616 | Ga0068852_100019333 | Ga0068852_1000193335 | 242 |
| 247 | 3300005616 | Ga0068852_100270969 | Ga0068852_1002709691 | 242 |
| 248 | 3300005616 | Ga0068852_100695960 | Ga0068852_1006959602 | 242 |
| 249 | 3300005617 | Ga0068859_100001747 | Ga0068859_10000174721 | 242 |
| 250 | 3300005618 | Ga0068864_100009680 | Ga0068864_1000096805 | 242 |
| 251 | 3300005618 | Ga0068864_100014755 | Ga0068864_1000147555 | 242 |
| 252 | 3300005618 | Ga0068864_100156525 | Ga0068864_1001565252 | 242 |
| 253 | 3300005718 | Ga0068866_10153168 | Ga0068866_101531682 | 242 |
| 254 | 3300005718 | Ga0068866_10246877 | Ga0068866_102468772 | 242 |
| 255 | 3300005719 | Ga0068861_100000564 | Ga0068861_1000005644 | 242 |
| 256 | 3300005719 | Ga0068861_100029241 | Ga0068861_1000292415 | 242 |
| 257 | 3300005719 | Ga0068861_100086200 | Ga0068861_1000862004 | 242 |
| 258 | 3300005719 | Ga0068861_100123958 | Ga0068861_1001239585 | 242 |
| 259 | 3300005834 | Ga0068851_10099000 | Ga0068851_100990002 | 242 |
| 260 | 3300005840 | Ga0068870_10127155 | Ga0068870_101271551 | 242 |
| 261 | 3300005841 | Ga0068863_100004874 | Ga0068863_10000487413 | 242 |
| 262 | 3300005841 | Ga0068863_100045403 | Ga0068863_1000454032 | 242 |
| 263 | 3300005841 | Ga0068863_100061670 | Ga0068863_1000616702 | 242 |
| 264 | 3300005841 | Ga0068863_100127749 | Ga0068863_1001277493 | 242 |
| 265 | 3300005841 | Ga0068863_100305860 | Ga0068863_1003058601 | 242 |
| 266 | 3300005842 | Ga0068858_100011382 | Ga0068858_1000113825 | 242 |
| 267 | 3300005842 | Ga0068858_100021251 | Ga0068858_1000212514 | 242 |
| 268 | 3300005842 | Ga0068858_100111244 | Ga0068858_1001112442 | 242 |
| 269 | 3300005842 | Ga0068858_100284925 | Ga0068858_1002849252 | 242 |
| 270 | 3300005842 | Ga0068858_100750236 | Ga0068858_1007502361 | 242 |
| 271 | 3300005843 | Ga0068860_100115312 | Ga0068860_1001153122 | 242 |
| 272 | 3300005843 | Ga0068860_100147446 | Ga0068860_1001474462 | 242 |
| 273 | 3300005843 | Ga0068860_100158482 | Ga0068860_1001584822 | 242 |
| 274 | 3300005844 | Ga0068862_100031354 | Ga0068862_1000313542 | 242 |
| 275 | 3300005844 | Ga0068862_100144529 | Ga0068862_1001445292 | 242 |
| 276 | 3300005844 | Ga0068862_100145317 | Ga0068862_1001453173 | 242 |
| 277 | 3300006028 | Ga0070717_10029680 | Ga0070717_100296803 | 242 |
| 278 | 3300006051 | Ga0075364_10181337 | Ga0075364_101813372 | 242 |
| 279 | 3300006186 | Ga0075369_10000833 | Ga0075369_100008333 | 242 |
| 280 | 3300006186 | Ga0075369_10038299 | Ga0075369_100382992 | 242 |
| 281 | 3300006195 | Ga0075366_10073931 | Ga0075366_100739313 | 242 |
| 282 | 3300006237 | Ga0097621_100231089 | Ga0097621_1002310892 | 242 |
| 283 | 3300006358 | Ga0068871_100004702 | Ga0068871_1000047026 | 242 |
| 284 | 3300006358 | Ga0068871_100032120 | Ga0068871_1000321202 | 242 |
| 285 | 3300006881 | Ga0068865_100535886 | Ga0068865_1005358861 | 242 |
| 286 | 3300006931 | Ga0097620_100001747 | Ga0097620_1000017474 | 242 |
| 287 | 3300009093 | Ga0105240_10080523 | Ga0105240_100805232 | 242 |
| 288 | 3300009094 | Ga0111539_10017990 | Ga0111539_100179904 | 242 |
| 289 | 3300009101 | Ga0105247_10107572 | Ga0105247_101075722 | 242 |
| 290 | 3300009148 | Ga0105243_10791060 | Ga0105243_107910601 | 242 |
| 291 | 3300009177 | Ga0105248_10111238 | Ga0105248_101112383 | 242 |
| 292 | 3300009177 | Ga0105248_10316026 | Ga0105248_103160261 | 242 |
| 293 | 3300009177 | Ga0105248_10387261 | Ga0105248_103872612 | 242 |
| 294 | 3300009545 | Ga0105237_10264731 | Ga0105237_102647312 | 242 |
| 295 | 3300009553 | Ga0105249_10108176 | Ga0105249_101081762 | 242 |
| 296 | 3300009553 | Ga0105249_10192611 | Ga0105249_101926114 | 242 |
| 297 | 3300009553 | Ga0105249_10277108 | Ga0105249_102771082 | 242 |
| 298 | 3300009553 | Ga0105249_10443358 | Ga0105249_104433582 | 242 |
| 299 | 3300009553 | Ga0105249_10793917 | Ga0105249_107939172 | 242 |
| 300 | 3300013296 | Ga0157374_10063917 | Ga0157374_100639174 | 242 |
| 301 | 3300013296 | Ga0157374_10102567 | Ga0157374_101025672 | 242 |
| 302 | 3300013297 | Ga0157378_10016847 | Ga0157378_100168472 | 242 |
| 303 | 3300013306 | Ga0163162_10014935 | Ga0163162_100149354 | 242 |
| 304 | 3300013306 | Ga0163162_10219098 | Ga0163162_102190985 | 242 |
| 305 | 3300013308 | Ga0157375_10004106 | Ga0157375_1000410616 | 242 |
| 306 | 3300013308 | Ga0157375_10011287 | Ga0157375_100112872 | 242 |
| 307 | 3300013308 | Ga0157375_10105221 | Ga0157375_101052214 | 242 |
| 308 | 3300013308 | Ga0157375_10138475 | Ga0157375_101384753 | 242 |
| 309 | 3300013308 | Ga0157375_10152956 | Ga0157375_101529562 | 242 |
| 310 | 3300013308 | Ga0157375_10180916 | Ga0157375_101809162 | 242 |
| 311 | 3300013308 | Ga0157375_11416751 | Ga0157375_114167511 | 242 |
| 312 | 3300014968 | Ga0157379_10002624 | Ga0157379_100026246 | 242 |
| 313 | 3300014968 | Ga0157379_10942414 | Ga0157379_109424141 | 242 |
| 314 | 3300014969 | Ga0157376_10038509 | Ga0157376_100385095 | 242 |
| 315 | 3300014969 | Ga0157376_10069703 | Ga0157376_100697036 | 242 |
| 316 | 3300014969 | Ga0157376_10289135 | Ga0157376_102891352 | 242 |
| 317 | 3300014969 | Ga0157376_10365782 | Ga0157376_103657822 | 242 |
| 318 | 3300014969 | Ga0157376_10658637 | Ga0157376_106586372 | 242 |
| 319 | 3300017792 | Ga0163161_10049193 | Ga0163161_100491937 | 242 |
| 320 | 3300017792 | Ga0163161_10117090 | Ga0163161_101170903 | 242 |
| 321 | 3300017792 | Ga0163161_10126069 | Ga0163161_101260692 | 242 |
| 322 | 3300017792 | Ga0163161_10244336 | Ga0163161_102443362 | 242 |
| 323 | 3300017792 | Ga0163161_10817916 | Ga0163161_108179161 | 242 |
| 324 | 3300025315 | Ga0207697_10014167 | Ga0207697_100141672 | 242 |
| 325 | 3300025907 | Ga0207645_10086099 | Ga0207645_100860993 | 242 |
| 326 | 3300025907 | Ga0207645_10178523 | Ga0207645_101785232 | 242 |
| 327 | 3300025910 | Ga0207684_10155772 | Ga0207684_101557722 | 242 |
| 328 | 3300025917 | Ga0207660_10042148 | Ga0207660_100421484 | 242 |
| 329 | 3300025918 | Ga0207662_10142365 | Ga0207662_101423653 | 242 |
| 330 | 3300025922 | Ga0207646_10333505 | Ga0207646_103335052 | 242 |
| 331 | 3300025923 | Ga0207681_10011126 | Ga0207681_100111262 | 242 |
| 332 | 3300025923 | Ga0207681_10014702 | Ga0207681_100147026 | 242 |
| 333 | 3300025924 | Ga0207694_10014747 | Ga0207694_100147477 | 242 |
| 334 | 3300025925 | Ga0207650_10016788 | Ga0207650_100167883 | 242 |
| 335 | 3300025925 | Ga0207650_10017344 | Ga0207650_100173445 | 242 |
| 336 | 3300025925 | Ga0207650_10023927 | Ga0207650_100239273 | 242 |
| 337 | 3300025925 | Ga0207650_10095306 | Ga0207650_100953062 | 242 |
| 338 | 3300025926 | Ga0207659_10010777 | Ga0207659_100107773 | 242 |
| 339 | 3300025926 | Ga0207659_10069050 | Ga0207659_100690503 | 242 |
| 340 | 3300025928 | Ga0207700_10000086 | Ga0207700_100000867 | 242 |
| 341 | 3300025928 | Ga0207700_10304540 | Ga0207700_103045402 | 242 |
| 342 | 3300025931 | Ga0207644_10165021 | Ga0207644_101650212 | 242 |
| 343 | 3300025933 | Ga0207706_10023984 | Ga0207706_100239845 | 242 |
| 344 | 3300025933 | Ga0207706_10136364 | Ga0207706_101363642 | 242 |
| 345 | 3300025934 | Ga0207686_10580369 | Ga0207686_105803692 | 242 |
| 346 | 3300025935 | Ga0207709_10025299 | Ga0207709_100252992 | 242 |
| 347 | 3300025936 | Ga0207670_10010745 | Ga0207670_100107453 | 242 |
| 348 | 3300025937 | Ga0207669_10003485 | Ga0207669_100034859 | 242 |
| 349 | 3300025937 | Ga0207669_10415108 | Ga0207669_104151081 | 242 |
| 350 | 3300025938 | Ga0207704_10242419 | Ga0207704_102424192 | 242 |
| 351 | 3300025940 | Ga0207691_10000509 | Ga0207691_1000050926 | 242 |
| 352 | 3300025940 | Ga0207691_10003508 | Ga0207691_100035086 | 242 |
| 353 | 3300025940 | Ga0207691_10033514 | Ga0207691_100335145 | 242 |
| 354 | 3300025940 | Ga0207691_10139309 | Ga0207691_101393092 | 242 |
| 355 | 3300025941 | Ga0207711_10081316 | Ga0207711_100813162 | 242 |
| 356 | 3300025942 | Ga0207689_10000174 | Ga0207689_1000017450 | 242 |
| 357 | 3300025942 | Ga0207689_10004337 | Ga0207689_100043376 | 242 |
| 358 | 3300025942 | Ga0207689_10421192 | Ga0207689_104211921 | 242 |
| 359 | 3300025944 | Ga0207661_10068898 | Ga0207661_100688982 | 242 |
| 360 | 3300025945 | Ga0207679_10206178 | Ga0207679_102061783 | 242 |
| 361 | 3300025960 | Ga0207651_10282497 | Ga0207651_102824972 | 242 |
| 362 | 3300025961 | Ga0207712_10313407 | Ga0207712_103134072 | 242 |
| 363 | 3300025972 | Ga0207668_10002470 | Ga0207668_100024707 | 242 |
| 364 | 3300025972 | Ga0207668_10016568 | Ga0207668_100165682 | 242 |
| 365 | 3300025972 | Ga0207668_10029303 | Ga0207668_100293033 | 242 |
| 366 | 3300025972 | Ga0207668_10100816 | Ga0207668_101008163 | 242 |
| 367 | 3300025986 | Ga0207658_10008875 | Ga0207658_100088756 | 242 |
| 368 | 3300025986 | Ga0207658_10034666 | Ga0207658_100346664 | 242 |
| 369 | 3300025986 | Ga0207658_10051891 | Ga0207658_100518912 | 242 |
| 370 | 3300025986 | Ga0207658_10082139 | Ga0207658_100821393 | 242 |
| 371 | 3300025986 | Ga0207658_10339222 | Ga0207658_103392222 | 242 |
| 372 | 3300026035 | Ga0207703_10193637 | Ga0207703_101936373 | 242 |
| 373 | 3300026035 | Ga0207703_10644804 | Ga0207703_106448041 | 242 |
| 374 | 3300026041 | Ga0207639_10000508 | Ga0207639_1000050818 | 242 |
| 375 | 3300026041 | Ga0207639_10090056 | Ga0207639_100900562 | 242 |
| 376 | 3300026067 | Ga0207678_10006420 | Ga0207678_100064208 | 242 |
| 377 | 3300026075 | Ga0207708_10006963 | Ga0207708_100069635 | 242 |
| 378 | 3300026075 | Ga0207708_10080620 | Ga0207708_100806202 | 242 |
| 379 | 3300026075 | Ga0207708_10202874 | Ga0207708_102028742 | 242 |
| 380 | 3300026088 | Ga0207641_10014012 | Ga0207641_100140126 | 242 |
| 381 | 3300026088 | Ga0207641_10027403 | Ga0207641_100274032 | 242 |
| 382 | 3300026088 | Ga0207641_10057332 | Ga0207641_100573322 | 242 |
| 383 | 3300026088 | Ga0207641_10165395 | Ga0207641_101653951 | 242 |
| 384 | 3300026089 | Ga0207648_10001922 | Ga0207648_1000192218 | 242 |
| 385 | 3300026089 | Ga0207648_10189296 | Ga0207648_101892963 | 242 |
| 386 | 3300026089 | Ga0207648_10220267 | Ga0207648_102202672 | 242 |
| 387 | 3300026089 | Ga0207648_10334797 | Ga0207648_103347972 | 242 |
| 388 | 3300026095 | Ga0207676_10010076 | Ga0207676_100100767 | 242 |
| 389 | 3300026095 | Ga0207676_10013354 | Ga0207676_100133544 | 242 |
| 390 | 3300026095 | Ga0207676_10034639 | Ga0207676_100346393 | 242 |
| 391 | 3300026116 | Ga0207674_10041103 | Ga0207674_100411035 | 242 |
| 392 | 3300026116 | Ga0207674_10581134 | Ga0207674_105811342 | 242 |
| 393 | 3300026118 | Ga0207675_100000847 | Ga0207675_10000084728 | 242 |
| 394 | 3300026118 | Ga0207675_100021000 | Ga0207675_1000210003 | 242 |
| 395 | 3300026118 | Ga0207675_100033377 | Ga0207675_1000333775 | 242 |
| 396 | 3300026118 | Ga0207675_100058168 | Ga0207675_1000581683 | 242 |
| 397 | 3300026121 | Ga0207683_10000020 | Ga0207683_1000002072 | 242 |
| 398 | 3300026121 | Ga0207683_10029090 | Ga0207683_100290903 | 242 |
| 399 | 3300026121 | Ga0207683_10137516 | Ga0207683_101375163 | 242 |
| 400 | 3300026142 | Ga0207698_10007168 | Ga0207698_100071684 | 242 |
| 401 | 3300027907 | Ga0207428_10371703 | Ga0207428_103717032 | 242 |
| 402 | 3300028379 | Ga0268266_10063383 | Ga0268266_100633838 | 242 |
| 403 | 3300028379 | Ga0268266_10173632 | Ga0268266_101736322 | 242 |
| 404 | 3300028379 | Ga0268266_10335395 | Ga0268266_103353952 | 242 |
| 405 | 3300028379 | Ga0268266_10388485 | Ga0268266_103884852 | 242 |
| 406 | 3300028380 | Ga0268265_10028173 | Ga0268265_100281733 | 242 |
| 407 | 3300028380 | Ga0268265_10030373 | Ga0268265_100303733 | 242 |
| 408 | 3300028380 | Ga0268265_10134089 | Ga0268265_101340891 | 242 |
| 409 | 3300028380 | Ga0268265_10631954 | Ga0268265_106319541 | 242 |
| 410 | 3300028381 | Ga0268264_10002310 | Ga0268264_100023105 | 242 |
| 411 | 3300028381 | Ga0268264_10152755 | Ga0268264_101527552 | 242 |
| 412 | 3300028381 | Ga0268264_10254749 | Ga0268264_102547492 | 242 |
| 413 | 3300028381 | Ga0268264_10338371 | Ga0268264_103383712 | 242 |
| 414 | 3300028381 | Ga0268264_10388798 | Ga0268264_103887981 | 242 |
| 415 | 3300028563 | Ga0265319_1047676 | Ga0265319_10476762 | 242 |
| 416 | 3300028577 | Ga0265318_10000108 | Ga0265318_1000010871 | 242 |
| 417 | 3300028577 | Ga0265318_10000878 | Ga0265318_1000087812 | 242 |
| 418 | 3300028666 | Ga0265336_10002346 | Ga0265336_100023464 | 242 |
| 419 | 3300028800 | Ga0265338_10192985 | Ga0265338_101929852 | 242 |
| 420 | 3300031235 | Ga0265330_10000201 | Ga0265330_1000020138 | 242 |
| 421 | 3300031235 | Ga0265330_10002606 | Ga0265330_100026066 | 242 |
| 422 | 3300031238 | Ga0265332_10000447 | Ga0265332_100004475 | 242 |
| 423 | 3300031238 | Ga0265332_10002933 | Ga0265332_100029335 | 242 |
| 424 | 3300031239 | Ga0265328_10000254 | Ga0265328_100002545 | 242 |
| 425 | 3300031239 | Ga0265328_10001319 | Ga0265328_100013195 | 242 |
| 426 | 3300031240 | Ga0265320_10000085 | Ga0265320_100000855 | 242 |
| 427 | 3300031240 | Ga0265320_10002076 | Ga0265320_100020764 | 242 |
| 428 | 3300031240 | Ga0265320_10011178 | Ga0265320_100111782 | 242 |
| 429 | 3300031240 | Ga0265320_10061572 | Ga0265320_100615722 | 242 |
| 430 | 3300031241 | Ga0265325_10031821 | Ga0265325_100318212 | 242 |
| 431 | 3300031242 | Ga0265329_10005103 | Ga0265329_100051034 | 242 |
| 432 | 3300031249 | Ga0265339_10008026 | Ga0265339_100080262 | 242 |
| 433 | 3300031249 | Ga0265339_10084862 | Ga0265339_100848622 | 242 |
| 434 | 3300031250 | Ga0265331_10000179 | Ga0265331_100001795 | 242 |
| 435 | 3300031250 | Ga0265331_10000762 | Ga0265331_1000076215 | 242 |
| 436 | 3300031344 | Ga0265316_10003342 | Ga0265316_1000334213 | 242 |
| 437 | 3300031344 | Ga0265316_10003383 | Ga0265316_100033832 | 242 |
| 438 | 3300031595 | Ga0265313_10000103 | Ga0265313_100001036 | 242 |
| 439 | 3300031595 | Ga0265313_10017259 | Ga0265313_100172593 | 242 |
| 440 | 3300031595 | Ga0265313_10018126 | Ga0265313_100181265 | 242 |
| 441 | 3300031711 | Ga0265314_10000235 | Ga0265314_100002355 | 242 |
| 442 | 3300031711 | Ga0265314_10017420 | Ga0265314_100174204 | 242 |
| 443 | 3300031712 | Ga0265342_10000463 | Ga0265342_1000046311 | 242 |
| 444 | 3300031712 | Ga0265342_10003566 | Ga0265342_100035667 | 242 |
| 445 | 3300031712 | Ga0265342_10009235 | Ga0265342_100092352 | 242 |
| 446 | 3300031712 | Ga0265342_10086579 | Ga0265342_100865791 | 242 |
| 447 | 3300035116 | Ga0373945_0154736 | Ga0373945_0154736_97_873 | 242 |
| 448 | 3300035119 | Ga0373956_0191930 | Ga0373956_0191930_44_796 | 242 |
| 449 | 3300035170 | Ga0373943_0262802 | Ga0373943_0262802_223_957 | 242 |
| 450 | 3300035691 | Ga0373931_0186196 | Ga0373931_0186196_298_1026 | 242 |
| 451 | 3300035691 | Ga0373931_0189163 | Ga0373931_0189163_84_812 | 242 |
| 452 | 3300035692 | Ga0373935_0024014 | Ga0373935_0024014_580_1356 | 242 |
| 453 | 3300035695 | Ga0373927_0013717 | Ga0373927_0013717_2075_2851 | 242 |
| 454 | 3300035724 | Ga0373933_0326290 | Ga0373933_0326290_30_758 | 242 |
| 455 | 3300035725 | Ga0373947_0011346 | Ga0373947_0011346_2881_3657 | 242 |
| 456 | 3300036401 | Ga0373937_0395001 | Ga0373937_0395001_328_1056 | 242 |
| 457 | 3300037068 | Ga0373925_0023031 | Ga0373925_0023031_2426_3202 | 242 |
| 458 | 3300041451 | Ga0451791_1069114 | Ga0451791_1069114_126_854 | 242 |
| 459 | 3300041509 | Ga0451843_1081050 | Ga0451843_1081050_16_744 | 242 |
| 460 | 3300046472 | Ga0495580_0123890 | Ga0495580_0123890_749_1477 | 242 |
| 461 | 3300046683 | Ga0495658_0178633 | Ga0495658_0178633_21_749 | 242 |
| 462 | 3300046683 | Ga0495658_0246490 | Ga0495658_0246490_87_815 | 242 |
| 463 | 3300048910 | Ga0496107_0501879 | Ga0496107_0501879_105_839 | 242 |
| 464 | 3300048911 | Ga0496108_0279919 | Ga0496108_0279919_359_1087 | 242 |
| 465 | 3300048912 | Ga0496109_0573604 | Ga0496109_0573604_289_1017 | 242 |
| 466 | 3300049585 | Ga0501069_0153713 | Ga0501069_0153713_13_747 | 242 |
| 467 | 3300049744 | Ga0501083_0002000 | Ga0501083_0002000_512_1246 | 242 |
| 468 | 3300050491 | nmdc:mga00v17_239889_c1 | nmdc:mga00v17_239889_c1_110_862 | 242 |
| 469 | 3300050493 | nmdc:mga0k408_50155_c1 | nmdc:mga0k408_50155_c1_1560_2312 | 242 |
| 470 | 3300050509 | nmdc:mga0qj67_361777_c1 | nmdc:mga0qj67_361777_c1_28_804 | 242 |
| 471 | 3300050511 | nmdc:mga08y16_61528_c1 | nmdc:mga08y16_61528_c1_917_1645 | 242 |
| 472 | 3300053096 | Ga0500641_0014674 | Ga0500641_0014674_373_1101 | 242 |
| 473 | 3300053146 | Ga0500588_0119327 | Ga0500588_0119327_146_874 | 242 |
| 474 | 3300060353 | Ga0501082_0042165 | Ga0501082_0042165_2240_2974 | 242 |
| 475 | 3300005340 | Ga0070689_100127231 | Ga0070689_1001272313 | 246 |
| 476 | 3300009094 | Ga0111539_10176415 | Ga0111539_101764152 | 246 |
| 477 | 3300050511 | nmdc:mga08y16_210431_c1 | nmdc:mga08y16_210431_c1_119_1003 | 246 |
| 478 | 3300042008 | Ga0439450_023743 | Ga0439450_023743_224_1021 | 247 |
| 479 | 3300048916 | Ga0496113_0023631 | Ga0496113_0023631_3231_3974 | 247 |
| 480 | 3300048926 | Ga0496123_0063787 | Ga0496123_0063787_1586_2329 | 247 |
| 481 | 3300048929 | Ga0496126_0017258 | Ga0496126_0017258_3110_3853 | 247 |
| 482 | 3300003792 | Ga0055540_1000231 | Ga0055540_100023132 | 248 |
| 483 | 3300005333 | Ga0070677_10000382 | Ga0070677_1000038217 | 248 |
| 484 | 3300005335 | Ga0070666_10000758 | Ga0070666_100007589 | 248 |
| 485 | 3300005335 | Ga0070666_10058312 | Ga0070666_100583124 | 248 |
| 486 | 3300005338 | Ga0068868_100013034 | Ga0068868_1000130346 | 248 |
| 487 | 3300005347 | Ga0070668_100003834 | Ga0070668_1000038347 | 248 |
| 488 | 3300005354 | Ga0070675_100001023 | Ga0070675_10000102326 | 248 |
| 489 | 3300005355 | Ga0070671_100010891 | Ga0070671_1000108915 | 248 |
| 490 | 3300005356 | Ga0070674_100000094 | Ga0070674_10000009443 | 248 |
| 491 | 3300005356 | Ga0070674_100008211 | Ga0070674_1000082114 | 248 |
| 492 | 3300005364 | Ga0070673_100000753 | Ga0070673_10000075313 | 248 |
| 493 | 3300005367 | Ga0070667_100001746 | Ga0070667_10000174621 | 248 |
| 494 | 3300005367 | Ga0070667_100006402 | Ga0070667_1000064024 | 248 |
| 495 | 3300005367 | Ga0070667_100044461 | Ga0070667_1000444614 | 248 |
| 496 | 3300005459 | Ga0068867_100008769 | Ga0068867_1000087693 | 248 |
| 497 | 3300005466 | Ga0070685_10050616 | Ga0070685_100506162 | 248 |
| 498 | 3300005539 | Ga0068853_100005616 | Ga0068853_1000056162 | 248 |
| 499 | 3300005543 | Ga0070672_100000552 | Ga0070672_10000055210 | 248 |
| 500 | 3300005543 | Ga0070672_100166921 | Ga0070672_1001669212 | 248 |
| 501 | 3300005548 | Ga0070665_100002419 | Ga0070665_10000241921 | 248 |
| 502 | 3300005548 | Ga0070665_100020178 | Ga0070665_1000201786 | 248 |
| 503 | 3300005834 | Ga0068851_10000941 | Ga0068851_1000094117 | 248 |
| 504 | 3300005840 | Ga0068870_10042210 | Ga0068870_100422103 | 248 |
| 505 | 3300005841 | Ga0068863_100022879 | Ga0068863_1000228798 | 248 |
| 506 | 3300005842 | Ga0068858_100058894 | Ga0068858_1000588943 | 248 |
| 507 | 3300005843 | Ga0068860_100025029 | Ga0068860_1000250299 | 248 |
| 508 | 3300006237 | Ga0097621_100018068 | Ga0097621_1000180684 | 248 |
| 509 | 3300009101 | Ga0105247_10160628 | Ga0105247_101606282 | 248 |
| 510 | 3300013296 | Ga0157374_10284991 | Ga0157374_102849912 | 248 |
| 511 | 3300013297 | Ga0157378_10275785 | Ga0157378_102757852 | 248 |
| 512 | 3300013306 | Ga0163162_10216437 | Ga0163162_102164373 | 248 |
| 513 | 3300025303 | Ga0209051_1000048 | Ga0209051_1000048205 | 248 |
| 514 | 3300025321 | Ga0207656_10003408 | Ga0207656_100034086 | 248 |
| 515 | 3300025893 | Ga0207682_10002512 | Ga0207682_100025128 | 248 |
| 516 | 3300025899 | Ga0207642_10095909 | Ga0207642_100959091 | 248 |
| 517 | 3300025903 | Ga0207680_10041527 | Ga0207680_100415274 | 248 |
| 518 | 3300025907 | Ga0207645_10004706 | Ga0207645_1000470610 | 248 |
| 519 | 3300025907 | Ga0207645_10262855 | Ga0207645_102628552 | 248 |
| 520 | 3300025908 | Ga0207643_10041542 | Ga0207643_100415423 | 248 |
| 521 | 3300025926 | Ga0207659_10016864 | Ga0207659_100168646 | 248 |
| 522 | 3300025931 | Ga0207644_10001344 | Ga0207644_100013449 | 248 |
| 523 | 3300025931 | Ga0207644_10163159 | Ga0207644_101631591 | 248 |
| 524 | 3300025937 | Ga0207669_10008259 | Ga0207669_100082595 | 248 |
| 525 | 3300025940 | Ga0207691_10000018 | Ga0207691_10000018128 | 248 |
| 526 | 3300025941 | Ga0207711_10073235 | Ga0207711_100732354 | 248 |
| 527 | 3300025960 | Ga0207651_10002176 | Ga0207651_100021768 | 248 |
| 528 | 3300025972 | Ga0207668_10002010 | Ga0207668_100020106 | 248 |
| 529 | 3300025986 | Ga0207658_10013016 | Ga0207658_100130167 | 248 |
| 530 | 3300025986 | Ga0207658_10016070 | Ga0207658_100160704 | 248 |
| 531 | 3300026023 | Ga0207677_10003221 | Ga0207677_100032216 | 248 |
| 532 | 3300026041 | Ga0207639_10009051 | Ga0207639_100090519 | 248 |
| 533 | 3300026089 | Ga0207648_10015731 | Ga0207648_100157317 | 248 |
| 534 | 3300026121 | Ga0207683_10002464 | Ga0207683_100024649 | 248 |
| 535 | 3300028379 | Ga0268266_10013368 | Ga0268266_100133687 | 248 |
| 536 | 3300028381 | Ga0268264_10229254 | Ga0268264_102292543 | 248 |
| 537 | 3300028800 | Ga0265338_10004756 | Ga0265338_1000475615 | 248 |
| 538 | 3300031239 | Ga0265328_10002130 | Ga0265328_100021306 | 248 |
| 539 | 3300031240 | Ga0265320_10001256 | Ga0265320_1000125615 | 248 |
| 540 | 3300031249 | Ga0265339_10003541 | Ga0265339_100035419 | 248 |
| 541 | 3300031711 | Ga0265314_10031242 | Ga0265314_100312423 | 248 |
| 542 | 3300031712 | Ga0265342_10001967 | Ga0265342_100019673 | 248 |
| 543 | 3300042005 | Ga0439448_0008586 | Ga0439448_0008586_688_1434 | 248 |
| 544 | 3300048903 | Ga0496100_0000133 | Ga0496100_0000133_11486_12232 | 248 |
| 545 | 3300048904 | Ga0496101_0000661 | Ga0496101_0000661_11283_12029 | 248 |
| 546 | 3300048905 | Ga0496102_0205966 | Ga0496102_0205966_496_1242 | 248 |
| 547 | 3300048906 | Ga0496103_0012076 | Ga0496103_0012076_918_1664 | 248 |
| 548 | 3300048909 | Ga0496106_0000992 | Ga0496106_0000992_8790_9536 | 248 |
| 549 | 3300048912 | Ga0496109_0000529 | Ga0496109_0000529_20340_21086 | 248 |
| 550 | 3300048913 | Ga0496110_0013633 | Ga0496110_0013633_384_1130 | 248 |
| 551 | 3300048913 | Ga0496110_0141582 | Ga0496110_0141582_647_1393 | 248 |
| 552 | 3300048914 | Ga0496111_0006650 | Ga0496111_0006650_4361_5107 | 248 |
| 553 | 3300048917 | Ga0496114_0001244 | Ga0496114_0001244_12964_13710 | 248 |
| 554 | 3300048919 | Ga0496116_0031538 | Ga0496116_0031538_2663_3409 | 248 |
| 555 | 3300048920 | Ga0496117_0000752 | Ga0496117_0000752_50155_50901 | 248 |
| 556 | 3300048921 | Ga0496118_0038785 | Ga0496118_0038785_520_1266 | 248 |
| 557 | 3300048922 | Ga0496119_0014870 | Ga0496119_0014870_448_1194 | 248 |
| 558 | 3300048924 | Ga0496121_0000027 | Ga0496121_0000027_11288_12034 | 248 |
| 559 | 3300048925 | Ga0496122_0000611 | Ga0496122_0000611_11288_12034 | 248 |
| 560 | 3300048926 | Ga0496123_0003205 | Ga0496123_0003205_9266_10012 | 248 |
| 561 | 3300048927 | Ga0496124_0000016 | Ga0496124_0000016_11288_12034 | 248 |
| 562 | 3300048928 | Ga0496125_0000008 | Ga0496125_0000008_11288_12034 | 248 |
| 563 | 3300048929 | Ga0496126_0000025 | Ga0496126_0000025_11288_12034 | 248 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5loy-assembly2.cif.gz_D | helical assembly of a designed anbu protein | 0.9732 | 9 | 248 |
| 5nyw-assembly2.cif.gz_1 | anbu (ancestral beta-subunit) from yersinia bercovieri | 0.9725 | 9 | 247 |
| 5nyw-assembly2.cif.gz_O | anbu (ancestral beta-subunit) from yersinia bercovieri | 0.9707 | 9 | 247 |
| 5nyw-assembly2.cif.gz_W | anbu (ancestral beta-subunit) from yersinia bercovieri | 0.9699 | 9 | 248 |
| 5nyw-assembly1.cif.gz_M | anbu (ancestral beta-subunit) from yersinia bercovieri | 0.9697 | 9 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8T915_50_270_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.8297 | 9 | 219 | 3.60.20.10 |
| af_A4HV47_25_244_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.8244 | 8 | 217 | 3.60.20.10 |
| 6qm8X00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.8233 | 4 | 219 | 3.60.20.10 |
| 5lexN00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.8137 | 9 | 223 | 3.60.20.10 |
| af_Q966I8_19_219_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.8111 | 6 | 219 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356VN81-F1-model_v4 | deleted | 0.9861 | 120 | 199 |
|
| AF-A0A352KM52-F1-model_v4 | Peptidase | 0.9811 | 122 | 248 |
|
| AF-A0A833LSZ3-F1-model_v4 | Proteasome-type protease | 0.9789 | 8 | 248 |
GO:0005839
GO:0008233 GO:0051603 |
| AF-M3AC61-F1-model_v4 | Proteasome-type protease | 0.9769 | 8 | 248 |
GO:0005839
GO:0008233 GO:0051603 |
| AF-A0A7C9GSW5-F1-model_v4 | Peptidase | 0.9766 | 8 | 248 |
GO:0005839
GO:0051603 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar