F464014

General Info

Members Datasets Scaffolds Average Seq Length
563 255 559 247

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100127231|Ga0070689_1001272313
Length 294
Sequence MHRGCVGTTTSGVFIAAGAIPVALWGSNRDHPRHSSIRRRLAGQGERREAARVTYCVGMKVDEGMIFASDSRTNAGLDNIAKFCKMTLFERAGDRVMVLLSSGNLAGTQAIISLLSQRGDDPDNPGSLWKARTMFDAVNLVSDAMRDIERRDGPSLQASEVTFNASFILGGQIRGEEMRLFRIYAEGNFIESGALTPYIQTGETKYGKPIIDRVITTTTNLADAAKCVLVSFDSTMRSNVSVGMPIDLICYERDSLQVQMRRRFDDGDPYFTSLHRSWSEGTRRVFRELPELLW

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
176 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.36
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 0
Rhizoplane 4.26
Rhizosphere 87.74
Stem 0
Stem Tuber 0
Unclassified 3.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1000231 3300003792 Bacteria 51661
2 Ga0065707_10049975 3300005295 Bacteria 1011
3 Ga0070676_10225468 3300005328 Bacteria 1240
4 Ga0070670_100028390 3300005331 Bacteria 4815
5 Ga0070670_100077873 3300005331 Bacteria 2848
6 Ga0070677_10000382 3300005333 Bacteria 15572
7 Ga0070677_10057419 3300005333 Bacteria 1595
8 Ga0068869_100000865 3300005334 Bacteria 17407
9 Ga0070666_10000758 3300005335 Bacteria 19568
10 Ga0070666_10058312 3300005335 Bacteria 2611
11 Ga0070680_100027471 3300005336 Bacteria 4557
12 Ga0070682_100036759 3300005337 Bacteria 2995
13 Ga0070682_100141760 3300005337 Bacteria 1639
14 Ga0068868_100013034 3300005338 Bacteria 6086
15 Ga0068868_100019465 3300005338 Bacteria 5087
16 Ga0068868_100023141 3300005338 Bacteria 4699
17 Ga0068868_100043514 3300005338 Bacteria 3508
18 Ga0068868_100464418 3300005338 Bacteria 1103
19 Ga0070689_100127231 3300005340 Bacteria 2040
20 Ga0070687_100104610 3300005343 Bacteria 1591
21 Ga0070687_100213866 3300005343 Bacteria 1176
22 Ga0070661_100695694 3300005344 Bacteria 828
23 Ga0070668_100001436 3300005347 Bacteria 17192
24 Ga0070668_100003834 3300005347 Bacteria 11107
25 Ga0070668_100005761 3300005347 Bacteria 9189
26 Ga0070668_100183826 3300005347 Bacteria 1709
27 Ga0070669_100009853 3300005353 Bacteria 6806
28 Ga0070669_100061188 3300005353 Bacteria 2766
29 Ga0070669_100068664 3300005353 Bacteria 2616
30 Ga0070675_100000463 3300005354 Bacteria 27714
31 Ga0070675_100001023 3300005354 Bacteria 20128
32 Ga0070675_100008274 3300005354 Bacteria 8069
33 Ga0070675_100167959 3300005354 Bacteria 1890
34 Ga0070671_100010891 3300005355 Bacteria 7303
35 Ga0070671_100021662 3300005355 Bacteria 5249
36 Ga0070671_100074683 3300005355 Bacteria 2832
37 Ga0070671_100130406 3300005355 Bacteria 2117
38 Ga0070674_100000094 3300005356 Bacteria 41372
39 Ga0070674_100008211 3300005356 Bacteria 6200
40 Ga0070674_100407246 3300005356 Bacteria 1113
41 Ga0070674_100636891 3300005356 Bacteria 905
42 Ga0070673_100000753 3300005364 Bacteria 17978
43 Ga0070673_100002697 3300005364 Bacteria 10877
44 Ga0070673_100195151 3300005364 Bacteria 1741
45 Ga0070673_100212399 3300005364 Bacteria 1672
46 Ga0070673_100625613 3300005364 Bacteria 984
47 Ga0070688_100041715 3300005365 Bacteria 2819
48 Ga0070659_100179555 3300005366 Bacteria 1737
49 Ga0070659_100688934 3300005366 Bacteria 883
50 Ga0070667_100001746 3300005367 Bacteria 19433
51 Ga0070667_100006402 3300005367 Bacteria 9784
52 Ga0070667_100013445 3300005367 Bacteria 6767
53 Ga0070667_100017690 3300005367 Bacteria 5907
54 Ga0070667_100040533 3300005367 Bacteria 3905
55 Ga0070667_100044461 3300005367 Bacteria 3730
56 Ga0070713_100000020 3300005436 Bacteria 108930
57 Ga0070713_100381694 3300005436 Bacteria 1313
58 Ga0070711_100240581 3300005439 Bacteria 1415
59 Ga0070700_100040098 3300005441 Bacteria 2865
60 Ga0070700_100076953 3300005441 Bacteria 2144
61 Ga0070700_100179573 3300005441 Bacteria 1472
62 Ga0070708_100038472 3300005445 Bacteria 4179
63 Ga0070663_100304410 3300005455 Bacteria 1277
64 Ga0070678_100000409 3300005456 Bacteria 20280
65 Ga0070678_100103717 3300005456 Bacteria 2210
66 Ga0070678_100217398 3300005456 Bacteria 1587
67 Ga0070662_100157711 3300005457 Bacteria 1773
68 Ga0070662_100326084 3300005457 Bacteria 1253
69 Ga0070681_10118114 3300005458 Bacteria 2588
70 Ga0068867_100006509 3300005459 Bacteria 8254
71 Ga0068867_100008769 3300005459 Bacteria 7139
72 Ga0068867_100079353 3300005459 Bacteria 2470
73 Ga0068867_100290235 3300005459 Bacteria 1345
74 Ga0070685_10050616 3300005466 Bacteria 2400
75 Ga0070706_100017714 3300005467 Bacteria 6573
76 Ga0070707_100077286 3300005468 Bacteria 3212
77 Ga0070698_100071307 3300005471 Bacteria 3484
78 Ga0070699_100338673 3300005518 Bacteria 1354
79 Ga0070684_100702359 3300005535 Bacteria 943
80 Ga0070684_100740714 3300005535 Bacteria 917
81 Ga0068853_100000300 3300005539 Bacteria 34560
82 Ga0068853_100005616 3300005539 Bacteria 9851
83 Ga0068853_100005626 3300005539 Bacteria 9843
84 Ga0068853_100021946 3300005539 Bacteria 5326
85 Ga0068853_100069540 3300005539 Bacteria 3063
86 Ga0070672_100000552 3300005543 Bacteria 22019
87 Ga0070672_100001803 3300005543 Bacteria 13392
88 Ga0070672_100029609 3300005543 Bacteria 4107
89 Ga0070672_100089043 3300005543 Bacteria 2486
90 Ga0070672_100129261 3300005543 Bacteria 2075
91 Ga0070672_100152446 3300005543 Bacteria 1912
92 Ga0070672_100166921 3300005543 Bacteria 1829
93 Ga0070686_100057560 3300005544 Bacteria 2497
94 Ga0070665_100002419 3300005548 Bacteria 20581
95 Ga0070665_100009078 3300005548 Bacteria 10071
96 Ga0070665_100020178 3300005548 Bacteria 6690
97 Ga0070665_100025134 3300005548 Bacteria 6001
98 Ga0070665_100382044 3300005548 Bacteria 1416
99 Ga0070665_100383054 3300005548 Bacteria 1414
100 Ga0070665_100395323 3300005548 Bacteria 1390
101 Ga0070665_100724347 3300005548 Bacteria 1008
102 Ga0070704_100097565 3300005549 Bacteria 2206
103 Ga0068855_100276821 3300005563 Bacteria 1865
104 Ga0070664_100224438 3300005564 Bacteria 1682
105 Ga0068857_100008978 3300005577 Bacteria 8663
106 Ga0068857_100030542 3300005577 Bacteria 4758
107 Ga0068857_100110444 3300005577 Bacteria 2471
108 Ga0068856_100122077 3300005614 Bacteria 2607
109 Ga0070702_100084926 3300005615 Bacteria 1905
110 Ga0068852_100019333 3300005616 Bacteria 5388
111 Ga0068852_100270969 3300005616 Bacteria 1633
112 Ga0068852_100571108 3300005616 Bacteria 1133
113 Ga0068852_100695960 3300005616 Bacteria 1026
114 Ga0068859_100001747 3300005617 Bacteria 22150
115 Ga0068859_100052895 3300005617 Bacteria 4084
116 Ga0068859_100209850 3300005617 Bacteria 2034
117 Ga0068864_100008836 3300005618 Bacteria 8306
118 Ga0068864_100009680 3300005618 Bacteria 7951
119 Ga0068864_100014755 3300005618 Bacteria 6491
120 Ga0068864_100156525 3300005618 Bacteria 2068
121 Ga0068866_10153168 3300005718 Bacteria 1337
122 Ga0068866_10246877 3300005718 Bacteria 1090
123 Ga0068861_100000564 3300005719 Bacteria 21995
124 Ga0068861_100029241 3300005719 Bacteria 4030
125 Ga0068861_100086200 3300005719 Bacteria 2468
126 Ga0068861_100123958 3300005719 Bacteria 2088
127 Ga0068851_10000941 3300005834 Bacteria 12604
128 Ga0068851_10099000 3300005834 Bacteria 1545
129 Ga0068870_10042210 3300005840 Bacteria 2374
130 Ga0068870_10055677 3300005840 Bacteria 2108
131 Ga0068870_10127155 3300005840 Bacteria 1476
132 Ga0068863_100004874 3300005841 Bacteria 13221
133 Ga0068863_100022879 3300005841 Bacteria 5973
134 Ga0068863_100045403 3300005841 Bacteria 4170
135 Ga0068863_100061670 3300005841 Bacteria 3546
136 Ga0068863_100127749 3300005841 Bacteria 2426
137 Ga0068863_100305860 3300005841 Bacteria 1543
138 Ga0068863_100490523 3300005841 Bacteria 1209
139 Ga0068858_100011382 3300005842 Bacteria 8401
140 Ga0068858_100021251 3300005842 Bacteria 6062
141 Ga0068858_100058894 3300005842 Bacteria 3551
142 Ga0068858_100111244 3300005842 Bacteria 2558
143 Ga0068858_100284925 3300005842 Bacteria 1574
144 Ga0068858_100750236 3300005842 Bacteria 951
145 Ga0068860_100025029 3300005843 Bacteria 5762
146 Ga0068860_100115312 3300005843 Bacteria 2569
147 Ga0068860_100147446 3300005843 Bacteria 2265
148 Ga0068860_100158482 3300005843 Bacteria 2181
149 Ga0068862_100031354 3300005844 Bacteria 4486
150 Ga0068862_100144529 3300005844 Bacteria 2113
151 Ga0068862_100145317 3300005844 Bacteria 2107
152 Ga0070717_10029680 3300006028 Bacteria 4390
153 Ga0075364_10181337 3300006051 Bacteria 1425
154 Ga0075367_10183240 3300006178 Bacteria 1306
155 Ga0075369_10000833 3300006186 Bacteria 10168
156 Ga0075369_10038299 3300006186 Bacteria 2045
157 Ga0075366_10073931 3300006195 Bacteria 2032
158 Ga0075366_10377159 3300006195 Bacteria 872
159 Ga0097621_100018068 3300006237 Bacteria 5377
160 Ga0097621_100231089 3300006237 Bacteria 1615
161 Ga0075370_10019556 3300006353 Bacteria 3690
162 Ga0075370_10021653 3300006353 Bacteria 3522
163 Ga0075370_10134635 3300006353 Bacteria 1443
164 Ga0068871_100004702 3300006358 Bacteria 9546
165 Ga0068871_100032120 3300006358 Bacteria 4144
166 Ga0068865_100535886 3300006881 Bacteria 981
167 Ga0097620_100001747 3300006931 Bacteria 22150
168 Ga0097620_100052895 3300006931 Bacteria 4084
169 Ga0097620_100209860 3300006931 Bacteria 2034
170 Ga0105240_10001580 3300009093 Bacteria 38653
171 Ga0105240_10055003 3300009093 Bacteria 4985
172 Ga0105240_10080523 3300009093 Bacteria 4005
173 Ga0111539_10017990 3300009094 Bacteria 8754
174 Ga0111539_10176415 3300009094 Bacteria 2496
175 Ga0105245_10016254 3300009098 Bacteria 6488
176 Ga0105245_10114570 3300009098 Bacteria 2511
177 Ga0105247_10107572 3300009101 Bacteria 1791
178 Ga0105247_10160628 3300009101 Bacteria 1487
179 Ga0105243_10179041 3300009148 Bacteria 1842
180 Ga0105243_10791060 3300009148 Bacteria 934
181 Ga0105242_10043620 3300009176 Bacteria 3628
182 Ga0105242_10671956 3300009176 Bacteria 1010
183 Ga0105248_10016230 3300009177 Bacteria 8198
184 Ga0105248_10111238 3300009177 Bacteria 3089
185 Ga0105248_10316026 3300009177 Bacteria 1759
186 Ga0105248_10387261 3300009177 Bacteria 1574
187 Ga0105237_10001046 3300009545 Bacteria 37146
188 Ga0105237_10241639 3300009545 Bacteria 1807
189 Ga0105237_10264731 3300009545 Unclassified 1722
190 Ga0105238_10007419 3300009551 Bacteria 10984
191 Ga0105238_10246661 3300009551 Bacteria 1764
192 Ga0105238_10507360 3300009551 Bacteria 1208
193 Ga0105249_10108176 3300009553 Bacteria 2624
194 Ga0105249_10192611 3300009553 Bacteria 1991
195 Ga0105249_10277108 3300009553 Bacteria 1673
196 Ga0105249_10443358 3300009553 Bacteria 1336
197 Ga0105249_10793917 3300009553 Bacteria 1010
198 Ga0105239_10001284 3300010375 Bacteria 33916
199 Ga0105239_10366887 3300010375 Bacteria 1627
200 Ga0105239_10742594 3300010375 Bacteria 1123
201 Ga0157374_10063917 3300013296 Bacteria 3452
202 Ga0157374_10102567 3300013296 Bacteria 2744
203 Ga0157374_10284991 3300013296 Bacteria 1631
204 Ga0157374_10420358 3300013296 Bacteria 1335
205 Ga0157374_10440469 3300013296 Bacteria 1303
206 Ga0157378_10010166 3300013297 Bacteria 8208
207 Ga0157378_10016847 3300013297 Bacteria 6407
208 Ga0157378_10051384 3300013297 Bacteria 3668
209 Ga0157378_10275785 3300013297 Bacteria 1619
210 Ga0163162_10014935 3300013306 Bacteria 7583
211 Ga0163162_10041082 3300013306 Bacteria 4627
212 Ga0163162_10054481 3300013306 Bacteria 4023
213 Ga0163162_10216437 3300013306 Bacteria 2045
214 Ga0163162_10219098 3300013306 Bacteria 2033
215 Ga0157372_10241435 3300013307 Bacteria 2096
216 Ga0157375_10004106 3300013308 Bacteria 12629
217 Ga0157375_10011287 3300013308 Bacteria 7887
218 Ga0157375_10086690 3300013308 Bacteria 3182
219 Ga0157375_10105221 3300013308 Bacteria 2912
220 Ga0157375_10115214 3300013308 Bacteria 2790
221 Ga0157375_10138475 3300013308 Bacteria 2559
222 Ga0157375_10152956 3300013308 Bacteria 2444
223 Ga0157375_10180916 3300013308 Bacteria 2259
224 Ga0157375_10420408 3300013308 Bacteria 1503
225 Ga0157375_10442300 3300013308 Bacteria 1466
226 Ga0157375_11416751 3300013308 Bacteria 819
227 Ga0163163_10078621 3300014325 Bacteria 3295
228 Ga0163163_10365842 3300014325 Bacteria 1499
229 Ga0163163_10507632 3300014325 Bacteria 1268
230 Ga0157380_10052009 3300014326 Bacteria 3242
231 Ga0157380_10061653 3300014326 Bacteria 3002
232 Ga0157380_10063192 3300014326 Bacteria 2968
233 Ga0157380_10185677 3300014326 Bacteria 1831
234 Ga0157380_10445550 3300014326 Bacteria 1242
235 Ga0157380_10797396 3300014326 Bacteria 961
236 Ga0157379_10001057 3300014968 Bacteria 22428
237 Ga0157379_10002624 3300014968 Bacteria 15116
238 Ga0157379_10942414 3300014968 Bacteria 821
239 Ga0157376_10038509 3300014969 Bacteria 3891
240 Ga0157376_10069703 3300014969 Bacteria 2982
241 Ga0157376_10289135 3300014969 Bacteria 1547
242 Ga0157376_10365782 3300014969 Bacteria 1385
243 Ga0157376_10658637 3300014969 Bacteria 1048
244 Ga0163161_10049193 3300017792 Bacteria 3046
245 Ga0163161_10117090 3300017792 Bacteria 1998
246 Ga0163161_10126069 3300017792 Bacteria 1928
247 Ga0163161_10244336 3300017792 Bacteria 1397
248 Ga0163161_10817916 3300017792 Bacteria 784
249 Ga0209051_1000048 3300025303 Bacteria 292755
250 Ga0209257_1026414 3300025304 Bacteria 1958
251 Ga0207697_10014167 3300025315 Bacteria 3314
252 Ga0207656_10003408 3300025321 Bacteria 5460
253 Ga0207682_10002512 3300025893 Bacteria 8199
254 Ga0207642_10095909 3300025899 Bacteria 1477
255 Ga0207680_10041527 3300025903 Bacteria 2684
256 Ga0207645_10004706 3300025907 Bacteria 10041
257 Ga0207645_10007637 3300025907 Bacteria 7620
258 Ga0207645_10086099 3300025907 Bacteria 2018
259 Ga0207645_10178523 3300025907 Bacteria 1393
260 Ga0207645_10262855 3300025907 Bacteria 1143
261 Ga0207643_10041542 3300025908 Bacteria 2592
262 Ga0207643_10043562 3300025908 Bacteria 2533
263 Ga0207684_10003448 3300025910 Bacteria 15423
264 Ga0207684_10155772 3300025910 Bacteria 1966
265 Ga0207654_10091887 3300025911 Bacteria 1852
266 Ga0207707_10195205 3300025912 Bacteria 1766
267 Ga0207695_10013552 3300025913 Bacteria 9714
268 Ga0207671_10002719 3300025914 Bacteria 18528
269 Ga0207671_10127247 3300025914 Bacteria 1952
270 Ga0207660_10042148 3300025917 Bacteria 3202
271 Ga0207660_10318319 3300025917 Bacteria 1242
272 Ga0207662_10142365 3300025918 Bacteria 1520
273 Ga0207646_10333505 3300025922 Bacteria 1370
274 Ga0207681_10011126 3300025923 Bacteria 5527
275 Ga0207681_10014702 3300025923 Bacteria 4872
276 Ga0207694_10014747 3300025924 Bacteria 5893
277 Ga0207694_10024439 3300025924 Bacteria 4589
278 Ga0207694_10034092 3300025924 Bacteria 3902
279 Ga0207694_10114621 3300025924 Bacteria 2147
280 Ga0207694_10537259 3300025924 Bacteria 981
281 Ga0207650_10016788 3300025925 Bacteria 5120
282 Ga0207650_10017344 3300025925 Bacteria 5040
283 Ga0207650_10018525 3300025925 Bacteria 4886
284 Ga0207650_10023927 3300025925 Bacteria 4336
285 Ga0207650_10095306 3300025925 Bacteria 2281
286 Ga0207659_10010777 3300025926 Bacteria 5752
287 Ga0207659_10016864 3300025926 Bacteria 4762
288 Ga0207659_10069050 3300025926 Bacteria 2572
289 Ga0207687_10004824 3300025927 Bacteria 8967
290 Ga0207687_10022894 3300025927 Bacteria 4161
291 Ga0207700_10000086 3300025928 Bacteria 58118
292 Ga0207700_10304540 3300025928 Bacteria 1377
293 Ga0207644_10001344 3300025931 Bacteria 15805
294 Ga0207644_10012267 3300025931 Bacteria 5689
295 Ga0207644_10083288 3300025931 Bacteria 2368
296 Ga0207644_10163159 3300025931 Bacteria 1734
297 Ga0207644_10165021 3300025931 Bacteria 1725
298 Ga0207706_10023984 3300025933 Bacteria 5474
299 Ga0207706_10136364 3300025933 Bacteria 2159
300 Ga0207706_10152693 3300025933 Bacteria 2031
301 Ga0207686_10580369 3300025934 Bacteria 880
302 Ga0207709_10025299 3300025935 Bacteria 3397
303 Ga0207670_10010745 3300025936 Bacteria 5285
304 Ga0207669_10003485 3300025937 Bacteria 6803
305 Ga0207669_10008259 3300025937 Bacteria 4880
306 Ga0207669_10415108 3300025937 Bacteria 1058
307 Ga0207704_10242419 3300025938 Bacteria 1348
308 Ga0207704_10535206 3300025938 Bacteria 950
309 Ga0207691_10000018 3300025940 Bacteria 134343
310 Ga0207691_10000509 3300025940 Bacteria 38750
311 Ga0207691_10003508 3300025940 Bacteria 15262
312 Ga0207691_10014158 3300025940 Bacteria 7610
313 Ga0207691_10033514 3300025940 Bacteria 4781
314 Ga0207691_10139309 3300025940 Bacteria 2138
315 Ga0207711_10073235 3300025941 Bacteria 2977
316 Ga0207711_10081316 3300025941 Bacteria 2831
317 Ga0207689_10000174 3300025942 Bacteria 56242
318 Ga0207689_10004337 3300025942 Bacteria 12921
319 Ga0207689_10421192 3300025942 Bacteria 1114
320 Ga0207661_10068898 3300025944 Bacteria 2883
321 Ga0207679_10206178 3300025945 Bacteria 1646
322 Ga0207651_10002164 3300025960 Bacteria 9298
323 Ga0207651_10002176 3300025960 Bacteria 9280
324 Ga0207651_10282497 3300025960 Bacteria 1372
325 Ga0207712_10313407 3300025961 Bacteria 1292
326 Ga0207668_10002010 3300025972 Bacteria 11871
327 Ga0207668_10002470 3300025972 Bacteria 10799
328 Ga0207668_10016568 3300025972 Bacteria 4601
329 Ga0207668_10029303 3300025972 Bacteria 3607
330 Ga0207668_10100816 3300025972 Bacteria 2145
331 Ga0207658_10008875 3300025986 Bacteria 6823
332 Ga0207658_10013016 3300025986 Bacteria 5682
333 Ga0207658_10016070 3300025986 Bacteria 5140
334 Ga0207658_10034666 3300025986 Bacteria 3609
335 Ga0207658_10051891 3300025986 Bacteria 3024
336 Ga0207658_10078755 3300025986 Bacteria 2519
337 Ga0207658_10082139 3300025986 Bacteria 2474
338 Ga0207658_10339222 3300025986 Bacteria 1306
339 Ga0207677_10003221 3300026023 Bacteria 8613
340 Ga0207677_10013142 3300026023 Bacteria 4786
341 Ga0207703_10193637 3300026035 Bacteria 1802
342 Ga0207703_10644804 3300026035 Bacteria 1004
343 Ga0207639_10000508 3300026041 Bacteria 26945
344 Ga0207639_10009051 3300026041 Bacteria 6860
345 Ga0207639_10090056 3300026041 Bacteria 2453
346 Ga0207639_10093910 3300026041 Bacteria 2407
347 Ga0207678_10006420 3300026067 Bacteria 10433
348 Ga0207708_10006963 3300026075 Bacteria 8361
349 Ga0207708_10080620 3300026075 Bacteria 2501
350 Ga0207708_10202874 3300026075 Bacteria 1582
351 Ga0207702_10278949 3300026078 Bacteria 1579
352 Ga0207641_10014012 3300026088 Bacteria 6573
353 Ga0207641_10027403 3300026088 Bacteria 4705
354 Ga0207641_10057332 3300026088 Bacteria 3312
355 Ga0207641_10099950 3300026088 Bacteria 2554
356 Ga0207641_10165395 3300026088 Bacteria 2014
357 Ga0207648_10001922 3300026089 Bacteria 22701
358 Ga0207648_10015731 3300026089 Bacteria 6940
359 Ga0207648_10033203 3300026089 Bacteria 4552
360 Ga0207648_10189296 3300026089 Bacteria 1823
361 Ga0207648_10220267 3300026089 Bacteria 1686
362 Ga0207648_10334797 3300026089 Bacteria 1362
363 Ga0207676_10010076 3300026095 Bacteria 6725
364 Ga0207676_10013354 3300026095 Bacteria 5899
365 Ga0207676_10034639 3300026095 Bacteria 3824
366 Ga0207676_10130273 3300026095 Bacteria 2137
367 Ga0207674_10041103 3300026116 Bacteria 4784
368 Ga0207674_10090058 3300026116 Bacteria 3059
369 Ga0207674_10581134 3300026116 Unclassified 1082
370 Ga0207675_100000847 3300026118 Bacteria 30430
371 Ga0207675_100021000 3300026118 Bacteria 6087
372 Ga0207675_100033377 3300026118 Bacteria 4796
373 Ga0207675_100058168 3300026118 Bacteria 3608
374 Ga0207683_10000020 3300026121 Bacteria 118805
375 Ga0207683_10002464 3300026121 Bacteria 16138
376 Ga0207683_10029090 3300026121 Bacteria 4782
377 Ga0207683_10137516 3300026121 Bacteria 2199
378 Ga0207698_10007168 3300026142 Bacteria 6981
379 Ga0207698_10208502 3300026142 Bacteria 1756
380 Ga0207428_10371703 3300027907 Bacteria 1050
381 Ga0268266_10013368 3300028379 Bacteria 7071
382 Ga0268266_10063383 3300028379 Bacteria 3191
383 Ga0268266_10078638 3300028379 Bacteria 2870
384 Ga0268266_10173632 3300028379 Bacteria 1958
385 Ga0268266_10335395 3300028379 Bacteria 1418
386 Ga0268266_10388485 3300028379 Bacteria 1318
387 Ga0268265_10028173 3300028380 Bacteria 4019
388 Ga0268265_10030373 3300028380 Bacteria 3891
389 Ga0268265_10134089 3300028380 Bacteria 2063
390 Ga0268265_10142539 3300028380 Bacteria 2008
391 Ga0268265_10631954 3300028380 Bacteria 1027
392 Ga0268264_10002310 3300028381 Bacteria 16863
393 Ga0268264_10152755 3300028381 Bacteria 2072
394 Ga0268264_10229254 3300028381 Bacteria 1714
395 Ga0268264_10254749 3300028381 Bacteria 1632
396 Ga0268264_10338371 3300028381 Bacteria 1429
397 Ga0268264_10388798 3300028381 Bacteria 1338
398 Ga0265319_1047676 3300028563 Bacteria 1425
399 Ga0265318_10000108 3300028577 Bacteria 77334
400 Ga0265318_10000878 3300028577 Bacteria 19643
401 Ga0265336_10002346 3300028666 Bacteria 7871
402 Ga0307517_10272545 3300028786 Bacteria 972
403 Ga0265338_10004756 3300028800 Bacteria 18161
404 Ga0265338_10192985 3300028800 Bacteria 1542
405 Ga0265330_10000201 3300031235 Bacteria 46135
406 Ga0265330_10002606 3300031235 Bacteria 9801
407 Ga0265330_10005212 3300031235 Bacteria 6492
408 Ga0265332_10000255 3300031238 Bacteria 42422
409 Ga0265332_10000447 3300031238 Bacteria 29010
410 Ga0265332_10002933 3300031238 Bacteria 8391
411 Ga0265328_10000254 3300031239 Bacteria 24536
412 Ga0265328_10001319 3300031239 Bacteria 11456
413 Ga0265328_10002130 3300031239 Bacteria 8936
414 Ga0265328_10010589 3300031239 Bacteria 3705
415 Ga0265320_10000085 3300031240 Bacteria 78884
416 Ga0265320_10001256 3300031240 Bacteria 18602
417 Ga0265320_10002076 3300031240 Bacteria 14103
418 Ga0265320_10011178 3300031240 Bacteria 5294
419 Ga0265320_10061572 3300031240 Bacteria 1789
420 Ga0265325_10031821 3300031241 Bacteria 2820
421 Ga0265329_10003349 3300031242 Bacteria 7009
422 Ga0265329_10005103 3300031242 Bacteria 5355
423 Ga0265339_10003541 3300031249 Bacteria 10916
424 Ga0265339_10008026 3300031249 Bacteria 6753
425 Ga0265339_10084862 3300031249 Bacteria 1668
426 Ga0265331_10000179 3300031250 Bacteria 77238
427 Ga0265331_10000354 3300031250 Bacteria 48614
428 Ga0265331_10000762 3300031250 Bacteria 26873
429 Ga0265327_10028928 3300031251 Bacteria 3160
430 Ga0265316_10003342 3300031344 Bacteria 16262
431 Ga0265316_10003383 3300031344 Bacteria 16155
432 Ga0265316_10152207 3300031344 Bacteria 1732
433 Ga0265313_10000103 3300031595 Bacteria 85452
434 Ga0265313_10017259 3300031595 Bacteria 4110
435 Ga0265313_10018126 3300031595 Bacteria 3966
436 Ga0316579_10014904 3300031691 Bacteria 3369
437 Ga0316579_10269876 3300031691 Bacteria 822
438 Ga0265314_10000235 3300031711 Bacteria 82170
439 Ga0265314_10002694 3300031711 Bacteria 17787
440 Ga0265314_10017420 3300031711 Bacteria 5640
441 Ga0265314_10031242 3300031711 Bacteria 3935
442 Ga0265342_10000463 3300031712 Bacteria 44008
443 Ga0265342_10001967 3300031712 Bacteria 18369
444 Ga0265342_10003566 3300031712 Bacteria 12730
445 Ga0265342_10009235 3300031712 Bacteria 6974
446 Ga0265342_10025498 3300031712 Bacteria 3715
447 Ga0265342_10086579 3300031712 Bacteria 1801
448 Ga0316578_10025420 3300031728 Bacteria 3329
449 Ga0307516_10006932 3300031730 Bacteria 13155
450 Ga0316577_10149253 3300031733 Bacteria 1317
451 Ga0307518_10381583 3300031838 Bacteria 799
452 Ga0307414_10033653 3300032004 Bacteria 3390
453 Ga0307411_10000039 3300032005 Bacteria 40183
454 Ga0316583_10054956 3300032133 Bacteria 1400
455 Ga0316583_10135685 3300032133 Bacteria 857
456 Ga0316585_10026141 3300032137 Bacteria 1813
457 Ga0316593_10012065 3300032168 Bacteria 2528
458 Ga0316596_1007743 3300033541 Bacteria 2544
459 Ga0373945_0154736 3300035116 Bacteria 931
460 Ga0373956_0191930 3300035119 Bacteria 967
461 Ga0373943_0262802 3300035170 Bacteria 972
462 Ga0316574_0050562 3300035398 Bacteria 2587
463 Ga0316574_0103129 3300035398 Bacteria 1826
464 Ga0373931_0186196 3300035691 Bacteria 1232
465 Ga0373931_0189163 3300035691 Bacteria 1224
466 Ga0373935_0024014 3300035692 Bacteria 3748
467 Ga0373927_0013717 3300035695 Bacteria 5380
468 Ga0373933_0326290 3300035724 Bacteria 996
469 Ga0373947_0011346 3300035725 Bacteria 5115
470 Ga0373937_0302455 3300036401 Bacteria 1512
471 Ga0373937_0395001 3300036401 Bacteria 1312
472 Ga0373937_0946341 3300036401 Bacteria 810
473 Ga0316582_0077427 3300036647 Bacteria 2164
474 Ga0316584_0214441 3300036712 Bacteria 1416
475 Ga0373925_0023031 3300037068 Bacteria 4545
476 Ga0316581_0092571 3300037588 Bacteria 930
477 Ga0451791_1069114 3300041451 Bacteria 961
478 Ga0451793_1183674 3300041452 Bacteria 926
479 Ga0451798_0182565 3300041458 Bacteria 1595
480 Ga0451800_1048118 3300041459 Bacteria 1042
481 Ga0451802_0675091 3300041460 Bacteria 1019
482 Ga0451807_0545829 3300041486 Bacteria 1270
483 Ga0451837_0610918 3300041494 Bacteria 1104
484 Ga0451843_1081050 3300041509 Unclassified 766
485 Ga0439448_0008586 3300042005 Bacteria 2994
486 Ga0439450_023743 3300042008 Unclassified 1333
487 Ga0451577_0000168 3300042876 Bacteria 144187
488 Ga0451577_0004136 3300042876 Bacteria 15551
489 Ga0451577_0056986 3300042876 Bacteria 3484
490 Ga0453684_0000642 3300044712 Bacteria 126116
491 Ga0453684_0078329 3300044712 Bacteria 4136
492 Ga0453684_0081004 3300044712 Bacteria 4051
493 Ga0453684_0082276 3300044712 Bacteria 4012
494 Ga0453684_0102584 3300044712 Bacteria 3497
495 Ga0451576_0185013 3300045051 Bacteria 2175
496 Ga0451576_0328737 3300045051 Bacteria 1600
497 Ga0495580_0123890 3300046472 Bacteria 1794
498 Ga0495630_0114451 3300046517 Bacteria 2044
499 Ga0495648_0070545 3300046524 Bacteria 2030
500 Ga0495658_0178633 3300046683 Bacteria 1316
501 Ga0495658_0246490 3300046683 Bacteria 1123
502 Ga0495624_0009675 3300046690 Bacteria 6674
503 Ga0495671_0125560 3300046692 Bacteria 1251
504 Ga0495674_0241349 3300047319 Bacteria 1489
505 Ga0495676_0010954 3300047321 Bacteria 8199
506 Ga0495602_0172370 3300048088 Bacteria 1678
507 Ga0496100_0000133 3300048903 Bacteria 41506
508 Ga0496101_0000661 3300048904 Bacteria 20755
509 Ga0496102_0205966 3300048905 Bacteria 1854
510 Ga0496103_0012076 3300048906 Bacteria 5130
511 Ga0496104_0616238 3300048907 Bacteria 995
512 Ga0496105_0332438 3300048908 Bacteria 1216
513 Ga0496105_0534599 3300048908 Bacteria 917
514 Ga0496106_0000992 3300048909 Bacteria 20718
515 Ga0496106_0114597 3300048909 Bacteria 2102
516 Ga0496107_0501879 3300048910 Bacteria 900
517 Ga0496108_0279919 3300048911 Bacteria 1452
518 Ga0496109_0000529 3300048912 Bacteria 32345
519 Ga0496109_0573604 3300048912 Bacteria 1064
520 Ga0496110_0013633 3300048913 Bacteria 6729
521 Ga0496110_0141582 3300048913 Bacteria 2174
522 Ga0496111_0006650 3300048914 Bacteria 7521
523 Ga0496113_0023631 3300048916 Bacteria 4359
524 Ga0496114_0001244 3300048917 Bacteria 19276
525 Ga0496116_0031538 3300048919 Bacteria 3792
526 Ga0496117_0000752 3300048920 Bacteria 51072
527 Ga0496118_0038785 3300048921 Bacteria 3812
528 Ga0496119_0014870 3300048922 Bacteria 6051
529 Ga0496121_0000027 3300048924 Bacteria 444747
530 Ga0496122_0000611 3300048925 Bacteria 73411
531 Ga0496123_0003205 3300048926 Bacteria 18661
532 Ga0496123_0063787 3300048926 Bacteria 2351
533 Ga0496124_0000016 3300048927 Bacteria 444747
534 Ga0496125_0000008 3300048928 Bacteria 704677
535 Ga0496126_0000025 3300048929 Bacteria 444747
536 Ga0496126_0017258 3300048929 Bacteria 7193
537 Ga0501069_0153713 3300049585 Bacteria 1323
538 Ga0501070_0000007 3300049586 Bacteria 219869
539 Ga0501079_0031117 3300049741 Bacteria 4101
540 Ga0501081_0116894 3300049743 Bacteria 1896
541 Ga0501083_0002000 3300049744 Bacteria 14027
542 nmdc:mga00v17_239889_c1 3300050491 Bacteria 1175
543 nmdc:mga0k408_19618_c1 3300050493 Bacteria 3781
544 nmdc:mga0k408_50155_c1 3300050493 Bacteria 2416
545 nmdc:mga0k408_85703_c1 3300050493 Bacteria 1849
546 nmdc:mga06z11_110865_c1 3300050494 Bacteria 1519
547 nmdc:mga07m45_176366_c1 3300050496 Bacteria 1243
548 nmdc:mga07m45_208756_c1 3300050496 Bacteria 1136
549 nmdc:mga07m45_5468_c1 3300050496 Bacteria 6325
550 nmdc:mga0qj67_361777_c1 3300050509 Bacteria 1172
551 nmdc:mga08y16_210431_c1 3300050511 Bacteria 2014
552 nmdc:mga08y16_61528_c1 3300050511 Bacteria 3920
553 Ga0495612_0177941 3300053078 Bacteria 933
554 Ga0495619_0017309 3300053085 Bacteria 4565
555 Ga0500641_0014674 3300053096 Bacteria 2894
556 Ga0500641_0043432 3300053096 Bacteria 1824
557 Ga0500588_0119327 3300053146 Bacteria 929
558 Ga0500645_027882 3300053730 Bacteria 1711
559 Ga0501082_0042165 3300060353 Bacteria 3934

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037588 Ga0316581_0092571 Ga0316581_0092571_11_700 229
2 3300005328 Ga0070676_10225468 Ga0070676_102254682 235
3 3300009176 Ga0105242_10043620 Ga0105242_100436202 235
4 3300009176 Ga0105242_10671956 Ga0105242_106719561 235
5 3300009177 Ga0105248_10016230 Ga0105248_100162304 235
6 3300013296 Ga0157374_10440469 Ga0157374_104404692 235
7 3300013297 Ga0157378_10010166 Ga0157378_100101664 235
8 3300013306 Ga0163162_10041082 Ga0163162_100410826 235
9 3300013306 Ga0163162_10054481 Ga0163162_100544814 235
10 3300013308 Ga0157375_10420408 Ga0157375_104204082 235
11 3300014325 Ga0163163_10078621 Ga0163163_100786212 235
12 3300014325 Ga0163163_10365842 Ga0163163_103658422 235
13 3300014326 Ga0157380_10052009 Ga0157380_100520093 235
14 3300014326 Ga0157380_10063192 Ga0157380_100631923 235
15 3300014326 Ga0157380_10185677 Ga0157380_101856773 235
16 3300014968 Ga0157379_10001057 Ga0157379_1000105712 235
17 3300036401 Ga0373937_0946341 Ga0373937_0946341_62_793 235
18 3300005354 Ga0070675_100167959 Ga0070675_1001679592 236
19 3300013308 Ga0157375_10115214 Ga0157375_101152142 236
20 3300014326 Ga0157380_10797396 Ga0157380_107973962 236
21 3300005617 Ga0068859_100052895 Ga0068859_1000528954 237
22 3300006931 Ga0097620_100052895 Ga0097620_1000528954 237
23 3300025924 Ga0207694_10024439 Ga0207694_100244398 237
24 3300041494 Ga0451837_0610918 Ga0451837_0610918_322_1035 237
25 iso_pu_bacteria 2643221654 2644305181 237
26 iso_pu_bacteria 2989392574 2989392834 237
27 3300009093 Ga0105240_10055003 Ga0105240_100550036 238
28 3300041460 Ga0451802_0675091 Ga0451802_0675091_261_983 238
29 3300049586 Ga0501070_0000007 Ga0501070_0000007_53073_53795 238
30 3300049741 Ga0501079_0031117 Ga0501079_0031117_2058_2780 238
31 3300049743 Ga0501081_0116894 Ga0501081_0116894_960_1682 238
32 iso_pu_bacteria 2738541264 2738668811 238
33 iso_pu_bacteria 2738541356 2739148003 238
34 3300005331 Ga0070670_100077873 Ga0070670_1000778733 240
35 3300005333 Ga0070677_10057419 Ga0070677_100574191 240
36 3300005338 Ga0068868_100023141 Ga0068868_1000231412 240
37 3300005338 Ga0068868_100043514 Ga0068868_1000435143 240
38 3300005355 Ga0070671_100021662 Ga0070671_1000216623 240
39 3300005355 Ga0070671_100074683 Ga0070671_1000746833 240
40 3300005364 Ga0070673_100002697 Ga0070673_1000026973 240
41 3300005445 Ga0070708_100038472 Ga0070708_1000384726 240
42 3300005457 Ga0070662_100157711 Ga0070662_1001577113 240
43 3300005459 Ga0068867_100006509 Ga0068867_1000065098 240
44 3300005467 Ga0070706_100017714 Ga0070706_1000177146 240
45 3300005518 Ga0070699_100338673 Ga0070699_1003386732 240
46 3300005539 Ga0068853_100069540 Ga0068853_1000695402 240
47 3300005543 Ga0070672_100001803 Ga0070672_1000018034 240
48 3300005548 Ga0070665_100009078 Ga0070665_1000090788 240
49 3300005548 Ga0070665_100724347 Ga0070665_1007243471 240
50 3300005577 Ga0068857_100030542 Ga0068857_1000305424 240
51 3300005616 Ga0068852_100571108 Ga0068852_1005711082 240
52 3300005617 Ga0068859_100209850 Ga0068859_1002098502 240
53 3300005618 Ga0068864_100008836 Ga0068864_1000088367 240
54 3300005840 Ga0068870_10055677 Ga0068870_100556772 240
55 3300005841 Ga0068863_100490523 Ga0068863_1004905232 240
56 3300006178 Ga0075367_10183240 Ga0075367_101832402 240
57 3300006195 Ga0075366_10377159 Ga0075366_103771591 240
58 3300006353 Ga0075370_10019556 Ga0075370_100195564 240
59 3300006353 Ga0075370_10021653 Ga0075370_100216532 240
60 3300006353 Ga0075370_10134635 Ga0075370_101346351 240
61 3300006931 Ga0097620_100209860 Ga0097620_1002098602 240
62 3300009093 Ga0105240_10001580 Ga0105240_1000158026 240
63 3300009098 Ga0105245_10016254 Ga0105245_100162545 240
64 3300009098 Ga0105245_10114570 Ga0105245_101145702 240
65 3300009148 Ga0105243_10179041 Ga0105243_101790413 240
66 3300009545 Ga0105237_10001046 Ga0105237_1000104610 240
67 3300009551 Ga0105238_10007419 Ga0105238_100074196 240
68 3300009551 Ga0105238_10507360 Ga0105238_105073601 240
69 3300010375 Ga0105239_10001284 Ga0105239_1000128410 240
70 3300010375 Ga0105239_10742594 Ga0105239_107425941 240
71 3300013296 Ga0157374_10420358 Ga0157374_104203582 240
72 3300013297 Ga0157378_10051384 Ga0157378_100513844 240
73 3300013308 Ga0157375_10086690 Ga0157375_100866903 240
74 3300013308 Ga0157375_10442300 Ga0157375_104423002 240
75 3300014325 Ga0163163_10507632 Ga0163163_105076321 240
76 3300025304 Ga0209257_1026414 Ga0209257_10264142 240
77 3300025907 Ga0207645_10007637 Ga0207645_100076373 240
78 3300025908 Ga0207643_10043562 Ga0207643_100435623 240
79 3300025910 Ga0207684_10003448 Ga0207684_1000344811 240
80 3300025913 Ga0207695_10013552 Ga0207695_1001355210 240
81 3300025914 Ga0207671_10002719 Ga0207671_100027194 240
82 3300025924 Ga0207694_10034092 Ga0207694_100340924 240
83 3300025924 Ga0207694_10114621 Ga0207694_101146213 240
84 3300025925 Ga0207650_10018525 Ga0207650_100185253 240
85 3300025927 Ga0207687_10004824 Ga0207687_100048242 240
86 3300025927 Ga0207687_10022894 Ga0207687_100228942 240
87 3300025931 Ga0207644_10012267 Ga0207644_100122673 240
88 3300025931 Ga0207644_10083288 Ga0207644_100832882 240
89 3300025933 Ga0207706_10152693 Ga0207706_101526933 240
90 3300025940 Ga0207691_10014158 Ga0207691_100141584 240
91 3300025960 Ga0207651_10002164 Ga0207651_100021642 240
92 3300025986 Ga0207658_10078755 Ga0207658_100787553 240
93 3300026023 Ga0207677_10013142 Ga0207677_100131422 240
94 3300026088 Ga0207641_10099950 Ga0207641_100999503 240
95 3300026089 Ga0207648_10033203 Ga0207648_100332034 240
96 3300026095 Ga0207676_10130273 Ga0207676_101302731 240
97 3300026142 Ga0207698_10208502 Ga0207698_102085022 240
98 3300028379 Ga0268266_10078638 Ga0268266_100786382 240
99 3300028786 Ga0307517_10272545 Ga0307517_102725451 240
100 3300031730 Ga0307516_10006932 Ga0307516_1000693213 240
101 3300031838 Ga0307518_10381583 Ga0307518_103815831 240
102 3300032004 Ga0307414_10033653 Ga0307414_100336532 240
103 3300032005 Ga0307411_10000039 Ga0307411_1000003913 240
104 3300036401 Ga0373937_0302455 Ga0373937_0302455_591_1313 240
105 3300041452 Ga0451793_1183674 Ga0451793_1183674_21_743 240
106 3300041458 Ga0451798_0182565 Ga0451798_0182565_604_1326 240
107 3300041459 Ga0451800_1048118 Ga0451800_1048118_216_938 240
108 3300041486 Ga0451807_0545829 Ga0451807_0545829_170_892 240
109 3300042876 Ga0451577_0004136 Ga0451577_0004136_5414_6157 240
110 3300042876 Ga0451577_0056986 Ga0451577_0056986_1515_2237 240
111 3300044712 Ga0453684_0081004 Ga0453684_0081004_3080_3823 240
112 3300044712 Ga0453684_0102584 Ga0453684_0102584_731_1453 240
113 3300045051 Ga0451576_0185013 Ga0451576_0185013_723_1445 240
114 3300045051 Ga0451576_0328737 Ga0451576_0328737_159_881 240
115 3300046517 Ga0495630_0114451 Ga0495630_0114451_1150_1872 240
116 3300046524 Ga0495648_0070545 Ga0495648_0070545_1116_1838 240
117 3300046690 Ga0495624_0009675 Ga0495624_0009675_401_1123 240
118 3300046692 Ga0495671_0125560 Ga0495671_0125560_472_1194 240
119 3300047319 Ga0495674_0241349 Ga0495674_0241349_702_1424 240
120 3300047321 Ga0495676_0010954 Ga0495676_0010954_5137_5859 240
121 3300048088 Ga0495602_0172370 Ga0495602_0172370_367_1089 240
122 3300048909 Ga0496106_0114597 Ga0496106_0114597_1072_1794 240
123 3300050493 nmdc:mga0k408_19618_c1 nmdc:mga0k408_19618_c1_169_894 240
124 3300050493 nmdc:mga0k408_85703_c1 nmdc:mga0k408_85703_c1_462_1184 240
125 3300050494 nmdc:mga06z11_110865_c1 nmdc:mga06z11_110865_c1_248_973 240
126 3300050496 nmdc:mga07m45_176366_c1 nmdc:mga07m45_176366_c1_248_973 240
127 3300050496 nmdc:mga07m45_208756_c1 nmdc:mga07m45_208756_c1_331_1053 240
128 3300050496 nmdc:mga07m45_5468_c1 nmdc:mga07m45_5468_c1_4148_4870 240
129 3300053078 Ga0495612_0177941 Ga0495612_0177941_133_855 240
130 3300053096 Ga0500641_0043432 Ga0500641_0043432_616_1338 240
131 3300053730 Ga0500645_027882 Ga0500645_027882_154_876 240
132 3300005295 Ga0065707_10049975 Ga0065707_100499752 241
133 3300005366 Ga0070659_100179555 Ga0070659_1001795552 241
134 3300005458 Ga0070681_10118114 Ga0070681_101181142 241
135 3300005535 Ga0070684_100740714 Ga0070684_1007407141 241
136 3300005539 Ga0068853_100005626 Ga0068853_1000056263 241
137 3300005577 Ga0068857_100110444 Ga0068857_1001104443 241
138 3300009545 Ga0105237_10241639 Ga0105237_102416392 241
139 3300009551 Ga0105238_10246661 Ga0105238_102466612 241
140 3300010375 Ga0105239_10366887 Ga0105239_103668872 241
141 3300013307 Ga0157372_10241435 Ga0157372_102414353 241
142 3300014326 Ga0157380_10061653 Ga0157380_100616533 241
143 3300014326 Ga0157380_10445550 Ga0157380_104455501 241
144 3300025911 Ga0207654_10091887 Ga0207654_100918872 241
145 3300025912 Ga0207707_10195205 Ga0207707_101952052 241
146 3300025914 Ga0207671_10127247 Ga0207671_101272472 241
147 3300025917 Ga0207660_10318319 Ga0207660_103183192 241
148 3300025924 Ga0207694_10537259 Ga0207694_105372591 241
149 3300025938 Ga0207704_10535206 Ga0207704_105352061 241
150 3300026041 Ga0207639_10093910 Ga0207639_100939102 241
151 3300026078 Ga0207702_10278949 Ga0207702_102789492 241
152 3300026116 Ga0207674_10090058 Ga0207674_100900581 241
153 3300028380 Ga0268265_10142539 Ga0268265_101425392 241
154 3300031235 Ga0265330_10005212 Ga0265330_100052122 241
155 3300031238 Ga0265332_10000255 Ga0265332_1000025521 241
156 3300031239 Ga0265328_10010589 Ga0265328_100105893 241
157 3300031242 Ga0265329_10003349 Ga0265329_100033493 241
158 3300031250 Ga0265331_10000354 Ga0265331_1000035435 241
159 3300031251 Ga0265327_10028928 Ga0265327_100289283 241
160 3300031344 Ga0265316_10152207 Ga0265316_101522072 241
161 3300031691 Ga0316579_10014904 Ga0316579_100149042 241
162 3300031691 Ga0316579_10269876 Ga0316579_102698761 241
163 3300031711 Ga0265314_10002694 Ga0265314_1000269416 241
164 3300031712 Ga0265342_10025498 Ga0265342_100254984 241
165 3300031728 Ga0316578_10025420 Ga0316578_100254203 241
166 3300031733 Ga0316577_10149253 Ga0316577_101492532 241
167 3300032133 Ga0316583_10054956 Ga0316583_100549561 241
168 3300032133 Ga0316583_10135685 Ga0316583_101356851 241
169 3300032137 Ga0316585_10026141 Ga0316585_100261412 241
170 3300032168 Ga0316593_10012065 Ga0316593_100120652 241
171 3300033541 Ga0316596_1007743 Ga0316596_10077433 241
172 3300035398 Ga0316574_0050562 Ga0316574_0050562_1382_2107 241
173 3300035398 Ga0316574_0103129 Ga0316574_0103129_774_1499 241
174 3300036647 Ga0316582_0077427 Ga0316582_0077427_1357_2082 241
175 3300036712 Ga0316584_0214441 Ga0316584_0214441_72_797 241
176 3300042876 Ga0451577_0000168 Ga0451577_0000168_26131_26895 241
177 3300044712 Ga0453684_0000642 Ga0453684_0000642_45162_45926 241
178 3300044712 Ga0453684_0078329 Ga0453684_0078329_321_1085 241
179 3300044712 Ga0453684_0082276 Ga0453684_0082276_670_1437 241
180 3300048907 Ga0496104_0616238 Ga0496104_0616238_67_795 241
181 3300048908 Ga0496105_0332438 Ga0496105_0332438_380_1108 241
182 3300048908 Ga0496105_0534599 Ga0496105_0534599_44_769 241
183 3300053085 Ga0495619_0017309 Ga0495619_0017309_330_1055 241
184 3300005331 Ga0070670_100028390 Ga0070670_1000283904 242
185 3300005334 Ga0068869_100000865 Ga0068869_10000086517 242
186 3300005336 Ga0070680_100027471 Ga0070680_1000274716 242
187 3300005337 Ga0070682_100036759 Ga0070682_1000367593 242
188 3300005337 Ga0070682_100141760 Ga0070682_1001417602 242
189 3300005338 Ga0068868_100019465 Ga0068868_1000194653 242
190 3300005338 Ga0068868_100464418 Ga0068868_1004644182 242
191 3300005343 Ga0070687_100104610 Ga0070687_1001046102 242
192 3300005343 Ga0070687_100213866 Ga0070687_1002138662 242
193 3300005344 Ga0070661_100695694 Ga0070661_1006956941 242
194 3300005347 Ga0070668_100001436 Ga0070668_10000143610 242
195 3300005347 Ga0070668_100005761 Ga0070668_1000057614 242
196 3300005347 Ga0070668_100183826 Ga0070668_1001838262 242
197 3300005353 Ga0070669_100009853 Ga0070669_1000098537 242
198 3300005353 Ga0070669_100061188 Ga0070669_1000611883 242
199 3300005353 Ga0070669_100068664 Ga0070669_1000686643 242
200 3300005354 Ga0070675_100000463 Ga0070675_10000046313 242
201 3300005354 Ga0070675_100008274 Ga0070675_1000082749 242
202 3300005355 Ga0070671_100130406 Ga0070671_1001304062 242
203 3300005356 Ga0070674_100407246 Ga0070674_1004072462 242
204 3300005356 Ga0070674_100636891 Ga0070674_1006368911 242
205 3300005364 Ga0070673_100195151 Ga0070673_1001951512 242
206 3300005364 Ga0070673_100212399 Ga0070673_1002123992 242
207 3300005364 Ga0070673_100625613 Ga0070673_1006256131 242
208 3300005365 Ga0070688_100041715 Ga0070688_1000417152 242
209 3300005366 Ga0070659_100688934 Ga0070659_1006889341 242
210 3300005367 Ga0070667_100013445 Ga0070667_1000134457 242
211 3300005367 Ga0070667_100017690 Ga0070667_1000176905 242
212 3300005367 Ga0070667_100040533 Ga0070667_1000405337 242
213 3300005436 Ga0070713_100000020 Ga0070713_1000000207 242
214 3300005436 Ga0070713_100381694 Ga0070713_1003816942 242
215 3300005439 Ga0070711_100240581 Ga0070711_1002405811 242
216 3300005441 Ga0070700_100040098 Ga0070700_1000400983 242
217 3300005441 Ga0070700_100076953 Ga0070700_1000769532 242
218 3300005441 Ga0070700_100179573 Ga0070700_1001795732 242
219 3300005455 Ga0070663_100304410 Ga0070663_1003044103 242
220 3300005456 Ga0070678_100000409 Ga0070678_10000040912 242
221 3300005456 Ga0070678_100103717 Ga0070678_1001037172 242
222 3300005456 Ga0070678_100217398 Ga0070678_1002173982 242
223 3300005457 Ga0070662_100326084 Ga0070662_1003260842 242
224 3300005459 Ga0068867_100079353 Ga0068867_1000793533 242
225 3300005459 Ga0068867_100290235 Ga0068867_1002902352 242
226 3300005468 Ga0070707_100077286 Ga0070707_1000772863 242
227 3300005471 Ga0070698_100071307 Ga0070698_1000713071 242
228 3300005535 Ga0070684_100702359 Ga0070684_1007023591 242
229 3300005539 Ga0068853_100000300 Ga0068853_10000030026 242
230 3300005539 Ga0068853_100021946 Ga0068853_1000219462 242
231 3300005543 Ga0070672_100029609 Ga0070672_1000296092 242
232 3300005543 Ga0070672_100089043 Ga0070672_1000890433 242
233 3300005543 Ga0070672_100129261 Ga0070672_1001292612 242
234 3300005543 Ga0070672_100152446 Ga0070672_1001524462 242
235 3300005544 Ga0070686_100057560 Ga0070686_1000575602 242
236 3300005548 Ga0070665_100025134 Ga0070665_1000251347 242
237 3300005548 Ga0070665_100382044 Ga0070665_1003820442 242
238 3300005548 Ga0070665_100383054 Ga0070665_1003830541 242
239 3300005548 Ga0070665_100395323 Ga0070665_1003953232 242
240 3300005549 Ga0070704_100097565 Ga0070704_1000975654 242
241 3300005563 Ga0068855_100276821 Ga0068855_1002768211 242
242 3300005564 Ga0070664_100224438 Ga0070664_1002244382 242
243 3300005577 Ga0068857_100008978 Ga0068857_1000089788 242
244 3300005614 Ga0068856_100122077 Ga0068856_1001220773 242
245 3300005615 Ga0070702_100084926 Ga0070702_1000849262 242
246 3300005616 Ga0068852_100019333 Ga0068852_1000193335 242
247 3300005616 Ga0068852_100270969 Ga0068852_1002709691 242
248 3300005616 Ga0068852_100695960 Ga0068852_1006959602 242
249 3300005617 Ga0068859_100001747 Ga0068859_10000174721 242
250 3300005618 Ga0068864_100009680 Ga0068864_1000096805 242
251 3300005618 Ga0068864_100014755 Ga0068864_1000147555 242
252 3300005618 Ga0068864_100156525 Ga0068864_1001565252 242
253 3300005718 Ga0068866_10153168 Ga0068866_101531682 242
254 3300005718 Ga0068866_10246877 Ga0068866_102468772 242
255 3300005719 Ga0068861_100000564 Ga0068861_1000005644 242
256 3300005719 Ga0068861_100029241 Ga0068861_1000292415 242
257 3300005719 Ga0068861_100086200 Ga0068861_1000862004 242
258 3300005719 Ga0068861_100123958 Ga0068861_1001239585 242
259 3300005834 Ga0068851_10099000 Ga0068851_100990002 242
260 3300005840 Ga0068870_10127155 Ga0068870_101271551 242
261 3300005841 Ga0068863_100004874 Ga0068863_10000487413 242
262 3300005841 Ga0068863_100045403 Ga0068863_1000454032 242
263 3300005841 Ga0068863_100061670 Ga0068863_1000616702 242
264 3300005841 Ga0068863_100127749 Ga0068863_1001277493 242
265 3300005841 Ga0068863_100305860 Ga0068863_1003058601 242
266 3300005842 Ga0068858_100011382 Ga0068858_1000113825 242
267 3300005842 Ga0068858_100021251 Ga0068858_1000212514 242
268 3300005842 Ga0068858_100111244 Ga0068858_1001112442 242
269 3300005842 Ga0068858_100284925 Ga0068858_1002849252 242
270 3300005842 Ga0068858_100750236 Ga0068858_1007502361 242
271 3300005843 Ga0068860_100115312 Ga0068860_1001153122 242
272 3300005843 Ga0068860_100147446 Ga0068860_1001474462 242
273 3300005843 Ga0068860_100158482 Ga0068860_1001584822 242
274 3300005844 Ga0068862_100031354 Ga0068862_1000313542 242
275 3300005844 Ga0068862_100144529 Ga0068862_1001445292 242
276 3300005844 Ga0068862_100145317 Ga0068862_1001453173 242
277 3300006028 Ga0070717_10029680 Ga0070717_100296803 242
278 3300006051 Ga0075364_10181337 Ga0075364_101813372 242
279 3300006186 Ga0075369_10000833 Ga0075369_100008333 242
280 3300006186 Ga0075369_10038299 Ga0075369_100382992 242
281 3300006195 Ga0075366_10073931 Ga0075366_100739313 242
282 3300006237 Ga0097621_100231089 Ga0097621_1002310892 242
283 3300006358 Ga0068871_100004702 Ga0068871_1000047026 242
284 3300006358 Ga0068871_100032120 Ga0068871_1000321202 242
285 3300006881 Ga0068865_100535886 Ga0068865_1005358861 242
286 3300006931 Ga0097620_100001747 Ga0097620_1000017474 242
287 3300009093 Ga0105240_10080523 Ga0105240_100805232 242
288 3300009094 Ga0111539_10017990 Ga0111539_100179904 242
289 3300009101 Ga0105247_10107572 Ga0105247_101075722 242
290 3300009148 Ga0105243_10791060 Ga0105243_107910601 242
291 3300009177 Ga0105248_10111238 Ga0105248_101112383 242
292 3300009177 Ga0105248_10316026 Ga0105248_103160261 242
293 3300009177 Ga0105248_10387261 Ga0105248_103872612 242
294 3300009545 Ga0105237_10264731 Ga0105237_102647312 242
295 3300009553 Ga0105249_10108176 Ga0105249_101081762 242
296 3300009553 Ga0105249_10192611 Ga0105249_101926114 242
297 3300009553 Ga0105249_10277108 Ga0105249_102771082 242
298 3300009553 Ga0105249_10443358 Ga0105249_104433582 242
299 3300009553 Ga0105249_10793917 Ga0105249_107939172 242
300 3300013296 Ga0157374_10063917 Ga0157374_100639174 242
301 3300013296 Ga0157374_10102567 Ga0157374_101025672 242
302 3300013297 Ga0157378_10016847 Ga0157378_100168472 242
303 3300013306 Ga0163162_10014935 Ga0163162_100149354 242
304 3300013306 Ga0163162_10219098 Ga0163162_102190985 242
305 3300013308 Ga0157375_10004106 Ga0157375_1000410616 242
306 3300013308 Ga0157375_10011287 Ga0157375_100112872 242
307 3300013308 Ga0157375_10105221 Ga0157375_101052214 242
308 3300013308 Ga0157375_10138475 Ga0157375_101384753 242
309 3300013308 Ga0157375_10152956 Ga0157375_101529562 242
310 3300013308 Ga0157375_10180916 Ga0157375_101809162 242
311 3300013308 Ga0157375_11416751 Ga0157375_114167511 242
312 3300014968 Ga0157379_10002624 Ga0157379_100026246 242
313 3300014968 Ga0157379_10942414 Ga0157379_109424141 242
314 3300014969 Ga0157376_10038509 Ga0157376_100385095 242
315 3300014969 Ga0157376_10069703 Ga0157376_100697036 242
316 3300014969 Ga0157376_10289135 Ga0157376_102891352 242
317 3300014969 Ga0157376_10365782 Ga0157376_103657822 242
318 3300014969 Ga0157376_10658637 Ga0157376_106586372 242
319 3300017792 Ga0163161_10049193 Ga0163161_100491937 242
320 3300017792 Ga0163161_10117090 Ga0163161_101170903 242
321 3300017792 Ga0163161_10126069 Ga0163161_101260692 242
322 3300017792 Ga0163161_10244336 Ga0163161_102443362 242
323 3300017792 Ga0163161_10817916 Ga0163161_108179161 242
324 3300025315 Ga0207697_10014167 Ga0207697_100141672 242
325 3300025907 Ga0207645_10086099 Ga0207645_100860993 242
326 3300025907 Ga0207645_10178523 Ga0207645_101785232 242
327 3300025910 Ga0207684_10155772 Ga0207684_101557722 242
328 3300025917 Ga0207660_10042148 Ga0207660_100421484 242
329 3300025918 Ga0207662_10142365 Ga0207662_101423653 242
330 3300025922 Ga0207646_10333505 Ga0207646_103335052 242
331 3300025923 Ga0207681_10011126 Ga0207681_100111262 242
332 3300025923 Ga0207681_10014702 Ga0207681_100147026 242
333 3300025924 Ga0207694_10014747 Ga0207694_100147477 242
334 3300025925 Ga0207650_10016788 Ga0207650_100167883 242
335 3300025925 Ga0207650_10017344 Ga0207650_100173445 242
336 3300025925 Ga0207650_10023927 Ga0207650_100239273 242
337 3300025925 Ga0207650_10095306 Ga0207650_100953062 242
338 3300025926 Ga0207659_10010777 Ga0207659_100107773 242
339 3300025926 Ga0207659_10069050 Ga0207659_100690503 242
340 3300025928 Ga0207700_10000086 Ga0207700_100000867 242
341 3300025928 Ga0207700_10304540 Ga0207700_103045402 242
342 3300025931 Ga0207644_10165021 Ga0207644_101650212 242
343 3300025933 Ga0207706_10023984 Ga0207706_100239845 242
344 3300025933 Ga0207706_10136364 Ga0207706_101363642 242
345 3300025934 Ga0207686_10580369 Ga0207686_105803692 242
346 3300025935 Ga0207709_10025299 Ga0207709_100252992 242
347 3300025936 Ga0207670_10010745 Ga0207670_100107453 242
348 3300025937 Ga0207669_10003485 Ga0207669_100034859 242
349 3300025937 Ga0207669_10415108 Ga0207669_104151081 242
350 3300025938 Ga0207704_10242419 Ga0207704_102424192 242
351 3300025940 Ga0207691_10000509 Ga0207691_1000050926 242
352 3300025940 Ga0207691_10003508 Ga0207691_100035086 242
353 3300025940 Ga0207691_10033514 Ga0207691_100335145 242
354 3300025940 Ga0207691_10139309 Ga0207691_101393092 242
355 3300025941 Ga0207711_10081316 Ga0207711_100813162 242
356 3300025942 Ga0207689_10000174 Ga0207689_1000017450 242
357 3300025942 Ga0207689_10004337 Ga0207689_100043376 242
358 3300025942 Ga0207689_10421192 Ga0207689_104211921 242
359 3300025944 Ga0207661_10068898 Ga0207661_100688982 242
360 3300025945 Ga0207679_10206178 Ga0207679_102061783 242
361 3300025960 Ga0207651_10282497 Ga0207651_102824972 242
362 3300025961 Ga0207712_10313407 Ga0207712_103134072 242
363 3300025972 Ga0207668_10002470 Ga0207668_100024707 242
364 3300025972 Ga0207668_10016568 Ga0207668_100165682 242
365 3300025972 Ga0207668_10029303 Ga0207668_100293033 242
366 3300025972 Ga0207668_10100816 Ga0207668_101008163 242
367 3300025986 Ga0207658_10008875 Ga0207658_100088756 242
368 3300025986 Ga0207658_10034666 Ga0207658_100346664 242
369 3300025986 Ga0207658_10051891 Ga0207658_100518912 242
370 3300025986 Ga0207658_10082139 Ga0207658_100821393 242
371 3300025986 Ga0207658_10339222 Ga0207658_103392222 242
372 3300026035 Ga0207703_10193637 Ga0207703_101936373 242
373 3300026035 Ga0207703_10644804 Ga0207703_106448041 242
374 3300026041 Ga0207639_10000508 Ga0207639_1000050818 242
375 3300026041 Ga0207639_10090056 Ga0207639_100900562 242
376 3300026067 Ga0207678_10006420 Ga0207678_100064208 242
377 3300026075 Ga0207708_10006963 Ga0207708_100069635 242
378 3300026075 Ga0207708_10080620 Ga0207708_100806202 242
379 3300026075 Ga0207708_10202874 Ga0207708_102028742 242
380 3300026088 Ga0207641_10014012 Ga0207641_100140126 242
381 3300026088 Ga0207641_10027403 Ga0207641_100274032 242
382 3300026088 Ga0207641_10057332 Ga0207641_100573322 242
383 3300026088 Ga0207641_10165395 Ga0207641_101653951 242
384 3300026089 Ga0207648_10001922 Ga0207648_1000192218 242
385 3300026089 Ga0207648_10189296 Ga0207648_101892963 242
386 3300026089 Ga0207648_10220267 Ga0207648_102202672 242
387 3300026089 Ga0207648_10334797 Ga0207648_103347972 242
388 3300026095 Ga0207676_10010076 Ga0207676_100100767 242
389 3300026095 Ga0207676_10013354 Ga0207676_100133544 242
390 3300026095 Ga0207676_10034639 Ga0207676_100346393 242
391 3300026116 Ga0207674_10041103 Ga0207674_100411035 242
392 3300026116 Ga0207674_10581134 Ga0207674_105811342 242
393 3300026118 Ga0207675_100000847 Ga0207675_10000084728 242
394 3300026118 Ga0207675_100021000 Ga0207675_1000210003 242
395 3300026118 Ga0207675_100033377 Ga0207675_1000333775 242
396 3300026118 Ga0207675_100058168 Ga0207675_1000581683 242
397 3300026121 Ga0207683_10000020 Ga0207683_1000002072 242
398 3300026121 Ga0207683_10029090 Ga0207683_100290903 242
399 3300026121 Ga0207683_10137516 Ga0207683_101375163 242
400 3300026142 Ga0207698_10007168 Ga0207698_100071684 242
401 3300027907 Ga0207428_10371703 Ga0207428_103717032 242
402 3300028379 Ga0268266_10063383 Ga0268266_100633838 242
403 3300028379 Ga0268266_10173632 Ga0268266_101736322 242
404 3300028379 Ga0268266_10335395 Ga0268266_103353952 242
405 3300028379 Ga0268266_10388485 Ga0268266_103884852 242
406 3300028380 Ga0268265_10028173 Ga0268265_100281733 242
407 3300028380 Ga0268265_10030373 Ga0268265_100303733 242
408 3300028380 Ga0268265_10134089 Ga0268265_101340891 242
409 3300028380 Ga0268265_10631954 Ga0268265_106319541 242
410 3300028381 Ga0268264_10002310 Ga0268264_100023105 242
411 3300028381 Ga0268264_10152755 Ga0268264_101527552 242
412 3300028381 Ga0268264_10254749 Ga0268264_102547492 242
413 3300028381 Ga0268264_10338371 Ga0268264_103383712 242
414 3300028381 Ga0268264_10388798 Ga0268264_103887981 242
415 3300028563 Ga0265319_1047676 Ga0265319_10476762 242
416 3300028577 Ga0265318_10000108 Ga0265318_1000010871 242
417 3300028577 Ga0265318_10000878 Ga0265318_1000087812 242
418 3300028666 Ga0265336_10002346 Ga0265336_100023464 242
419 3300028800 Ga0265338_10192985 Ga0265338_101929852 242
420 3300031235 Ga0265330_10000201 Ga0265330_1000020138 242
421 3300031235 Ga0265330_10002606 Ga0265330_100026066 242
422 3300031238 Ga0265332_10000447 Ga0265332_100004475 242
423 3300031238 Ga0265332_10002933 Ga0265332_100029335 242
424 3300031239 Ga0265328_10000254 Ga0265328_100002545 242
425 3300031239 Ga0265328_10001319 Ga0265328_100013195 242
426 3300031240 Ga0265320_10000085 Ga0265320_100000855 242
427 3300031240 Ga0265320_10002076 Ga0265320_100020764 242
428 3300031240 Ga0265320_10011178 Ga0265320_100111782 242
429 3300031240 Ga0265320_10061572 Ga0265320_100615722 242
430 3300031241 Ga0265325_10031821 Ga0265325_100318212 242
431 3300031242 Ga0265329_10005103 Ga0265329_100051034 242
432 3300031249 Ga0265339_10008026 Ga0265339_100080262 242
433 3300031249 Ga0265339_10084862 Ga0265339_100848622 242
434 3300031250 Ga0265331_10000179 Ga0265331_100001795 242
435 3300031250 Ga0265331_10000762 Ga0265331_1000076215 242
436 3300031344 Ga0265316_10003342 Ga0265316_1000334213 242
437 3300031344 Ga0265316_10003383 Ga0265316_100033832 242
438 3300031595 Ga0265313_10000103 Ga0265313_100001036 242
439 3300031595 Ga0265313_10017259 Ga0265313_100172593 242
440 3300031595 Ga0265313_10018126 Ga0265313_100181265 242
441 3300031711 Ga0265314_10000235 Ga0265314_100002355 242
442 3300031711 Ga0265314_10017420 Ga0265314_100174204 242
443 3300031712 Ga0265342_10000463 Ga0265342_1000046311 242
444 3300031712 Ga0265342_10003566 Ga0265342_100035667 242
445 3300031712 Ga0265342_10009235 Ga0265342_100092352 242
446 3300031712 Ga0265342_10086579 Ga0265342_100865791 242
447 3300035116 Ga0373945_0154736 Ga0373945_0154736_97_873 242
448 3300035119 Ga0373956_0191930 Ga0373956_0191930_44_796 242
449 3300035170 Ga0373943_0262802 Ga0373943_0262802_223_957 242
450 3300035691 Ga0373931_0186196 Ga0373931_0186196_298_1026 242
451 3300035691 Ga0373931_0189163 Ga0373931_0189163_84_812 242
452 3300035692 Ga0373935_0024014 Ga0373935_0024014_580_1356 242
453 3300035695 Ga0373927_0013717 Ga0373927_0013717_2075_2851 242
454 3300035724 Ga0373933_0326290 Ga0373933_0326290_30_758 242
455 3300035725 Ga0373947_0011346 Ga0373947_0011346_2881_3657 242
456 3300036401 Ga0373937_0395001 Ga0373937_0395001_328_1056 242
457 3300037068 Ga0373925_0023031 Ga0373925_0023031_2426_3202 242
458 3300041451 Ga0451791_1069114 Ga0451791_1069114_126_854 242
459 3300041509 Ga0451843_1081050 Ga0451843_1081050_16_744 242
460 3300046472 Ga0495580_0123890 Ga0495580_0123890_749_1477 242
461 3300046683 Ga0495658_0178633 Ga0495658_0178633_21_749 242
462 3300046683 Ga0495658_0246490 Ga0495658_0246490_87_815 242
463 3300048910 Ga0496107_0501879 Ga0496107_0501879_105_839 242
464 3300048911 Ga0496108_0279919 Ga0496108_0279919_359_1087 242
465 3300048912 Ga0496109_0573604 Ga0496109_0573604_289_1017 242
466 3300049585 Ga0501069_0153713 Ga0501069_0153713_13_747 242
467 3300049744 Ga0501083_0002000 Ga0501083_0002000_512_1246 242
468 3300050491 nmdc:mga00v17_239889_c1 nmdc:mga00v17_239889_c1_110_862 242
469 3300050493 nmdc:mga0k408_50155_c1 nmdc:mga0k408_50155_c1_1560_2312 242
470 3300050509 nmdc:mga0qj67_361777_c1 nmdc:mga0qj67_361777_c1_28_804 242
471 3300050511 nmdc:mga08y16_61528_c1 nmdc:mga08y16_61528_c1_917_1645 242
472 3300053096 Ga0500641_0014674 Ga0500641_0014674_373_1101 242
473 3300053146 Ga0500588_0119327 Ga0500588_0119327_146_874 242
474 3300060353 Ga0501082_0042165 Ga0501082_0042165_2240_2974 242
475 3300005340 Ga0070689_100127231 Ga0070689_1001272313 246
476 3300009094 Ga0111539_10176415 Ga0111539_101764152 246
477 3300050511 nmdc:mga08y16_210431_c1 nmdc:mga08y16_210431_c1_119_1003 246
478 3300042008 Ga0439450_023743 Ga0439450_023743_224_1021 247
479 3300048916 Ga0496113_0023631 Ga0496113_0023631_3231_3974 247
480 3300048926 Ga0496123_0063787 Ga0496123_0063787_1586_2329 247
481 3300048929 Ga0496126_0017258 Ga0496126_0017258_3110_3853 247
482 3300003792 Ga0055540_1000231 Ga0055540_100023132 248
483 3300005333 Ga0070677_10000382 Ga0070677_1000038217 248
484 3300005335 Ga0070666_10000758 Ga0070666_100007589 248
485 3300005335 Ga0070666_10058312 Ga0070666_100583124 248
486 3300005338 Ga0068868_100013034 Ga0068868_1000130346 248
487 3300005347 Ga0070668_100003834 Ga0070668_1000038347 248
488 3300005354 Ga0070675_100001023 Ga0070675_10000102326 248
489 3300005355 Ga0070671_100010891 Ga0070671_1000108915 248
490 3300005356 Ga0070674_100000094 Ga0070674_10000009443 248
491 3300005356 Ga0070674_100008211 Ga0070674_1000082114 248
492 3300005364 Ga0070673_100000753 Ga0070673_10000075313 248
493 3300005367 Ga0070667_100001746 Ga0070667_10000174621 248
494 3300005367 Ga0070667_100006402 Ga0070667_1000064024 248
495 3300005367 Ga0070667_100044461 Ga0070667_1000444614 248
496 3300005459 Ga0068867_100008769 Ga0068867_1000087693 248
497 3300005466 Ga0070685_10050616 Ga0070685_100506162 248
498 3300005539 Ga0068853_100005616 Ga0068853_1000056162 248
499 3300005543 Ga0070672_100000552 Ga0070672_10000055210 248
500 3300005543 Ga0070672_100166921 Ga0070672_1001669212 248
501 3300005548 Ga0070665_100002419 Ga0070665_10000241921 248
502 3300005548 Ga0070665_100020178 Ga0070665_1000201786 248
503 3300005834 Ga0068851_10000941 Ga0068851_1000094117 248
504 3300005840 Ga0068870_10042210 Ga0068870_100422103 248
505 3300005841 Ga0068863_100022879 Ga0068863_1000228798 248
506 3300005842 Ga0068858_100058894 Ga0068858_1000588943 248
507 3300005843 Ga0068860_100025029 Ga0068860_1000250299 248
508 3300006237 Ga0097621_100018068 Ga0097621_1000180684 248
509 3300009101 Ga0105247_10160628 Ga0105247_101606282 248
510 3300013296 Ga0157374_10284991 Ga0157374_102849912 248
511 3300013297 Ga0157378_10275785 Ga0157378_102757852 248
512 3300013306 Ga0163162_10216437 Ga0163162_102164373 248
513 3300025303 Ga0209051_1000048 Ga0209051_1000048205 248
514 3300025321 Ga0207656_10003408 Ga0207656_100034086 248
515 3300025893 Ga0207682_10002512 Ga0207682_100025128 248
516 3300025899 Ga0207642_10095909 Ga0207642_100959091 248
517 3300025903 Ga0207680_10041527 Ga0207680_100415274 248
518 3300025907 Ga0207645_10004706 Ga0207645_1000470610 248
519 3300025907 Ga0207645_10262855 Ga0207645_102628552 248
520 3300025908 Ga0207643_10041542 Ga0207643_100415423 248
521 3300025926 Ga0207659_10016864 Ga0207659_100168646 248
522 3300025931 Ga0207644_10001344 Ga0207644_100013449 248
523 3300025931 Ga0207644_10163159 Ga0207644_101631591 248
524 3300025937 Ga0207669_10008259 Ga0207669_100082595 248
525 3300025940 Ga0207691_10000018 Ga0207691_10000018128 248
526 3300025941 Ga0207711_10073235 Ga0207711_100732354 248
527 3300025960 Ga0207651_10002176 Ga0207651_100021768 248
528 3300025972 Ga0207668_10002010 Ga0207668_100020106 248
529 3300025986 Ga0207658_10013016 Ga0207658_100130167 248
530 3300025986 Ga0207658_10016070 Ga0207658_100160704 248
531 3300026023 Ga0207677_10003221 Ga0207677_100032216 248
532 3300026041 Ga0207639_10009051 Ga0207639_100090519 248
533 3300026089 Ga0207648_10015731 Ga0207648_100157317 248
534 3300026121 Ga0207683_10002464 Ga0207683_100024649 248
535 3300028379 Ga0268266_10013368 Ga0268266_100133687 248
536 3300028381 Ga0268264_10229254 Ga0268264_102292543 248
537 3300028800 Ga0265338_10004756 Ga0265338_1000475615 248
538 3300031239 Ga0265328_10002130 Ga0265328_100021306 248
539 3300031240 Ga0265320_10001256 Ga0265320_1000125615 248
540 3300031249 Ga0265339_10003541 Ga0265339_100035419 248
541 3300031711 Ga0265314_10031242 Ga0265314_100312423 248
542 3300031712 Ga0265342_10001967 Ga0265342_100019673 248
543 3300042005 Ga0439448_0008586 Ga0439448_0008586_688_1434 248
544 3300048903 Ga0496100_0000133 Ga0496100_0000133_11486_12232 248
545 3300048904 Ga0496101_0000661 Ga0496101_0000661_11283_12029 248
546 3300048905 Ga0496102_0205966 Ga0496102_0205966_496_1242 248
547 3300048906 Ga0496103_0012076 Ga0496103_0012076_918_1664 248
548 3300048909 Ga0496106_0000992 Ga0496106_0000992_8790_9536 248
549 3300048912 Ga0496109_0000529 Ga0496109_0000529_20340_21086 248
550 3300048913 Ga0496110_0013633 Ga0496110_0013633_384_1130 248
551 3300048913 Ga0496110_0141582 Ga0496110_0141582_647_1393 248
552 3300048914 Ga0496111_0006650 Ga0496111_0006650_4361_5107 248
553 3300048917 Ga0496114_0001244 Ga0496114_0001244_12964_13710 248
554 3300048919 Ga0496116_0031538 Ga0496116_0031538_2663_3409 248
555 3300048920 Ga0496117_0000752 Ga0496117_0000752_50155_50901 248
556 3300048921 Ga0496118_0038785 Ga0496118_0038785_520_1266 248
557 3300048922 Ga0496119_0014870 Ga0496119_0014870_448_1194 248
558 3300048924 Ga0496121_0000027 Ga0496121_0000027_11288_12034 248
559 3300048925 Ga0496122_0000611 Ga0496122_0000611_11288_12034 248
560 3300048926 Ga0496123_0003205 Ga0496123_0003205_9266_10012 248
561 3300048927 Ga0496124_0000016 Ga0496124_0000016_11288_12034 248
562 3300048928 Ga0496125_0000008 Ga0496125_0000008_11288_12034 248
563 3300048929 Ga0496126_0000025 Ga0496126_0000025_11288_12034 248

Structural Annotation

Top 5 Hits

ID Description Score Start End
5loy-assembly2.cif.gz_D helical assembly of a designed anbu protein 0.9732 9 248
5nyw-assembly2.cif.gz_1 anbu (ancestral beta-subunit) from yersinia bercovieri 0.9725 9 247
5nyw-assembly2.cif.gz_O anbu (ancestral beta-subunit) from yersinia bercovieri 0.9707 9 247
5nyw-assembly2.cif.gz_W anbu (ancestral beta-subunit) from yersinia bercovieri 0.9699 9 248
5nyw-assembly1.cif.gz_M anbu (ancestral beta-subunit) from yersinia bercovieri 0.9697 9 247
ID Description Score Start End Superfamily
af_Q8T915_50_270_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8297 9 219 3.60.20.10
af_A4HV47_25_244_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8244 8 217 3.60.20.10
6qm8X00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8233 4 219 3.60.20.10
5lexN00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8137 9 223 3.60.20.10
af_Q966I8_19_219_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8111 6 219 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A356VN81-F1-model_v4 deleted 0.9861 120 199
AF-A0A352KM52-F1-model_v4 Peptidase 0.9811 122 248
AF-A0A833LSZ3-F1-model_v4 Proteasome-type protease 0.9789 8 248 GO:0005839
GO:0008233
GO:0051603
AF-M3AC61-F1-model_v4 Proteasome-type protease 0.9769 8 248 GO:0005839
GO:0008233
GO:0051603
AF-A0A7C9GSW5-F1-model_v4 Peptidase 0.9766 8 248 GO:0005839
GO:0051603

Feature Viewer

pLDDT pTM Quality
89 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map