F463920

General Info

Members Datasets Scaffolds Average Seq Length
562 343 1124 340

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10028633|Ga0075433_100286334
Length 341
Sequence MKRAIFTLGLSTVGLAIGFGLSVAPATAQTLKAVKDRGSLICGVSQGLPGFSNPDDKGNWTGLDVDYCRAIAAAIFNDPTKVKFSPLSTKDRFEALKAGEIDVLSRNSTWTLSRDATYNFIGVNYYDGQGFMVRKALKVNSALELNGASICVQTGTTTELNLGDYFRSNSMRYEVIAFATADETIKAYEGGRCDVFTTDVSQLYSEKLKLAKADDHVILPEIISKEPLGPMVRHGDDQWFDLVKWVHFAMINAEELGVNSKNVDEALKSNMPEIKRLVGTEGNFGEQLGLTKDWAVRIVKHVGNYGEVFERNVGSGSRLGISRGINRLWTKGGIQYAPPIR

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
158 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
282 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
283 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
284 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
285 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
291 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
294 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
295 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
296 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
297 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
299 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
303 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
304 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
305 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
306 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
307 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
308 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
309 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
310 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
311 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
312 2791355199
313 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
314 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
315 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
316 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
317 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
318 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
319 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
320 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
321 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
322 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
323 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
324 2904699407
325 2906610324
326 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
327 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
328 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
329 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
330 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
331 2922425934
332 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
333 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
334 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
335 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
336 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
337 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
338 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
339 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
340 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
341 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
342 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
343 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 0
Isolates 6.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.3
Nodule 4.09
Rhizoplane 6.41
Rhizosphere 75.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10028633 3300006852 Bacteria 4738
2 JGI24739J22299_10002185 3300001989 Bacteria 7510
3 JGI24737J22298_10018513 3300001990 Bacteria 2235
4 JGI24735J21928_10012353 3300002067 Bacteria 2700
5 JGI25153J46596_10000763 3300003215 Bacteria 19685
6 Ga0065707_10179269 3300005295 Bacteria 1429
7 Ga0070683_100313144 3300005329 Bacteria 1494
8 Ga0070690_100048613 3300005330 Bacteria 2702
9 Ga0070670_100139722 3300005331 Bacteria 2094
10 Ga0070670_100183668 3300005331 Bacteria 1816
11 Ga0070687_100007673 3300005343 Bacteria 4517
12 Ga0070668_100045218 3300005347 Bacteria 3378
13 Ga0070668_100380829 3300005347 Bacteria 1200
14 Ga0070669_100144072 3300005353 Bacteria 1839
15 Ga0070675_100329870 3300005354 Bacteria 1349
16 Ga0070671_100026550 3300005355 Bacteria 4760
17 Ga0070671_100081136 3300005355 Bacteria 2712
18 Ga0070674_100266729 3300005356 Bacteria 1351
19 Ga0070673_100043311 3300005364 Bacteria 3477
20 Ga0070673_100154298 3300005364 Bacteria 1947
21 Ga0070667_100159720 3300005367 Bacteria 1984
22 Ga0070709_10115024 3300005434 Bacteria 1814
23 Ga0070714_100024854 3300005435 Bacteria 4937
24 Ga0070710_10009867 3300005437 Bacteria 4680
25 Ga0070710_10244117 3300005437 Bacteria 1152
26 Ga0070711_100123036 3300005439 Bacteria 1922
27 Ga0070711_100195742 3300005439 Bacteria 1556
28 Ga0070700_100175140 3300005441 Bacteria 1488
29 Ga0070663_100128250 3300005455 Bacteria 1923
30 Ga0070662_100265284 3300005457 Bacteria 1385
31 Ga0070685_10128471 3300005466 Bacteria 1582
32 Ga0070707_100014160 3300005468 Bacteria 7475
33 Ga0070679_100183868 3300005530 Bacteria 2062
34 Ga0068853_100126574 3300005539 Bacteria 2282
35 Ga0068853_100196832 3300005539 Bacteria 1833
36 Ga0068853_100286604 3300005539 Bacteria 1519
37 Ga0070665_100064764 3300005548 Bacteria 3666
38 Ga0070665_100243613 3300005548 Bacteria 1798
39 Ga0070704_100017657 3300005549 Bacteria 4543
40 Ga0068855_100265983 3300005563 Bacteria 1909
41 Ga0068855_100299454 3300005563 Bacteria 1781
42 Ga0068857_100055485 3300005577 Bacteria 3516
43 Ga0068854_100059212 3300005578 Bacteria 2767
44 Ga0068856_100000759 3300005614 Bacteria 35015
45 Ga0068856_100039826 3300005614 Bacteria 4614
46 Ga0068856_100041953 3300005614 Bacteria 4499
47 Ga0068852_100012482 3300005616 Bacteria 6454
48 Ga0068852_100049474 3300005616 Bacteria 3596
49 Ga0068852_100383289 3300005616 Bacteria 1379
50 Ga0068859_100068557 3300005617 Bacteria 3582
51 Ga0068864_100131465 3300005618 Bacteria 2249
52 Ga0068858_100224841 3300005842 Bacteria 1778
53 Ga0068860_100095673 3300005843 Bacteria 2831
54 Ga0068860_100580083 3300005843 Bacteria 1125
55 Ga0068862_100116411 3300005844 Bacteria 2351
56 Ga0081455_10002892 3300005937 Bacteria 20170
57 Ga0081538_10014965 3300005981 Bacteria 6038
58 Ga0081540_1004448 3300005983 Bacteria 10683
59 Ga0081540_1063644 3300005983 Bacteria 1745
60 Ga0081540_1074449 3300005983 Bacteria 1556
61 Ga0081539_10000048 3300005985 Bacteria 272906
62 Ga0081539_10027760 3300005985 Bacteria 3577
63 Ga0081539_10065568 3300005985 Bacteria 1971
64 Ga0070717_10018331 3300006028 Bacteria 5462
65 Ga0070717_10227741 3300006028 Bacteria 1640
66 Ga0075368_10031068 3300006042 Bacteria 2070
67 Ga0075366_10009772 3300006195 Bacteria 5363
68 Ga0075366_10023330 3300006195 Bacteria 3604
69 Ga0097621_100207118 3300006237 Bacteria 1705
70 Ga0075370_10181673 3300006353 Bacteria 1238
71 Ga0075428_100002806 3300006844 Bacteria 18965
72 Ga0075431_100001644 3300006847 Bacteria 20930
73 Ga0075429_100005530 3300006880 Bacteria 10884
74 Ga0097620_100068557 3300006931 Bacteria 3582
75 Ga0075435_100325142 3300007076 Bacteria 1316
76 Ga0099794_10002401 3300007265 Bacteria 6900
77 Ga0099795_10002148 3300007788 Bacteria 4549
78 Ga0105240_10019187 3300009093 Bacteria 9140
79 Ga0105240_10464085 3300009093 Bacteria 1414
80 Ga0111539_10024349 3300009094 Bacteria 7430
81 Ga0111539_10034305 3300009094 Bacteria 6155
82 Ga0114129_10003726 3300009147 Bacteria 21494
83 Ga0114129_10007650 3300009147 Bacteria 15381
84 Ga0114129_10377972 3300009147 Bacteria 1871
85 Ga0105241_10031752 3300009174 Bacteria 3955
86 Ga0105241_10059776 3300009174 Bacteria 2931
87 Ga0105242_10317865 3300009176 Bacteria 1427
88 Ga0105248_10127975 3300009177 Bacteria 2865
89 Ga0105248_10158818 3300009177 Bacteria 2551
90 Ga0105248_10348374 3300009177 Bacteria 1667
91 Ga0099796_10028030 3300010159 Bacteria 1804
92 Ga0105239_10012188 3300010375 Bacteria 9584
93 Ga0157369_10014318 3300013105 Bacteria 8958
94 Ga0171462_1050 3300013250 Bacteria 40440
95 Ga0157372_10415812 3300013307 Bacteria 1567
96 Ga0163163_10219932 3300014325 Bacteria 1948
97 Ga0157380_10039851 3300014326 Bacteria 3655
98 Ga0228598_1001760 3300024227 Bacteria 4741
99 Ga0209758_1000088 3300025297 Bacteria 251547
100 Ga0209758_1000190 3300025297 Bacteria 137882
101 Ga0209758_1002991 3300025297 Bacteria 16204
102 Ga0207656_10014111 3300025321 Bacteria 3070
103 Ga0207710_10033562 3300025900 Bacteria 2251
104 Ga0207710_10069837 3300025900 Bacteria 1609
105 Ga0207680_10011816 3300025903 Bacteria 4426
106 Ga0207647_10000455 3300025904 Bacteria 33311
107 Ga0207647_10072183 3300025904 Bacteria 2082
108 Ga0207699_10148842 3300025906 Bacteria 1547
109 Ga0207643_10043166 3300025908 Bacteria 2544
110 Ga0207705_10306152 3300025909 Bacteria 1219
111 Ga0207654_10002203 3300025911 Bacteria 9986
112 Ga0207695_10004560 3300025913 Bacteria 18834
113 Ga0207695_10051749 3300025913 Bacteria 4309
114 Ga0207695_10116220 3300025913 Bacteria 2649
115 Ga0207671_10120343 3300025914 Bacteria 2007
116 Ga0207671_10176556 3300025914 Bacteria 1661
117 Ga0207693_10005300 3300025915 Bacteria 10776
118 Ga0207693_10044418 3300025915 Bacteria 3492
119 Ga0207693_10081308 3300025915 Bacteria 2536
120 Ga0207693_10140366 3300025915 Bacteria 1900
121 Ga0207662_10007387 3300025918 Bacteria 5982
122 Ga0207662_10284563 3300025918 Bacteria 1095
123 Ga0207657_10328622 3300025919 Bacteria 1208
124 Ga0207646_10029707 3300025922 Bacteria 4964
125 Ga0207694_10000376 3300025924 Bacteria 41494
126 Ga0207650_10088930 3300025925 Bacteria 2356
127 Ga0207659_10031022 3300025926 Bacteria 3655
128 Ga0207664_10075034 3300025929 Bacteria 2733
129 Ga0207664_10148493 3300025929 Bacteria 1989
130 Ga0207690_10023900 3300025932 Bacteria 3821
131 Ga0207706_10028917 3300025933 Bacteria 4947
132 Ga0207706_10035121 3300025933 Bacteria 4459
133 Ga0207686_10090644 3300025934 Bacteria 2018
134 Ga0207709_10180684 3300025935 Bacteria 1490
135 Ga0207670_10176980 3300025936 Bacteria 1604
136 Ga0207669_10029668 3300025937 Bacteria 3028
137 Ga0207665_10027608 3300025939 Bacteria 3749
138 Ga0207665_10221596 3300025939 Bacteria 1386
139 Ga0207691_10254109 3300025940 Bacteria 1516
140 Ga0207711_10027104 3300025941 Bacteria 4811
141 Ga0207711_10086639 3300025941 Bacteria 2747
142 Ga0207711_10140272 3300025941 Bacteria 2174
143 Ga0207711_10298771 3300025941 Bacteria 1485
144 Ga0207667_10012109 3300025949 Bacteria 9967
145 Ga0207667_10104098 3300025949 Bacteria 2927
146 Ga0207667_10537118 3300025949 Bacteria 1183
147 Ga0207651_10045869 3300025960 Bacteria 2934
148 Ga0207712_10096743 3300025961 Bacteria 2186
149 Ga0207640_10086799 3300025981 Bacteria 2155
150 Ga0207658_10223254 3300025986 Bacteria 1586
151 Ga0207677_10015669 3300026023 Bacteria 4468
152 Ga0207703_10008930 3300026035 Bacteria 7894
153 Ga0207639_10041887 3300026041 Bacteria 3430
154 Ga0207639_10240205 3300026041 Bacteria 1574
155 Ga0207678_10051204 3300026067 Bacteria 3565
156 Ga0207678_10054618 3300026067 Bacteria 3440
157 Ga0207702_10000355 3300026078 Bacteria 52521
158 Ga0207702_10000539 3300026078 Bacteria 42329
159 Ga0207702_10005850 3300026078 Bacteria 10696
160 Ga0207702_10149157 3300026078 Bacteria 2125
161 Ga0207702_10194092 3300026078 Bacteria 1878
162 Ga0207676_10073341 3300026095 Bacteria 2754
163 Ga0207676_10109612 3300026095 Bacteria 2307
164 Ga0207698_10026396 3300026142 Bacteria 4108
165 Ga0209588_1013228 3300027671 Bacteria 2516
166 Ga0207428_10006451 3300027907 Bacteria 10834
167 Ga0207428_10076404 3300027907 Bacteria 2622
168 Ga0268266_10090051 3300028379 Bacteria 2688
169 Ga0268266_10091057 3300028379 Bacteria 2674
170 Ga0268266_10092626 3300028379 Bacteria 2652
171 Ga0268265_10094815 3300028380 Bacteria 2394
172 Ga0268264_10000049 3300028381 Bacteria 329992
173 Ga0268264_10073082 3300028381 Bacteria 2909
174 Ga0268264_10226746 3300028381 Bacteria 1723
175 Ga0307517_10000766 3300028786 Bacteria 55210
176 Ga0307515_10129915 3300028794 Bacteria 2783
177 Ga0265338_10009524 3300028800 Bacteria 11568
178 Ga0265330_10026025 3300031235 Bacteria 2650
179 Ga0265332_10059906 3300031238 Bacteria 1629
180 Ga0265325_10007415 3300031241 Bacteria 6567
181 Ga0265325_10008069 3300031241 Bacteria 6242
182 Ga0265340_10009912 3300031247 Bacteria 5106
183 Ga0265339_10000286 3300031249 Bacteria 40859
184 Ga0265316_10246601 3300031344 Bacteria 1312
185 Ga0307509_10044224 3300031507 Bacteria 4813
186 Ga0265313_10000450 3300031595 Bacteria 43434
187 Ga0265314_10079204 3300031711 Bacteria 2173
188 Ga0307516_10008547 3300031730 Bacteria 11560
189 Ga0307516_10035632 3300031730 Bacteria 4989
190 Ga0307516_10071291 3300031730 Bacteria 3336
191 Ga0307413_10101821 3300031824 Bacteria 1900
192 Ga0307409_100131084 3300031995 Bacteria 2142
193 Ga0307416_100058649 3300032002 Bacteria 3123
194 Ga0307510_10037963 3300033180 Bacteria 5333
195 Ga0373926_0009096 3300035083 Bacteria 3315
196 Ga0373926_0016584 3300035083 Bacteria 2522
197 Ga0373928_0020134 3300035084 Bacteria 1397
198 Ga0373928_0044705 3300035084 Bacteria 1029
199 Ga0373934_0030116 3300035086 Bacteria 2122
200 Ga0373944_0001705 3300035089 Bacteria 5562
201 Ga0373936_0113197 3300035113 Bacteria 1154
202 Ga0373954_0015476 3300035118 Bacteria 3410
203 Ga0373956_0004169 3300035119 Bacteria 5797
204 Ga0373956_0013277 3300035119 Bacteria 3425
205 Ga0373957_0017895 3300035120 Bacteria 2475
206 Ga0373943_0007878 3300035170 Bacteria 4781
207 Ga0373943_0069485 3300035170 Bacteria 1780
208 Ga0373943_0111345 3300035170 Bacteria 1444
209 Ga0373946_0000317 3300035171 Bacteria 15643
210 Ga0373955_0000862 3300035172 Bacteria 12983
211 Ga0373955_0003395 3300035172 Bacteria 6997
212 Ga0373955_0029117 3300035172 Bacteria 2869
213 Ga0373955_0084540 3300035172 Bacteria 1799
214 Ga0373924_0017310 3300035410 Bacteria 2763
215 Ga0373924_0021649 3300035410 Bacteria 2508
216 Ga0373924_0114425 3300035410 Bacteria 1168
217 Ga0373931_0062706 3300035691 Bacteria 2007
218 Ga0373935_0007859 3300035692 Bacteria 6398
219 Ga0373935_0011452 3300035692 Bacteria 5325
220 Ga0373935_0089998 3300035692 Bacteria 2008
221 Ga0373935_0154421 3300035692 Bacteria 1560
222 Ga0373927_0001762 3300035695 Bacteria 16152
223 Ga0373927_0008229 3300035695 Bacteria 7021
224 Ga0373927_0031444 3300035695 Bacteria 3459
225 Ga0373927_0105739 3300035695 Bacteria 1833
226 Ga0373933_0000911 3300035724 Bacteria 18062
227 Ga0373947_0001044 3300035725 Bacteria 16908
228 Ga0373947_0001344 3300035725 Bacteria 15110
229 Ga0373947_0032091 3300035725 Bacteria 3094
230 Ga0373947_0058725 3300035725 Bacteria 2331
231 Ga0373937_0002053 3300036401 Bacteria 16833
232 Ga0373937_0006177 3300036401 Bacteria 10315
233 Ga0373937_0007628 3300036401 Bacteria 9373
234 Ga0373937_0010534 3300036401 Bacteria 8073
235 Ga0373937_0040612 3300036401 Bacteria 4240
236 Ga0373937_0094530 3300036401 Bacteria 2772
237 Ga0373925_0008529 3300037068 Bacteria 7469
238 Ga0373925_0010949 3300037068 Bacteria 6583
239 Ga0373925_0036021 3300037068 Bacteria 3653
240 Ga0373925_0067673 3300037068 Bacteria 2694
241 Ga0395900_0018087 3300037418 Bacteria 7192
242 Ga0395898_0026861 3300037466 Bacteria 5785
243 Ga0436365_1184860 3300039437 Bacteria 2340
244 Ga0436361_0624205 3300039447 Bacteria 2200
245 Ga0436362_0648852 3300039453 Bacteria 2604
246 Ga0439456_029260 3300042013 Bacteria 1176
247 Ga0439459_0003390 3300042438 Bacteria 2525
248 Ga0466963_0067877 3300044694 Bacteria 2394
249 Ga0453684_0340552 3300044712 Bacteria 1693
250 Ga0466957_0041409 3300044842 Bacteria 2786
251 Ga0466957_0075753 3300044842 Bacteria 2088
252 Ga0466959_0035242 3300045049 Bacteria 3703
253 Ga0466958_0030831 3300045836 Bacteria 3187
254 Ga0466967_0481538 3300045976 Bacteria 1216
255 Ga0495592_0002960 3300046454 Bacteria 12091
256 Ga0495592_0053110 3300046454 Bacteria 3006
257 Ga0495603_0011862 3300046455 Bacteria 5274
258 Ga0495603_0037589 3300046455 Bacteria 2905
259 Ga0495629_0001814 3300046459 Bacteria 16736
260 Ga0495629_0141829 3300046459 Bacteria 1672
261 Ga0495638_0024809 3300046460 Bacteria 3903
262 Ga0495641_0050219 3300046461 Bacteria 1907
263 Ga0495651_0025537 3300046462 Bacteria 4599
264 Ga0495651_0099732 3300046462 Bacteria 2165
265 Ga0495653_0028306 3300046463 Bacteria 4481
266 Ga0495653_0028334 3300046463 Bacteria 4478
267 Ga0495580_0012156 3300046472 Bacteria 6620
268 Ga0495639_0019296 3300046475 Bacteria 2975
269 Ga0495639_0088154 3300046475 Bacteria 1453
270 Ga0495662_0001401 3300046476 Bacteria 11959
271 Ga0495662_0039764 3300046476 Bacteria 2272
272 Ga0495664_0003909 3300046477 Bacteria 8131
273 Ga0495664_0044959 3300046477 Bacteria 2618
274 Ga0495664_0052384 3300046477 Bacteria 2425
275 Ga0495584_0067728 3300046491 Bacteria 1794
276 Ga0495585_0060859 3300046492 Bacteria 2077
277 Ga0495594_0042601 3300046499 Bacteria 2486
278 Ga0495607_0066028 3300046501 Bacteria 2037
279 Ga0495608_0005129 3300046511 Bacteria 9360
280 Ga0495608_0013134 3300046511 Bacteria 5748
281 Ga0495618_0002499 3300046514 Bacteria 11798
282 Ga0495618_0002683 3300046514 Bacteria 11336
283 Ga0495618_0021029 3300046514 Bacteria 4020
284 Ga0495628_0051633 3300046516 Bacteria 3250
285 Ga0495628_0065814 3300046516 Bacteria 2834
286 Ga0495628_0134842 3300046516 Bacteria 1887
287 Ga0495630_0003957 3300046517 Bacteria 10354
288 Ga0495630_0091990 3300046517 Bacteria 2292
289 Ga0495630_0186387 3300046517 Bacteria 1583
290 Ga0495631_0042239 3300046518 Bacteria 2015
291 Ga0495631_0052978 3300046518 Bacteria 1771
292 Ga0495652_0011336 3300046529 Bacteria 8064
293 Ga0495652_0054711 3300046529 Bacteria 3397
294 Ga0495652_0080849 3300046529 Bacteria 2682
295 Ga0495652_0093349 3300046529 Bacteria 2457
296 Ga0495640_0002191 3300046533 Bacteria 15620
297 Ga0495640_0005056 3300046533 Bacteria 10469
298 Ga0495640_0019415 3300046533 Bacteria 5016
299 Ga0495640_0091878 3300046533 Bacteria 2002
300 Ga0495586_0041887 3300046535 Bacteria 2467
301 Ga0495586_0204693 3300046535 Bacteria 1119
302 Ga0495587_0008181 3300046536 Bacteria 6739
303 Ga0495587_0011432 3300046536 Bacteria 5624
304 Ga0495587_0045672 3300046536 Bacteria 2602
305 Ga0495587_0046298 3300046536 Bacteria 2582
306 Ga0495587_0071021 3300046536 Bacteria 2025
307 Ga0495609_0053187 3300046538 Bacteria 1801
308 Ga0495645_0006327 3300046543 Bacteria 8213
309 Ga0495645_0177175 3300046543 Bacteria 1463
310 Ga0495622_0110053 3300046557 Bacteria 1261
311 Ga0495633_0020195 3300046558 Bacteria 3354
312 Ga0495667_0102246 3300046559 Bacteria 1853
313 Ga0495667_0243898 3300046559 Bacteria 1144
314 Ga0495656_0085366 3300046615 Bacteria 1433
315 Ga0495656_0085751 3300046615 Bacteria 1430
316 Ga0495634_0002668 3300046642 Bacteria 14667
317 Ga0495634_0015710 3300046642 Bacteria 5429
318 Ga0495634_0025527 3300046642 Bacteria 4133
319 Ga0495634_0028976 3300046642 Bacteria 3837
320 Ga0495634_0116134 3300046642 Bacteria 1717
321 Ga0495611_0137584 3300046648 Bacteria 1140
322 Ga0495625_0069162 3300046660 Bacteria 2480
323 Ga0495625_0232506 3300046660 Bacteria 1203
324 Ga0495635_0001228 3300046663 Bacteria 17142
325 Ga0495635_0003861 3300046663 Bacteria 10413
326 Ga0495635_0005383 3300046663 Bacteria 8906
327 Ga0495635_0029793 3300046663 Bacteria 3796
328 Ga0495659_0037971 3300046664 Bacteria 1708
329 Ga0495659_0048289 3300046664 Bacteria 1542
330 Ga0495657_0004536 3300046675 Bacteria 11096
331 Ga0495657_0021702 3300046675 Bacteria 4605
332 Ga0495657_0084884 3300046675 Bacteria 2042
333 Ga0495657_0174888 3300046675 Bacteria 1320
334 Ga0495599_0009373 3300046678 Bacteria 5981
335 Ga0495599_0011485 3300046678 Bacteria 5443
336 Ga0495623_0001106 3300046679 Bacteria 18215
337 Ga0495623_0033796 3300046679 Bacteria 3281
338 Ga0495623_0055910 3300046679 Bacteria 2485
339 Ga0495646_0016251 3300046680 Bacteria 4724
340 Ga0495647_0016505 3300046681 Bacteria 2600
341 Ga0495658_0004424 3300046683 Bacteria 6915
342 Ga0495658_0102105 3300046683 Bacteria 1713
343 Ga0495669_0016843 3300046684 Bacteria 3133
344 Ga0495613_0010075 3300046689 Bacteria 7022
345 Ga0495613_0011195 3300046689 Bacteria 6664
346 Ga0495624_0011609 3300046690 Bacteria 6051
347 Ga0495624_0034443 3300046690 Bacteria 3275
348 Ga0495624_0079865 3300046690 Bacteria 2028
349 Ga0495670_0016987 3300046691 Bacteria 3577
350 Ga0495670_0156421 3300046691 Bacteria 1196
351 Ga0495671_0101614 3300046692 Bacteria 1405
352 Ga0495600_0002376 3300046809 Bacteria 10763
353 Ga0495600_0005432 3300046809 Bacteria 7680
354 Ga0495600_0069632 3300046809 Bacteria 2299
355 Ga0495581_0019722 3300047315 Bacteria 3914
356 Ga0495581_0044818 3300047315 Bacteria 2557
357 Ga0495604_0000915 3300047317 Bacteria 24528
358 Ga0495604_0036117 3300047317 Bacteria 3897
359 Ga0495604_0155345 3300047317 Bacteria 1621
360 Ga0495604_0196501 3300047317 Bacteria 1402
361 Ga0495636_0045171 3300047318 Bacteria 1835
362 Ga0495674_0006158 3300047319 Bacteria 11522
363 Ga0495674_0008535 3300047319 Bacteria 9751
364 Ga0495674_0010372 3300047319 Bacteria 8819
365 Ga0495676_0017970 3300047321 Bacteria 6240
366 Ga0495676_0161797 3300047321 Bacteria 1583
367 Ga0495680_0002894 3300047322 Bacteria 17254
368 Ga0495680_0002971 3300047322 Bacteria 16961
369 Ga0495680_0131140 3300047322 Bacteria 1841
370 Ga0495675_0005136 3300047444 Bacteria 7963
371 Ga0495675_0009369 3300047444 Bacteria 6090
372 Ga0495675_0036557 3300047444 Bacteria 3131
373 Ga0495675_0059034 3300047444 Bacteria 2432
374 Ga0495675_0166922 3300047444 Bacteria 1353
375 Ga0495684_0001238 3300047471 Bacteria 20564
376 Ga0495684_0002294 3300047471 Bacteria 15313
377 Ga0495684_0003026 3300047471 Bacteria 13229
378 Ga0495686_0053987 3300047472 Bacteria 2517
379 Ga0495593_0005942 3300047673 Bacteria 7193
380 Ga0495602_0042467 3300048088 Bacteria 4142
381 Ga0495602_0133261 3300048088 Bacteria 1978
382 Ga0495602_0138423 3300048088 Bacteria 1930
383 Ga0496100_0310160 3300048903 Bacteria 1183
384 Ga0496101_0012170 3300048904 Bacteria 5736
385 Ga0496101_0110266 3300048904 Bacteria 2071
386 Ga0496101_0145343 3300048904 Bacteria 1810
387 Ga0496101_0145927 3300048904 Bacteria 1807
388 Ga0496103_0183741 3300048906 Bacteria 1344
389 Ga0496104_0030495 3300048907 Bacteria 5011
390 Ga0496104_0059595 3300048907 Bacteria 3614
391 Ga0496104_0068316 3300048907 Bacteria 3377
392 Ga0496105_0073933 3300048908 Bacteria 2816
393 Ga0496105_0127994 3300048908 Bacteria 2094
394 Ga0496105_0147498 3300048908 Bacteria 1934
395 Ga0496106_0003991 3300048909 Bacteria 11026
396 Ga0496106_0127578 3300048909 Bacteria 1993
397 Ga0496107_0004902 3300048910 Bacteria 9097
398 Ga0496107_0005978 3300048910 Bacteria 8339
399 Ga0496108_0000581 3300048911 Bacteria 28520
400 Ga0496108_0044591 3300048911 Bacteria 3701
401 Ga0496109_0000507 3300048912 Bacteria 33280
402 Ga0496109_0267528 3300048912 Bacteria 1610
403 Ga0496110_0046175 3300048913 Bacteria 3810
404 Ga0496110_0063447 3300048913 Bacteria 3264
405 Ga0496110_0113508 3300048913 Bacteria 2437
406 Ga0496111_0034655 3300048914 Bacteria 3605
407 Ga0496111_0279467 3300048914 Bacteria 1238
408 Ga0496112_0020579 3300048915 Bacteria 6256
409 Ga0496112_0097942 3300048915 Bacteria 2903
410 Ga0496113_0010775 3300048916 Bacteria 6063
411 Ga0496114_0035612 3300048917 Bacteria 4111
412 Ga0496114_0078087 3300048917 Bacteria 2793
413 Ga0496114_0192612 3300048917 Bacteria 1784
414 Ga0496115_0043793 3300048918 Bacteria 3569
415 Ga0496115_0113634 3300048918 Bacteria 2225
416 Ga0496115_0129163 3300048918 Bacteria 2082
417 Ga0496116_0006385 3300048919 Bacteria 10704
418 Ga0496117_0110303 3300048920 Bacteria 1715
419 Ga0496118_0029045 3300048921 Bacteria 4645
420 Ga0496119_0044950 3300048922 Bacteria 2774
421 Ga0496121_0007109 3300048924 Bacteria 13587
422 Ga0496121_0018959 3300048924 Bacteria 6903
423 Ga0496121_0148874 3300048924 Bacteria 1726
424 Ga0496124_0113338 3300048927 Bacteria 2179
425 Ga0496125_0011584 3300048928 Bacteria 8810
426 Ga0496125_0039222 3300048928 Bacteria 4082
427 Ga0496126_0023579 3300048929 Bacteria 5961
428 Ga0501031_0004440 3300049568 Bacteria 9097
429 Ga0501032_0050672 3300049569 Bacteria 2799
430 Ga0501034_0032270 3300049571 Bacteria 5320
431 Ga0501034_0032423 3300049571 Bacteria 5306
432 Ga0501034_0111675 3300049571 Bacteria 2724
433 Ga0501038_0004917 3300049574 Bacteria 12413
434 Ga0501043_0097948 3300049579 Bacteria 2305
435 Ga0501043_0212845 3300049579 Bacteria 1498
436 Ga0501046_0003578 3300049580 Bacteria 14237
437 Ga0501047_0009688 3300049581 Bacteria 9107
438 Ga0501047_0013610 3300049581 Bacteria 7717
439 Ga0501047_0054923 3300049581 Bacteria 3852
440 Ga0501048_0007594 3300049582 Bacteria 8221
441 Ga0501067_0066503 3300049583 Bacteria 1995
442 Ga0501069_0028485 3300049585 Bacteria 3062
443 Ga0501069_0054603 3300049585 Bacteria 2225
444 Ga0501070_0025819 3300049586 Bacteria 4928
445 Ga0501070_0085920 3300049586 Bacteria 2604
446 Ga0501070_0190529 3300049586 Bacteria 1686
447 Ga0501071_0008334 3300049587 Bacteria 6847
448 Ga0501073_0013472 3300049589 Bacteria 5947
449 Ga0501073_0050193 3300049589 Bacteria 2924
450 Ga0501073_0153192 3300049589 Bacteria 1598
451 Ga0501074_0008201 3300049590 Bacteria 7571
452 Ga0501074_0087878 3300049590 Bacteria 2226
453 Ga0501079_0183056 3300049741 Bacteria 1635
454 Ga0501079_0235000 3300049741 Bacteria 1432
455 Ga0501080_0011424 3300049742 Bacteria 8132
456 Ga0501080_0035355 3300049742 Bacteria 4663
457 Ga0501083_0010347 3300049744 Bacteria 6567
458 Ga0501083_0033144 3300049744 Bacteria 3538
459 Ga0501083_0037510 3300049744 Bacteria 3301
460 Ga0501035_0162650 3300049822 Bacteria 1931
461 Ga0501044_0089734 3300049823 Bacteria 3102
462 nmdc:mga00v17_36132_c1 3300050491 Bacteria 2943
463 nmdc:mga00v17_57815_c1 3300050491 Bacteria 2373
464 nmdc:mga0yw44_60500_c1 3300050492 Bacteria 2320
465 nmdc:mga0k408_5864_c1 3300050493 Bacteria 6547
466 nmdc:mga0k408_70826_c1 3300050493 Bacteria 2035
467 nmdc:mga0k408_93004_c1 3300050493 Bacteria 1773
468 nmdc:mga0k408_98490_c1 3300050493 Bacteria 1723
469 nmdc:mga07m45_69991_c1 3300050496 Bacteria 1995
470 nmdc:mga05p37_15089_c1 3300050507 Bacteria 9276
471 nmdc:mga05p37_2497_c2 3300050507 Bacteria 20560
472 nmdc:mga05p37_514593_c1 3300050507 Bacteria 1370
473 nmdc:mga09592_6406_c1 3300050508 Bacteria 9591
474 nmdc:mga06r32_1397_c1 3300050510 Bacteria 21821
475 nmdc:mga08y16_100319_c1 3300050511 Bacteria 3014
476 nmdc:mga08y16_143786_c1 3300050511 Bacteria 2479
477 nmdc:mga08y16_30567_c1 3300050511 Bacteria 5668
478 Ga0495601_0009527 3300053077 Bacteria 5749
479 Ga0495601_0021640 3300053077 Bacteria 3939
480 Ga0495601_0070296 3300053077 Bacteria 2234
481 Ga0495601_0158770 3300053077 Bacteria 1477
482 Ga0495612_0002536 3300053078 Bacteria 7535
483 Ga0495612_0071141 3300053078 Bacteria 1450
484 Ga0495595_0001175 3300053084 Bacteria 10163
485 Ga0495595_0001238 3300053084 Bacteria 9939
486 Ga0495595_0019147 3300053084 Bacteria 2967
487 Ga0495619_0003520 3300053085 Bacteria 10097
488 Ga0495619_0005408 3300053085 Bacteria 8093
489 Ga0495619_0018869 3300053085 Bacteria 4379
490 Ga0495619_0052121 3300053085 Bacteria 2704
491 Ga0495619_0130368 3300053085 Bacteria 1727
492 Ga0495619_0219664 3300053085 Bacteria 1316
493 Ga0500643_040262 3300053087 Bacteria 1377
494 Ga0500646_0027019 3300053090 Bacteria 1559
495 Ga0500651_0027934 3300053093 Bacteria 3548
496 Ga0500566_0003023 3300053094 Bacteria 10055
497 Ga0500650_0000267 3300053098 Bacteria 12550
498 Ga0500554_028534 3300053102 Bacteria 1623
499 Ga0500556_0000091 3300053104 Bacteria 83564
500 Ga0500556_0055056 3300053104 Bacteria 1450
501 Ga0500562_043794 3300053108 Bacteria 1191
502 Ga0500569_042288 3300053109 Bacteria 1340
503 Ga0500642_0000046 3300053130 Bacteria 82391
504 Ga0500652_007965 3300053131 Bacteria 3504
505 Ga0500559_0002858 3300053136 Bacteria 8725
506 Ga0500568_0002100 3300053139 Bacteria 12054
507 Ga0500586_000704 3300053145 Bacteria 6861
508 Ga0500603_000645 3300053150 Bacteria 8504
509 Ga0500616_0000022 3300053153 Bacteria 460463
510 Ga0500616_0069778 3300053153 Bacteria 1796
511 Ga0500619_028193 3300053154 Bacteria 1689
512 Ga0500622_0005473 3300053156 Bacteria 7622
513 Ga0500627_0073540 3300053158 Bacteria 1517
514 Ga0500636_0189611 3300053177 Bacteria 1096
515 Ga0500637_0000155 3300053178 Bacteria 25033
516 Ga0500645_030418 3300053730 Bacteria 1624
517 Ga0500596_000518 3300053735 Bacteria 7283
518 Ga0501084_0279363 3300054114 Bacteria 1410
519 Ga0501082_0026636 3300060353 Bacteria 4984
520 2509149779 2508501128 Bacteria 8613869
521 2509154148 2508501128 Bacteria 8613869
522 2513644271 2513237094 Bacteria 8789602
523 2513658993 2513237096 Bacteria 8722461
524 2513672990 2513237098 Bacteria 9902361
525 2513921257 2513237145 Bacteria 8979722
526 2524540364 2524023228 Bacteria 10118060
527 2603861878 2602042107 Bacteria 6226103
528 2671121401 2667528175 Bacteria 7532676
529 2723842040 2721755755 Bacteria 8322773
530 2793070977 2791355197 Bacteria 8420563
531 2793077410
532 2824778779 2824773399 Bacteria 8360218
533 2854896462 2854896431 Bacteria 5869725
534 2857526045 2857524615 Bacteria 6615449
535 2874610343 2874604998 Bacteria 7834745
536 2876812821 2876808645 Bacteria 8824342
537 2879111664 2879110137 Bacteria 8907982
538 2885391432 2885383462 Bacteria 9473874
539 2889035057 2889033259 Bacteria 9099371
540 2891091406 2891088606 Bacteria 4762464
541 2903749934 2903748898 Bacteria 9972761
542 2903772311 2903768456 Bacteria 9749579
543 2904709190
544 2906613207
545 2906635505 2906635258 Bacteria 8601019
546 2906643938 2906643746 Bacteria 8722424
547 2906668636 2906660503 Bacteria 8595048
548 2908747920 2908739725 Bacteria 8628932
549 2919074103 2919073203 Bacteria 6531949
550 2922433705
551 2935634751 2935630451 Bacteria 8169952
552 2941511919 2941507105 Bacteria 8166816
553 2941519621 2941515067 Bacteria 8166720
554 2941527687 2941523033 Bacteria 8169134
555 3005483358 3005474847 Bacteria 9259049
556 8006935741 8006933436 Bacteria 10410654
557 8006968330 8006964411 Bacteria 8966052
558 8006975660 8006973647 Bacteria 10679141
559 8006985935 8006984368 Bacteria 9651211
560 8007000264 8006994254 Bacteria 8309700
561 8019563053 8019555841 Bacteria 9642137
562 8019573136 8019565922 Bacteria 9639779
563 Ga0075433_10028633
564 JGI24739J22299_10002185
565 JGI24737J22298_10018513
566 JGI24735J21928_10012353
567 JGI25153J46596_10000763
568 Ga0065707_10179269
569 Ga0070683_100313144
570 Ga0070690_100048613
571 Ga0070670_100139722
572 Ga0070670_100183668
573 Ga0070687_100007673
574 Ga0070668_100045218
575 Ga0070668_100380829
576 Ga0070669_100144072
577 Ga0070675_100329870
578 Ga0070671_100026550
579 Ga0070671_100081136
580 Ga0070674_100266729
581 Ga0070673_100043311
582 Ga0070673_100154298
583 Ga0070667_100159720
584 Ga0070709_10115024
585 Ga0070714_100024854
586 Ga0070710_10009867
587 Ga0070710_10244117
588 Ga0070711_100123036
589 Ga0070711_100195742
590 Ga0070700_100175140
591 Ga0070663_100128250
592 Ga0070662_100265284
593 Ga0070685_10128471
594 Ga0070707_100014160
595 Ga0070679_100183868
596 Ga0068853_100126574
597 Ga0068853_100196832
598 Ga0068853_100286604
599 Ga0070665_100064764
600 Ga0070665_100243613
601 Ga0070704_100017657
602 Ga0068855_100265983
603 Ga0068855_100299454
604 Ga0068857_100055485
605 Ga0068854_100059212
606 Ga0068856_100000759
607 Ga0068856_100039826
608 Ga0068856_100041953
609 Ga0068852_100012482
610 Ga0068852_100049474
611 Ga0068852_100383289
612 Ga0068859_100068557
613 Ga0068864_100131465
614 Ga0068858_100224841
615 Ga0068860_100095673
616 Ga0068860_100580083
617 Ga0068862_100116411
618 Ga0081455_10002892
619 Ga0081538_10014965
620 Ga0081540_1004448
621 Ga0081540_1063644
622 Ga0081540_1074449
623 Ga0081539_10000048
624 Ga0081539_10027760
625 Ga0081539_10065568
626 Ga0070717_10018331
627 Ga0070717_10227741
628 Ga0075368_10031068
629 Ga0075366_10009772
630 Ga0075366_10023330
631 Ga0097621_100207118
632 Ga0075370_10181673
633 Ga0075428_100002806
634 Ga0075431_100001644
635 Ga0075429_100005530
636 Ga0097620_100068557
637 Ga0075435_100325142
638 Ga0099794_10002401
639 Ga0099795_10002148
640 Ga0105240_10019187
641 Ga0105240_10464085
642 Ga0111539_10024349
643 Ga0111539_10034305
644 Ga0114129_10003726
645 Ga0114129_10007650
646 Ga0114129_10377972
647 Ga0105241_10031752
648 Ga0105241_10059776
649 Ga0105242_10317865
650 Ga0105248_10127975
651 Ga0105248_10158818
652 Ga0105248_10348374
653 Ga0099796_10028030
654 Ga0105239_10012188
655 Ga0157369_10014318
656 Ga0171462_1050
657 Ga0157372_10415812
658 Ga0163163_10219932
659 Ga0157380_10039851
660 Ga0228598_1001760
661 Ga0209758_1000088
662 Ga0209758_1000190
663 Ga0209758_1002991
664 Ga0207656_10014111
665 Ga0207710_10033562
666 Ga0207710_10069837
667 Ga0207680_10011816
668 Ga0207647_10000455
669 Ga0207647_10072183
670 Ga0207699_10148842
671 Ga0207643_10043166
672 Ga0207705_10306152
673 Ga0207654_10002203
674 Ga0207695_10004560
675 Ga0207695_10051749
676 Ga0207695_10116220
677 Ga0207671_10120343
678 Ga0207671_10176556
679 Ga0207693_10005300
680 Ga0207693_10044418
681 Ga0207693_10081308
682 Ga0207693_10140366
683 Ga0207662_10007387
684 Ga0207662_10284563
685 Ga0207657_10328622
686 Ga0207646_10029707
687 Ga0207694_10000376
688 Ga0207650_10088930
689 Ga0207659_10031022
690 Ga0207664_10075034
691 Ga0207664_10148493
692 Ga0207690_10023900
693 Ga0207706_10028917
694 Ga0207706_10035121
695 Ga0207686_10090644
696 Ga0207709_10180684
697 Ga0207670_10176980
698 Ga0207669_10029668
699 Ga0207665_10027608
700 Ga0207665_10221596
701 Ga0207691_10254109
702 Ga0207711_10027104
703 Ga0207711_10086639
704 Ga0207711_10140272
705 Ga0207711_10298771
706 Ga0207667_10012109
707 Ga0207667_10104098
708 Ga0207667_10537118
709 Ga0207651_10045869
710 Ga0207712_10096743
711 Ga0207640_10086799
712 Ga0207658_10223254
713 Ga0207677_10015669
714 Ga0207703_10008930
715 Ga0207639_10041887
716 Ga0207639_10240205
717 Ga0207678_10051204
718 Ga0207678_10054618
719 Ga0207702_10000355
720 Ga0207702_10000539
721 Ga0207702_10005850
722 Ga0207702_10149157
723 Ga0207702_10194092
724 Ga0207676_10073341
725 Ga0207676_10109612
726 Ga0207698_10026396
727 Ga0209588_1013228
728 Ga0207428_10006451
729 Ga0207428_10076404
730 Ga0268266_10090051
731 Ga0268266_10091057
732 Ga0268266_10092626
733 Ga0268265_10094815
734 Ga0268264_10000049
735 Ga0268264_10073082
736 Ga0268264_10226746
737 Ga0307517_10000766
738 Ga0307515_10129915
739 Ga0265338_10009524
740 Ga0265330_10026025
741 Ga0265332_10059906
742 Ga0265325_10007415
743 Ga0265325_10008069
744 Ga0265340_10009912
745 Ga0265339_10000286
746 Ga0265316_10246601
747 Ga0307509_10044224
748 Ga0265313_10000450
749 Ga0265314_10079204
750 Ga0307516_10008547
751 Ga0307516_10035632
752 Ga0307516_10071291
753 Ga0307413_10101821
754 Ga0307409_100131084
755 Ga0307416_100058649
756 Ga0307510_10037963
757 Ga0373926_0009096
758 Ga0373926_0016584
759 Ga0373928_0020134
760 Ga0373928_0044705
761 Ga0373934_0030116
762 Ga0373944_0001705
763 Ga0373936_0113197
764 Ga0373954_0015476
765 Ga0373956_0004169
766 Ga0373956_0013277
767 Ga0373957_0017895
768 Ga0373943_0007878
769 Ga0373943_0069485
770 Ga0373943_0111345
771 Ga0373946_0000317
772 Ga0373955_0000862
773 Ga0373955_0003395
774 Ga0373955_0029117
775 Ga0373955_0084540
776 Ga0373924_0017310
777 Ga0373924_0021649
778 Ga0373924_0114425
779 Ga0373931_0062706
780 Ga0373935_0007859
781 Ga0373935_0011452
782 Ga0373935_0089998
783 Ga0373935_0154421
784 Ga0373927_0001762
785 Ga0373927_0008229
786 Ga0373927_0031444
787 Ga0373927_0105739
788 Ga0373933_0000911
789 Ga0373947_0001044
790 Ga0373947_0001344
791 Ga0373947_0032091
792 Ga0373947_0058725
793 Ga0373937_0002053
794 Ga0373937_0006177
795 Ga0373937_0007628
796 Ga0373937_0010534
797 Ga0373937_0040612
798 Ga0373937_0094530
799 Ga0373925_0008529
800 Ga0373925_0010949
801 Ga0373925_0036021
802 Ga0373925_0067673
803 Ga0395900_0018087
804 Ga0395898_0026861
805 Ga0436365_1184860
806 Ga0436361_0624205
807 Ga0436362_0648852
808 Ga0439456_029260
809 Ga0439459_0003390
810 Ga0466963_0067877
811 Ga0453684_0340552
812 Ga0466957_0041409
813 Ga0466957_0075753
814 Ga0466959_0035242
815 Ga0466958_0030831
816 Ga0466967_0481538
817 Ga0495592_0002960
818 Ga0495592_0053110
819 Ga0495603_0011862
820 Ga0495603_0037589
821 Ga0495629_0001814
822 Ga0495629_0141829
823 Ga0495638_0024809
824 Ga0495641_0050219
825 Ga0495651_0025537
826 Ga0495651_0099732
827 Ga0495653_0028306
828 Ga0495653_0028334
829 Ga0495580_0012156
830 Ga0495639_0019296
831 Ga0495639_0088154
832 Ga0495662_0001401
833 Ga0495662_0039764
834 Ga0495664_0003909
835 Ga0495664_0044959
836 Ga0495664_0052384
837 Ga0495584_0067728
838 Ga0495585_0060859
839 Ga0495594_0042601
840 Ga0495607_0066028
841 Ga0495608_0005129
842 Ga0495608_0013134
843 Ga0495618_0002499
844 Ga0495618_0002683
845 Ga0495618_0021029
846 Ga0495628_0051633
847 Ga0495628_0065814
848 Ga0495628_0134842
849 Ga0495630_0003957
850 Ga0495630_0091990
851 Ga0495630_0186387
852 Ga0495631_0042239
853 Ga0495631_0052978
854 Ga0495652_0011336
855 Ga0495652_0054711
856 Ga0495652_0080849
857 Ga0495652_0093349
858 Ga0495640_0002191
859 Ga0495640_0005056
860 Ga0495640_0019415
861 Ga0495640_0091878
862 Ga0495586_0041887
863 Ga0495586_0204693
864 Ga0495587_0008181
865 Ga0495587_0011432
866 Ga0495587_0045672
867 Ga0495587_0046298
868 Ga0495587_0071021
869 Ga0495609_0053187
870 Ga0495645_0006327
871 Ga0495645_0177175
872 Ga0495622_0110053
873 Ga0495633_0020195
874 Ga0495667_0102246
875 Ga0495667_0243898
876 Ga0495656_0085366
877 Ga0495656_0085751
878 Ga0495634_0002668
879 Ga0495634_0015710
880 Ga0495634_0025527
881 Ga0495634_0028976
882 Ga0495634_0116134
883 Ga0495611_0137584
884 Ga0495625_0069162
885 Ga0495625_0232506
886 Ga0495635_0001228
887 Ga0495635_0003861
888 Ga0495635_0005383
889 Ga0495635_0029793
890 Ga0495659_0037971
891 Ga0495659_0048289
892 Ga0495657_0004536
893 Ga0495657_0021702
894 Ga0495657_0084884
895 Ga0495657_0174888
896 Ga0495599_0009373
897 Ga0495599_0011485
898 Ga0495623_0001106
899 Ga0495623_0033796
900 Ga0495623_0055910
901 Ga0495646_0016251
902 Ga0495647_0016505
903 Ga0495658_0004424
904 Ga0495658_0102105
905 Ga0495669_0016843
906 Ga0495613_0010075
907 Ga0495613_0011195
908 Ga0495624_0011609
909 Ga0495624_0034443
910 Ga0495624_0079865
911 Ga0495670_0016987
912 Ga0495670_0156421
913 Ga0495671_0101614
914 Ga0495600_0002376
915 Ga0495600_0005432
916 Ga0495600_0069632
917 Ga0495581_0019722
918 Ga0495581_0044818
919 Ga0495604_0000915
920 Ga0495604_0036117
921 Ga0495604_0155345
922 Ga0495604_0196501
923 Ga0495636_0045171
924 Ga0495674_0006158
925 Ga0495674_0008535
926 Ga0495674_0010372
927 Ga0495676_0017970
928 Ga0495676_0161797
929 Ga0495680_0002894
930 Ga0495680_0002971
931 Ga0495680_0131140
932 Ga0495675_0005136
933 Ga0495675_0009369
934 Ga0495675_0036557
935 Ga0495675_0059034
936 Ga0495675_0166922
937 Ga0495684_0001238
938 Ga0495684_0002294
939 Ga0495684_0003026
940 Ga0495686_0053987
941 Ga0495593_0005942
942 Ga0495602_0042467
943 Ga0495602_0133261
944 Ga0495602_0138423
945 Ga0496100_0310160
946 Ga0496101_0012170
947 Ga0496101_0110266
948 Ga0496101_0145343
949 Ga0496101_0145927
950 Ga0496103_0183741
951 Ga0496104_0030495
952 Ga0496104_0059595
953 Ga0496104_0068316
954 Ga0496105_0073933
955 Ga0496105_0127994
956 Ga0496105_0147498
957 Ga0496106_0003991
958 Ga0496106_0127578
959 Ga0496107_0004902
960 Ga0496107_0005978
961 Ga0496108_0000581
962 Ga0496108_0044591
963 Ga0496109_0000507
964 Ga0496109_0267528
965 Ga0496110_0046175
966 Ga0496110_0063447
967 Ga0496110_0113508
968 Ga0496111_0034655
969 Ga0496111_0279467
970 Ga0496112_0020579
971 Ga0496112_0097942
972 Ga0496113_0010775
973 Ga0496114_0035612
974 Ga0496114_0078087
975 Ga0496114_0192612
976 Ga0496115_0043793
977 Ga0496115_0113634
978 Ga0496115_0129163
979 Ga0496116_0006385
980 Ga0496117_0110303
981 Ga0496118_0029045
982 Ga0496119_0044950
983 Ga0496121_0007109
984 Ga0496121_0018959
985 Ga0496121_0148874
986 Ga0496124_0113338
987 Ga0496125_0011584
988 Ga0496125_0039222
989 Ga0496126_0023579
990 Ga0501031_0004440
991 Ga0501032_0050672
992 Ga0501034_0032270
993 Ga0501034_0032423
994 Ga0501034_0111675
995 Ga0501038_0004917
996 Ga0501043_0097948
997 Ga0501043_0212845
998 Ga0501046_0003578
999 Ga0501047_0009688
1000 Ga0501047_0013610
1001 Ga0501047_0054923
1002 Ga0501048_0007594
1003 Ga0501067_0066503
1004 Ga0501069_0028485
1005 Ga0501069_0054603
1006 Ga0501070_0025819
1007 Ga0501070_0085920
1008 Ga0501070_0190529
1009 Ga0501071_0008334
1010 Ga0501073_0013472
1011 Ga0501073_0050193
1012 Ga0501073_0153192
1013 Ga0501074_0008201
1014 Ga0501074_0087878
1015 Ga0501079_0183056
1016 Ga0501079_0235000
1017 Ga0501080_0011424
1018 Ga0501080_0035355
1019 Ga0501083_0010347
1020 Ga0501083_0033144
1021 Ga0501083_0037510
1022 Ga0501035_0162650
1023 Ga0501044_0089734
1024 nmdc:mga00v17_36132_c1
1025 nmdc:mga00v17_57815_c1
1026 nmdc:mga0yw44_60500_c1
1027 nmdc:mga0k408_5864_c1
1028 nmdc:mga0k408_70826_c1
1029 nmdc:mga0k408_93004_c1
1030 nmdc:mga0k408_98490_c1
1031 nmdc:mga07m45_69991_c1
1032 nmdc:mga05p37_15089_c1
1033 nmdc:mga05p37_2497_c2
1034 nmdc:mga05p37_514593_c1
1035 nmdc:mga09592_6406_c1
1036 nmdc:mga06r32_1397_c1
1037 nmdc:mga08y16_100319_c1
1038 nmdc:mga08y16_143786_c1
1039 nmdc:mga08y16_30567_c1
1040 Ga0495601_0009527
1041 Ga0495601_0021640
1042 Ga0495601_0070296
1043 Ga0495601_0158770
1044 Ga0495612_0002536
1045 Ga0495612_0071141
1046 Ga0495595_0001175
1047 Ga0495595_0001238
1048 Ga0495595_0019147
1049 Ga0495619_0003520
1050 Ga0495619_0005408
1051 Ga0495619_0018869
1052 Ga0495619_0052121
1053 Ga0495619_0130368
1054 Ga0495619_0219664
1055 Ga0500643_040262
1056 Ga0500646_0027019
1057 Ga0500651_0027934
1058 Ga0500566_0003023
1059 Ga0500650_0000267
1060 Ga0500554_028534
1061 Ga0500556_0000091
1062 Ga0500556_0055056
1063 Ga0500562_043794
1064 Ga0500569_042288
1065 Ga0500642_0000046
1066 Ga0500652_007965
1067 Ga0500559_0002858
1068 Ga0500568_0002100
1069 Ga0500586_000704
1070 Ga0500603_000645
1071 Ga0500616_0000022
1072 Ga0500616_0069778
1073 Ga0500619_028193
1074 Ga0500622_0005473
1075 Ga0500627_0073540
1076 Ga0500636_0189611
1077 Ga0500637_0000155
1078 Ga0500645_030418
1079 Ga0500596_000518
1080 Ga0501084_0279363
1081 Ga0501082_0026636
1082 2509149779
1083 2509154148
1084 2513644271
1085 2513658993
1086 2513672990
1087 2513921257
1088 2524540364
1089 2603861878
1090 2671121401
1091 2723842040
1092 2793070977
1093 2793077410
1094 2824778779
1095 2854896462
1096 2857526045
1097 2874610343
1098 2876812821
1099 2879111664
1100 2885391432
1101 2889035057
1102 2891091406
1103 2903749934
1104 2903772311
1105 2904709190
1106 2906613207
1107 2906635505
1108 2906643938
1109 2906668636
1110 2908747920
1111 2919074103
1112 2922433705
1113 2935634751
1114 2941511919
1115 2941519621
1116 2941527687
1117 3005483358
1118 8006935741
1119 8006968330
1120 8006975660
1121 8006985935
1122 8007000264
1123 8019563053
1124 8019573136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

40

262

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.8938 21 334
6xks-assembly3.cif.gz_C crystal structure of domain a from the periplasmic lysine-, arginine-, ornithine-binding protein (lao) of salmonella typhimurium 0.8848 29 113
6gpc-assembly1.cif.gz_A crystal structure of the arginine-bound form of domain 1 from tmargbp 0.8846 24 107
8ovn-assembly1.cif.gz_A x-ray structure of the sf-iglusnfr-s72a 0.8762 21 250
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.8757 21 334
ID Description Score Start End Superfamily
2v25B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9364 21 107 3.40.190.10
5eyfA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.908 22 107 3.40.190.10
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.891 123 212 3.40.190.10
2yjpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8882 22 125 3.40.190.10
2y7iB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8861 122 217 3.40.190.10
ID Description Score Start End GO Terms
AF-U3U0L6-F1-model_v4 Amino-acid ABC transporter-binding protein yhdW 0.9822 110 323 GO:0006865
AF-A0A101CZL7-F1-model_v4 General L-amino acid-binding periplasmic protein AapJ 0.9777 126 206 GO:0006865
AF-U3U0L6-F1-model_v4 Amino-acid ABC transporter-binding protein yhdW 0.9688 110 323 GO:0006865
AF-A0A840AHG7-F1-model_v4 General L-amino acid transport system substrate-binding protein 0.9591 22 334 GO:0006865
AF-A0A2E4XNY7-F1-model_v4 SH3b domain-containing protein 0.958 120 216

Map