F463849
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 561 | 374 | 489 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0059083|Ga0453684_0059083_4004_4807 |
| Length | 267 |
| Sequence | LSSIAHAGIIVSENAFSESFSIRRNLDAPGSRGNVPMKSAIMQPYFLPYIGYFQLMHAVDTFVVYDNIKYTKKGWINRNRILVDGKDTYITIPLANASDFLDIRERTVSPDFKREKMLHQVAEAYRKAPFFDPTYALFEKIVHCNEHNLFSYLLNSIKLVCEYLNIATSITISSGIPIDHSLKAENKVIALCKHLGSEHYINAIGGQELYSKEEFAGNAINLHFIKTGPVEYVQFNHPFVPWLSIIDVLMFNDLETVKGFLDAYTLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 2 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 3 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 4 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 5 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 6 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 7 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 8 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 9 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 10 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 11 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 12 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 13 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 14 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 15 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 16 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 17 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 18 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 19 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 20 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 21 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 22 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 23 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 24 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 25 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 26 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 27 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 28 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 29 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 30 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 31 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 32 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 33 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 34 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 35 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 36 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 37 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 38 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 39 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 40 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 41 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 42 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 43 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 44 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 45 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 46 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 47 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 48 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 49 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 50 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 51 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 52 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 53 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 54 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 55 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 56 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 57 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 58 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 59 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 60 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 61 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 62 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 63 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 64 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 65 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 66 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 67 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 68 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 69 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 70 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 71 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 72 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 73 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 74 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 79 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 84 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 87 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 89 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 102 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 106 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 108 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 114 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 121 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 122 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 123 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 124 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 125 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 126 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 127 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 128 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 131 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 132 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 133 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 134 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 135 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 138 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 167 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 247 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 248 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 249 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 338 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 340 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 341 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 342 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 343 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 346 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 348 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 350 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 352 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 353 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 354 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 356 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 357 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 359 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 362 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 364 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 365 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 366 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 367 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 368 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 369 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 370 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 371 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 372 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 373 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 374 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.17 |
| Metatranscriptomes | 0 |
| Isolates | 12.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.48 |
| Nodule | 8.38 |
| Rhizoplane | 7.49 |
| Rhizosphere | 61.14 |
| Stem | 0 |
| Stem Tuber | 0.36 |
| Unclassified | 10.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1017273 | 3300001904 | Bacteria | 1145 |
| 2 | JGI24735J21928_10001863 | 3300002067 | Bacteria | 7392 |
| 3 | JGI25155J39150_1000028 | 3300002704 | Bacteria | 120158 |
| 4 | JGI25156J39149_1000013 | 3300002705 | Bacteria | 189553 |
| 5 | JGI25154J39366_1000032 | 3300002738 | Bacteria | 189265 |
| 6 | JGI25157J39369_1000017 | 3300002741 | Bacteria | 189553 |
| 7 | JGI25151J46595_10006611 | 3300003187 | Bacteria | 5792 |
| 8 | JGI25165J46597_1014655 | 3300003214 | Bacteria | 1065 |
| 9 | rootH2_10022911 | 3300003320 | Bacteria | 27500 |
| 10 | rootH1_10032066 | 3300003323 | Bacteria | 1957 |
| 11 | rootH1_10306814 | 3300003323 | Bacteria | 1587 |
| 12 | Ga0055538_1000068 | 3300003751 | Bacteria | 97329 |
| 13 | Ga0055527_1000940 | 3300003760 | Bacteria | 7171 |
| 14 | Ga0055528_1002119 | 3300003790 | Bacteria | 10953 |
| 15 | Ga0055531_10000007 | 3300003794 | Bacteria | 225289 |
| 16 | Ga0055543_1002571 | 3300004625 | Bacteria | 5890 |
| 17 | Ga0065165_1000278 | 3300005262 | Bacteria | 87353 |
| 18 | Ga0065707_10277394 | 3300005295 | Bacteria | 1056 |
| 19 | Ga0070658_10000427 | 3300005327 | Bacteria | 36514 |
| 20 | Ga0070658_10006490 | 3300005327 | Bacteria | 9482 |
| 21 | Ga0070658_10435737 | 3300005327 | Bacteria | 1128 |
| 22 | Ga0070676_10291930 | 3300005328 | Bacteria | 1102 |
| 23 | Ga0070690_100000691 | 3300005330 | Bacteria | 17290 |
| 24 | Ga0068869_100011002 | 3300005334 | Bacteria | 5926 |
| 25 | Ga0068869_100639176 | 3300005334 | Unclassified | 902 |
| 26 | Ga0070666_10001834 | 3300005335 | Bacteria | 12941 |
| 27 | Ga0070680_100431635 | 3300005336 | Bacteria | 1124 |
| 28 | Ga0068868_100001999 | 3300005338 | Bacteria | 14029 |
| 29 | Ga0070660_100581743 | 3300005339 | Bacteria | 935 |
| 30 | Ga0070689_100029808 | 3300005340 | Bacteria | 4135 |
| 31 | Ga0070668_100003531 | 3300005347 | Bacteria | 11532 |
| 32 | Ga0070668_100005392 | 3300005347 | Bacteria | 9493 |
| 33 | Ga0070668_100732622 | 3300005347 | Unclassified | 874 |
| 34 | Ga0070669_100124600 | 3300005353 | Bacteria | 1970 |
| 35 | Ga0070675_100100003 | 3300005354 | Unclassified | 2442 |
| 36 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 37 | Ga0070671_100006127 | 3300005355 | Bacteria | 9578 |
| 38 | Ga0070671_100509064 | 3300005355 | Bacteria | 1036 |
| 39 | Ga0070674_100144990 | 3300005356 | Bacteria | 1786 |
| 40 | Ga0070674_100254096 | 3300005356 | Bacteria | 1382 |
| 41 | Ga0070688_100003007 | 3300005365 | Bacteria | 8598 |
| 42 | Ga0070659_100036364 | 3300005366 | Bacteria | 3839 |
| 43 | Ga0070667_100030603 | 3300005367 | Bacteria | 4489 |
| 44 | Ga0070700_100560128 | 3300005441 | Bacteria | 889 |
| 45 | Ga0070663_100322199 | 3300005455 | Bacteria | 1243 |
| 46 | Ga0070678_100026668 | 3300005456 | Bacteria | 3911 |
| 47 | Ga0070678_100073654 | 3300005456 | Unclassified | 2564 |
| 48 | Ga0070662_100114572 | 3300005457 | Unclassified | 2058 |
| 49 | Ga0068867_100358938 | 3300005459 | Unclassified | 1218 |
| 50 | Ga0070685_10004994 | 3300005466 | Bacteria | 6716 |
| 51 | Ga0070707_100001508 | 3300005468 | Bacteria | 22712 |
| 52 | Ga0070699_100001291 | 3300005518 | Bacteria | 23104 |
| 53 | Ga0070699_100020489 | 3300005518 | Bacteria | 5704 |
| 54 | Ga0070679_100076783 | 3300005530 | Bacteria | 3329 |
| 55 | Ga0070697_100040020 | 3300005536 | Bacteria | 3791 |
| 56 | Ga0068853_100004714 | 3300005539 | Bacteria | 10582 |
| 57 | Ga0068853_100254350 | 3300005539 | Bacteria | 1613 |
| 58 | Ga0070672_100053776 | 3300005543 | Bacteria | 3149 |
| 59 | Ga0070672_100571890 | 3300005543 | Bacteria | 983 |
| 60 | Ga0070696_100030891 | 3300005546 | Unclassified | 3669 |
| 61 | Ga0070696_100499855 | 3300005546 | Bacteria | 967 |
| 62 | Ga0070693_100299989 | 3300005547 | Unclassified | 1083 |
| 63 | Ga0070693_100531045 | 3300005547 | Bacteria | 839 |
| 64 | Ga0070665_100000191 | 3300005548 | Bacteria | 108807 |
| 65 | Ga0070665_100073513 | 3300005548 | Bacteria | 3424 |
| 66 | Ga0070704_100024796 | 3300005549 | Bacteria | 3940 |
| 67 | Ga0068855_100052223 | 3300005563 | Bacteria | 4813 |
| 68 | Ga0068855_100074327 | 3300005563 | Bacteria | 3948 |
| 69 | Ga0068857_100377113 | 3300005577 | Bacteria | 1316 |
| 70 | Ga0068856_100192675 | 3300005614 | Bacteria | 2052 |
| 71 | Ga0070702_100281341 | 3300005615 | Bacteria | 1142 |
| 72 | Ga0070702_100475259 | 3300005615 | Unclassified | 912 |
| 73 | Ga0068852_100097322 | 3300005616 | Bacteria | 2647 |
| 74 | Ga0068859_100000752 | 3300005617 | Bacteria | 32637 |
| 75 | Ga0068859_100038942 | 3300005617 | Bacteria | 4768 |
| 76 | Ga0068864_100001479 | 3300005618 | Bacteria | 19364 |
| 77 | Ga0068866_10121699 | 3300005718 | Unclassified | 1471 |
| 78 | Ga0068866_10165207 | 3300005718 | Bacteria | 1294 |
| 79 | Ga0068861_100198632 | 3300005719 | Bacteria | 1682 |
| 80 | Ga0068851_10031595 | 3300005834 | Bacteria | 2631 |
| 81 | Ga0068863_100056587 | 3300005841 | Bacteria | 3713 |
| 82 | Ga0068858_100003128 | 3300005842 | Bacteria | 16565 |
| 83 | Ga0068860_100005794 | 3300005843 | Bacteria | 12443 |
| 84 | Ga0068860_100085237 | 3300005843 | Bacteria | 3006 |
| 85 | Ga0081455_10308979 | 3300005937 | Bacteria | 1131 |
| 86 | Ga0081540_1003477 | 3300005983 | Bacteria | 12428 |
| 87 | Ga0070716_100125466 | 3300006173 | Bacteria | 1614 |
| 88 | Ga0097621_100003468 | 3300006237 | Bacteria | 10876 |
| 89 | Ga0097621_100013394 | 3300006237 | Bacteria | 6113 |
| 90 | Ga0075370_10211104 | 3300006353 | Bacteria | 1146 |
| 91 | Ga0068871_100002423 | 3300006358 | Bacteria | 12736 |
| 92 | Ga0068871_100004395 | 3300006358 | Bacteria | 9798 |
| 93 | Ga0068871_100153155 | 3300006358 | Unclassified | 1967 |
| 94 | Ga0075428_100222407 | 3300006844 | Unclassified | 2038 |
| 95 | Ga0075433_10203924 | 3300006852 | Bacteria | 1758 |
| 96 | Ga0075434_100311406 | 3300006871 | Bacteria | 1595 |
| 97 | Ga0075429_100829581 | 3300006880 | Bacteria | 809 |
| 98 | Ga0097620_100000752 | 3300006931 | Bacteria | 32637 |
| 99 | Ga0097620_100038942 | 3300006931 | Bacteria | 4768 |
| 100 | Ga0079104_1000627 | 3300006946 | Bacteria | 34512 |
| 101 | Ga0105251_10005673 | 3300009011 | Bacteria | 8104 |
| 102 | Ga0105244_10004206 | 3300009036 | Bacteria | 10009 |
| 103 | Ga0105244_10004943 | 3300009036 | Bacteria | 9009 |
| 104 | Ga0105250_10003815 | 3300009092 | Bacteria | 7075 |
| 105 | Ga0105250_10005778 | 3300009092 | Bacteria | 5506 |
| 106 | Ga0105250_10015292 | 3300009092 | Bacteria | 3143 |
| 107 | Ga0105245_10004921 | 3300009098 | Bacteria | 11753 |
| 108 | Ga0105245_10005949 | 3300009098 | Bacteria | 10720 |
| 109 | Ga0105247_10000813 | 3300009101 | Bacteria | 23797 |
| 110 | Ga0105247_10032030 | 3300009101 | Bacteria | 3193 |
| 111 | Ga0114129_10035722 | 3300009147 | Bacteria | 7020 |
| 112 | Ga0114129_10083943 | 3300009147 | Unclassified | 4423 |
| 113 | Ga0114129_10117416 | 3300009147 | Bacteria | 3666 |
| 114 | Ga0105242_10004520 | 3300009176 | Bacteria | 10804 |
| 115 | Ga0105242_10010848 | 3300009176 | Bacteria | 6998 |
| 116 | Ga0105242_10123242 | 3300009176 | Bacteria | 2228 |
| 117 | Ga0105248_10010760 | 3300009177 | Bacteria | 10100 |
| 118 | Ga0105248_10198894 | 3300009177 | Unclassified | 2258 |
| 119 | Ga0105248_10342474 | 3300009177 | Unclassified | 1683 |
| 120 | Ga0105237_10056227 | 3300009545 | Bacteria | 3939 |
| 121 | Ga0105238_10111414 | 3300009551 | Bacteria | 2717 |
| 122 | Ga0105238_10472930 | 3300009551 | Bacteria | 1252 |
| 123 | Ga0105249_10207736 | 3300009553 | Bacteria | 1920 |
| 124 | Ga0105249_10365268 | 3300009553 | Bacteria | 1466 |
| 125 | Ga0105239_10001689 | 3300010375 | Bacteria | 29111 |
| 126 | Ga0105239_10122016 | 3300010375 | Bacteria | 2895 |
| 127 | Ga0105239_10744571 | 3300010375 | Bacteria | 1121 |
| 128 | Ga0105246_10013581 | 3300011119 | Bacteria | 5109 |
| 129 | Ga0157373_10000216 | 3300013100 | Bacteria | 47143 |
| 130 | Ga0157373_10045759 | 3300013100 | Unclassified | 3123 |
| 131 | Ga0157373_10079870 | 3300013100 | Bacteria | 2307 |
| 132 | Ga0157371_10014810 | 3300013102 | Bacteria | 5870 |
| 133 | Ga0157371_10080426 | 3300013102 | Bacteria | 2308 |
| 134 | Ga0157370_10000154 | 3300013104 | Bacteria | 84734 |
| 135 | Ga0157370_10008545 | 3300013104 | Bacteria | 11036 |
| 136 | Ga0157370_10021030 | 3300013104 | Bacteria | 6506 |
| 137 | Ga0157370_10437364 | 3300013104 | Bacteria | 1203 |
| 138 | Ga0157369_10084073 | 3300013105 | Bacteria | 3403 |
| 139 | Ga0157369_10611862 | 3300013105 | Bacteria | 1124 |
| 140 | Ga0157374_10001973 | 3300013296 | Bacteria | 17209 |
| 141 | Ga0157378_10004445 | 3300013297 | Bacteria | 12331 |
| 142 | Ga0157378_10006836 | 3300013297 | Bacteria | 9948 |
| 143 | Ga0157378_10110488 | 3300013297 | Bacteria | 2520 |
| 144 | Ga0163162_10000585 | 3300013306 | Bacteria | 33759 |
| 145 | Ga0163162_10002465 | 3300013306 | Bacteria | 17469 |
| 146 | Ga0163162_10037640 | 3300013306 | Bacteria | 4828 |
| 147 | Ga0157372_10704034 | 3300013307 | Bacteria | 1175 |
| 148 | Ga0157375_10012600 | 3300013308 | Bacteria | 7504 |
| 149 | Ga0157375_10091621 | 3300013308 | Bacteria | 3102 |
| 150 | Ga0157375_10404736 | 3300013308 | Bacteria | 1531 |
| 151 | Ga0163163_10000541 | 3300014325 | Bacteria | 33456 |
| 152 | Ga0157380_10171392 | 3300014326 | Bacteria | 1897 |
| 153 | Ga0157377_10149154 | 3300014745 | Bacteria | 1444 |
| 154 | Ga0157379_10000597 | 3300014968 | Bacteria | 29148 |
| 155 | Ga0157379_10007200 | 3300014968 | Bacteria | 9622 |
| 156 | Ga0157376_10002086 | 3300014969 | Bacteria | 13438 |
| 157 | Ga0157376_10002895 | 3300014969 | Bacteria | 11764 |
| 158 | Ga0157376_10436916 | 3300014969 | Bacteria | 1273 |
| 159 | Ga0163161_10009956 | 3300017792 | Bacteria | 6586 |
| 160 | Ga0213872_10000063 | 3300021361 | Bacteria | 97755 |
| 161 | Ga0213872_10060349 | 3300021361 | Bacteria | 1715 |
| 162 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 163 | Ga0209784_100041 | 3300025224 | Bacteria | 228573 |
| 164 | Ga0209672_101610 | 3300025228 | Bacteria | 7544 |
| 165 | Ga0207425_1001839 | 3300025245 | Bacteria | 8205 |
| 166 | Ga0207425_1009474 | 3300025245 | Bacteria | 2418 |
| 167 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 168 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 169 | Ga0209759_1000026 | 3300025256 | Bacteria | 311743 |
| 170 | Ga0209129_1005065 | 3300025258 | Bacteria | 4838 |
| 171 | Ga0209233_1001032 | 3300025261 | Bacteria | 11766 |
| 172 | Ga0209455_1037151 | 3300025272 | Unclassified | 769 |
| 173 | Ga0209673_1002354 | 3300025273 | Bacteria | 13319 |
| 174 | Ga0209025_1001036 | 3300025294 | Bacteria | 40764 |
| 175 | Ga0209758_1002328 | 3300025297 | Bacteria | 19630 |
| 176 | Ga0209050_1000934 | 3300025298 | Bacteria | 38215 |
| 177 | Ga0209050_1003662 | 3300025298 | Bacteria | 11100 |
| 178 | Ga0209050_1015038 | 3300025298 | Bacteria | 3284 |
| 179 | Ga0209256_1008392 | 3300025299 | Bacteria | 4805 |
| 180 | Ga0209256_1013915 | 3300025299 | Bacteria | 2945 |
| 181 | Ga0209051_1006408 | 3300025303 | Bacteria | 6634 |
| 182 | Ga0209051_1011431 | 3300025303 | Bacteria | 4384 |
| 183 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 184 | Ga0207696_1002629 | 3300025711 | Bacteria | 8689 |
| 185 | Ga0207696_1006436 | 3300025711 | Bacteria | 4734 |
| 186 | Ga0207655_1000094 | 3300025728 | Bacteria | 196748 |
| 187 | Ga0207655_1003666 | 3300025728 | Bacteria | 11321 |
| 188 | Ga0207713_1006192 | 3300025735 | Bacteria | 7336 |
| 189 | Ga0207713_1026498 | 3300025735 | Bacteria | 2654 |
| 190 | Ga0207642_10065020 | 3300025899 | Unclassified | 1712 |
| 191 | Ga0207680_10000531 | 3300025903 | Bacteria | 18126 |
| 192 | Ga0207647_10000410 | 3300025904 | Bacteria | 35247 |
| 193 | Ga0207645_10277644 | 3300025907 | Bacteria | 1112 |
| 194 | Ga0207705_10000057 | 3300025909 | Bacteria | 157369 |
| 195 | Ga0207695_10029730 | 3300025913 | Bacteria | 6029 |
| 196 | Ga0207657_10171490 | 3300025919 | Bacteria | 1757 |
| 197 | Ga0207657_10359975 | 3300025919 | Bacteria | 1147 |
| 198 | Ga0207646_10002835 | 3300025922 | Bacteria | 20156 |
| 199 | Ga0207681_10391987 | 3300025923 | Bacteria | 1120 |
| 200 | Ga0207694_10097771 | 3300025924 | Bacteria | 2323 |
| 201 | Ga0207694_10488066 | 3300025924 | Bacteria | 1031 |
| 202 | Ga0207659_10226090 | 3300025926 | Unclassified | 1507 |
| 203 | Ga0207687_10000968 | 3300025927 | Bacteria | 19507 |
| 204 | Ga0207700_10239453 | 3300025928 | Bacteria | 1546 |
| 205 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 206 | Ga0207644_10004427 | 3300025931 | Bacteria | 9119 |
| 207 | Ga0207690_10004780 | 3300025932 | Bacteria | 7988 |
| 208 | Ga0207686_10002019 | 3300025934 | Bacteria | 11187 |
| 209 | Ga0207686_10033786 | 3300025934 | Bacteria | 3055 |
| 210 | Ga0207686_10068223 | 3300025934 | Bacteria | 2278 |
| 211 | Ga0207669_10063412 | 3300025937 | Bacteria | 2281 |
| 212 | Ga0207669_10126473 | 3300025937 | Unclassified | 1747 |
| 213 | Ga0207665_10190835 | 3300025939 | Unclassified | 1488 |
| 214 | Ga0207665_10472993 | 3300025939 | Bacteria | 965 |
| 215 | Ga0207691_10051811 | 3300025940 | Bacteria | 3751 |
| 216 | Ga0207691_10097850 | 3300025940 | Bacteria | 2622 |
| 217 | Ga0207711_10000970 | 3300025941 | Bacteria | 27457 |
| 218 | Ga0207711_10076348 | 3300025941 | Bacteria | 2917 |
| 219 | Ga0207689_10021042 | 3300025942 | Bacteria | 5484 |
| 220 | Ga0207667_10093850 | 3300025949 | Bacteria | 3099 |
| 221 | Ga0207668_10014057 | 3300025972 | Bacteria | 4949 |
| 222 | Ga0207668_10028338 | 3300025972 | Bacteria | 3661 |
| 223 | Ga0207677_10000206 | 3300026023 | Bacteria | 47813 |
| 224 | Ga0207703_10001244 | 3300026035 | Bacteria | 23862 |
| 225 | Ga0207703_10498594 | 3300026035 | Bacteria | 1143 |
| 226 | Ga0207639_10003427 | 3300026041 | Bacteria | 10664 |
| 227 | Ga0207639_10474509 | 3300026041 | Bacteria | 1139 |
| 228 | Ga0207702_10088545 | 3300026078 | Bacteria | 2705 |
| 229 | Ga0207702_10798240 | 3300026078 | Bacteria | 933 |
| 230 | Ga0207641_10112932 | 3300026088 | Bacteria | 2411 |
| 231 | Ga0207676_10000386 | 3300026095 | Bacteria | 37594 |
| 232 | Ga0207674_10233622 | 3300026116 | Bacteria | 1786 |
| 233 | Ga0207675_100167432 | 3300026118 | Bacteria | 2099 |
| 234 | Ga0207683_10088794 | 3300026121 | Unclassified | 2751 |
| 235 | Ga0207683_10134179 | 3300026121 | Unclassified | 2228 |
| 236 | Ga0207683_10172414 | 3300026121 | Bacteria | 1960 |
| 237 | Ga0209281_1000198 | 3300027111 | Bacteria | 136459 |
| 238 | Ga0207428_10497169 | 3300027907 | Bacteria | 886 |
| 239 | Ga0268266_10001432 | 3300028379 | Bacteria | 28461 |
| 240 | Ga0268266_10024495 | 3300028379 | Bacteria | 5132 |
| 241 | Ga0268266_10053925 | 3300028379 | Bacteria | 3455 |
| 242 | Ga0268265_10198835 | 3300028380 | Bacteria | 1737 |
| 243 | Ga0268264_10001587 | 3300028381 | Bacteria | 21048 |
| 244 | Ga0268264_10139536 | 3300028381 | Unclassified | 2160 |
| 245 | Ga0265326_10042209 | 3300028558 | Bacteria | 1294 |
| 246 | Ga0265323_10010586 | 3300028653 | Unclassified | 3736 |
| 247 | Ga0265336_10000815 | 3300028666 | Bacteria | 16376 |
| 248 | Ga0265336_10082483 | 3300028666 | Unclassified | 959 |
| 249 | Ga0265324_10000023 | 3300029957 | Bacteria | 164128 |
| 250 | Ga0265324_10000381 | 3300029957 | Bacteria | 32068 |
| 251 | Ga0265325_10000099 | 3300031241 | Bacteria | 61211 |
| 252 | Ga0265325_10127913 | 3300031241 | Bacteria | 1219 |
| 253 | Ga0265327_10043538 | 3300031251 | Bacteria | 2401 |
| 254 | Ga0265327_10184570 | 3300031251 | Bacteria | 952 |
| 255 | Ga0307509_10095354 | 3300031507 | Bacteria | 3031 |
| 256 | Ga0265314_10000756 | 3300031711 | Bacteria | 38675 |
| 257 | Ga0265314_10034821 | 3300031711 | Bacteria | 3674 |
| 258 | Ga0307412_10000629 | 3300031911 | Bacteria | 20571 |
| 259 | Ga0307414_10000030 | 3300032004 | Bacteria | 187373 |
| 260 | Ga0307414_10053975 | 3300032004 | Bacteria | 2806 |
| 261 | Ga0307414_10194009 | 3300032004 | Bacteria | 1646 |
| 262 | Ga0307510_10010031 | 3300033180 | Bacteria | 11255 |
| 263 | Ga0307510_10223706 | 3300033180 | Bacteria | 1391 |
| 264 | Ga0373954_0002282 | 3300035118 | Bacteria | 7988 |
| 265 | Ga0373956_0265137 | 3300035119 | Bacteria | 817 |
| 266 | Ga0373943_0085674 | 3300035170 | Bacteria | 1623 |
| 267 | Ga0373927_0111246 | 3300035695 | Bacteria | 1785 |
| 268 | Ga0373933_0202205 | 3300035724 | Bacteria | 1271 |
| 269 | Ga0373947_0081752 | 3300035725 | Bacteria | 2001 |
| 270 | Ga0373937_0074707 | 3300036401 | Bacteria | 3128 |
| 271 | Ga0373925_0024109 | 3300037068 | Bacteria | 4441 |
| 272 | Ga0400483_096366 | 3300039062 | Bacteria | 9894 |
| 273 | Ga0400483_189746 | 3300039062 | Bacteria | 26083 |
| 274 | Ga0436365_1141939 | 3300039437 | Unclassified | 1149 |
| 275 | Ga0436361_0552481 | 3300039447 | Bacteria | 3428 |
| 276 | Ga0436361_0811061 | 3300039447 | Bacteria | 135576 |
| 277 | Ga0439452_000031 | 3300042010 | Bacteria | 196691 |
| 278 | Ga0439456_000119 | 3300042013 | Bacteria | 24617 |
| 279 | Ga0450906_009471 | 3300042145 | Bacteria | 1858 |
| 280 | Ga0439464_0003279 | 3300042439 | Bacteria | 4071 |
| 281 | Ga0451577_0000052 | 3300042876 | Bacteria | 291030 |
| 282 | Ga0451577_0000465 | 3300042876 | Bacteria | 70232 |
| 283 | Ga0466963_0166928 | 3300044694 | Bacteria | 1534 |
| 284 | Ga0453684_0001383 | 3300044712 | Bacteria | 70232 |
| 285 | Ga0453684_0001941 | 3300044712 | Bacteria | 53308 |
| 286 | Ga0453684_0003648 | 3300044712 | Bacteria | 34184 |
| 287 | Ga0453684_0004611 | 3300044712 | Bacteria | 28699 |
| 288 | Ga0453684_0021415 | 3300044712 | Bacteria | 9660 |
| 289 | Ga0453684_0023286 | 3300044712 | Bacteria | 9133 |
| 290 | Ga0453684_0028773 | 3300044712 | Bacteria | 7912 |
| 291 | Ga0453684_0059083 | 3300044712 | Unclassified | 4948 |
| 292 | Ga0453684_0074100 | 3300044712 | Bacteria | 4288 |
| 293 | Ga0453684_0089833 | 3300044712 | Bacteria | 3797 |
| 294 | Ga0453684_0244912 | 3300044712 | Bacteria | 2062 |
| 295 | Ga0453684_0898176 | 3300044712 | Bacteria | 949 |
| 296 | Ga0451576_0003894 | 3300045051 | Bacteria | 19970 |
| 297 | Ga0451576_0007917 | 3300045051 | Bacteria | 12580 |
| 298 | Ga0451576_0026019 | 3300045051 | Bacteria | 6297 |
| 299 | Ga0451576_0417596 | 3300045051 | Bacteria | 1407 |
| 300 | Ga0451576_0548679 | 3300045051 | Bacteria | 1214 |
| 301 | Ga0451576_0654321 | 3300045051 | Bacteria | 1104 |
| 302 | Ga0495592_0151293 | 3300046454 | Bacteria | 1605 |
| 303 | Ga0495629_0004408 | 3300046459 | Bacteria | 10543 |
| 304 | Ga0495629_0097112 | 3300046459 | Bacteria | 2055 |
| 305 | Ga0495638_0001554 | 3300046460 | Bacteria | 20587 |
| 306 | Ga0495641_0048560 | 3300046461 | Unclassified | 1946 |
| 307 | Ga0495651_0035862 | 3300046462 | Bacteria | 3861 |
| 308 | Ga0495651_0121069 | 3300046462 | Bacteria | 1922 |
| 309 | Ga0495582_0009618 | 3300046473 | Bacteria | 5323 |
| 310 | Ga0495639_0011072 | 3300046475 | Bacteria | 3887 |
| 311 | Ga0495662_0072991 | 3300046476 | Bacteria | 1664 |
| 312 | Ga0495585_0004565 | 3300046492 | Bacteria | 8956 |
| 313 | Ga0495607_0234626 | 3300046501 | Bacteria | 890 |
| 314 | Ga0495583_0077722 | 3300046506 | Bacteria | 1447 |
| 315 | Ga0495606_0046214 | 3300046507 | Bacteria | 2879 |
| 316 | Ga0495610_0000893 | 3300046512 | Bacteria | 27748 |
| 317 | Ga0495610_0011551 | 3300046512 | Bacteria | 5390 |
| 318 | Ga0495610_0037324 | 3300046512 | Bacteria | 2474 |
| 319 | Ga0495616_0016554 | 3300046513 | Bacteria | 4078 |
| 320 | Ga0495628_0296475 | 3300046516 | Bacteria | 1198 |
| 321 | Ga0495630_0000720 | 3300046517 | Bacteria | 23449 |
| 322 | Ga0495631_0123876 | 3300046518 | Bacteria | 1111 |
| 323 | Ga0495643_0006006 | 3300046522 | Bacteria | 8099 |
| 324 | Ga0495643_0009752 | 3300046522 | Bacteria | 5939 |
| 325 | Ga0495643_0319684 | 3300046522 | Bacteria | 702 |
| 326 | Ga0495648_0032906 | 3300046524 | Bacteria | 3394 |
| 327 | Ga0495648_0121091 | 3300046524 | Bacteria | 1406 |
| 328 | Ga0495652_0332738 | 3300046529 | Bacteria | 1094 |
| 329 | Ga0495640_0039793 | 3300046533 | Bacteria | 3297 |
| 330 | Ga0495640_0061103 | 3300046533 | Bacteria | 2561 |
| 331 | Ga0495586_0094917 | 3300046535 | Unclassified | 1650 |
| 332 | Ga0495587_0102961 | 3300046536 | Bacteria | 1644 |
| 333 | Ga0495609_0003004 | 3300046538 | Bacteria | 9949 |
| 334 | Ga0495609_0065880 | 3300046538 | Bacteria | 1596 |
| 335 | Ga0495597_0000834 | 3300046542 | Bacteria | 24225 |
| 336 | Ga0495597_0040053 | 3300046542 | Bacteria | 2095 |
| 337 | Ga0495622_0002744 | 3300046557 | Bacteria | 8426 |
| 338 | Ga0495622_0018053 | 3300046557 | Bacteria | 3285 |
| 339 | Ga0495633_0002543 | 3300046558 | Bacteria | 12798 |
| 340 | Ga0495634_0018420 | 3300046642 | Bacteria | 4971 |
| 341 | Ga0495634_0120186 | 3300046642 | Bacteria | 1683 |
| 342 | Ga0495611_0002210 | 3300046648 | Bacteria | 9045 |
| 343 | Ga0495625_0064380 | 3300046660 | Bacteria | 2586 |
| 344 | Ga0495635_0001213 | 3300046663 | Bacteria | 17235 |
| 345 | Ga0495635_0179746 | 3300046663 | Bacteria | 1438 |
| 346 | Ga0495661_0007280 | 3300046665 | Bacteria | 7714 |
| 347 | Ga0495661_0119017 | 3300046665 | Bacteria | 1461 |
| 348 | Ga0495588_0001986 | 3300046674 | Bacteria | 8748 |
| 349 | Ga0495657_0022136 | 3300046675 | Bacteria | 4557 |
| 350 | Ga0495658_0034983 | 3300046683 | Unclassified | 2760 |
| 351 | Ga0495624_0012421 | 3300046690 | Bacteria | 5822 |
| 352 | Ga0495670_0017136 | 3300046691 | Bacteria | 3563 |
| 353 | Ga0495671_0000500 | 3300046692 | Bacteria | 30197 |
| 354 | Ga0495671_0068424 | 3300046692 | Bacteria | 1746 |
| 355 | Ga0495649_0012363 | 3300046694 | Bacteria | 4971 |
| 356 | Ga0495649_0033017 | 3300046694 | Bacteria | 2849 |
| 357 | Ga0495581_0103776 | 3300047315 | Bacteria | 1652 |
| 358 | Ga0495604_0004387 | 3300047317 | Bacteria | 11167 |
| 359 | Ga0495604_0065019 | 3300047317 | Bacteria | 2778 |
| 360 | Ga0495674_0013049 | 3300047319 | Bacteria | 7821 |
| 361 | Ga0495674_0014315 | 3300047319 | Bacteria | 7428 |
| 362 | Ga0495676_0000093 | 3300047321 | Bacteria | 66312 |
| 363 | Ga0495676_0029707 | 3300047321 | Bacteria | 4652 |
| 364 | Ga0495680_0505311 | 3300047322 | Bacteria | 820 |
| 365 | Ga0495687_000011 | 3300047443 | Bacteria | 397225 |
| 366 | Ga0495673_0000566 | 3300047469 | Bacteria | 37632 |
| 367 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 368 | Ga0495686_0259959 | 3300047472 | Bacteria | 972 |
| 369 | Ga0495686_0288863 | 3300047472 | Bacteria | 909 |
| 370 | Ga0495593_0012371 | 3300047673 | Bacteria | 4877 |
| 371 | Ga0495626_0000843 | 3300048091 | Bacteria | 27491 |
| 372 | Ga0495626_0040030 | 3300048091 | Bacteria | 2215 |
| 373 | Ga0496100_0002818 | 3300048903 | Bacteria | 8915 |
| 374 | Ga0496100_0003277 | 3300048903 | Bacteria | 8413 |
| 375 | Ga0496100_0107023 | 3300048903 | Bacteria | 1937 |
| 376 | Ga0496101_0006948 | 3300048904 | Bacteria | 7313 |
| 377 | Ga0496101_0066995 | 3300048904 | Bacteria | 2620 |
| 378 | Ga0496102_0001727 | 3300048905 | Bacteria | 19121 |
| 379 | Ga0496102_0003631 | 3300048905 | Bacteria | 13052 |
| 380 | Ga0496102_0017709 | 3300048905 | Bacteria | 6245 |
| 381 | Ga0496102_0078313 | 3300048905 | Bacteria | 3043 |
| 382 | Ga0496102_0270139 | 3300048905 | Bacteria | 1603 |
| 383 | Ga0496103_0000572 | 3300048906 | Bacteria | 29210 |
| 384 | Ga0496103_0008681 | 3300048906 | Bacteria | 6034 |
| 385 | Ga0496103_0117298 | 3300048906 | Bacteria | 1694 |
| 386 | Ga0496104_0002691 | 3300048907 | Bacteria | 15306 |
| 387 | Ga0496104_0033944 | 3300048907 | Bacteria | 4756 |
| 388 | Ga0496104_0262920 | 3300048907 | Bacteria | 1638 |
| 389 | Ga0496105_0004214 | 3300048908 | Bacteria | 10803 |
| 390 | Ga0496105_0005455 | 3300048908 | Bacteria | 9649 |
| 391 | Ga0496105_0098401 | 3300048908 | Bacteria | 2415 |
| 392 | Ga0496107_0024196 | 3300048910 | Bacteria | 4296 |
| 393 | Ga0496107_0376963 | 3300048910 | Bacteria | 1055 |
| 394 | Ga0496108_0086509 | 3300048911 | Bacteria | 2661 |
| 395 | Ga0496108_0095505 | 3300048911 | Bacteria | 2531 |
| 396 | Ga0496109_0019728 | 3300048912 | Bacteria | 5948 |
| 397 | Ga0496109_0041663 | 3300048912 | Bacteria | 4159 |
| 398 | Ga0496109_0376707 | 3300048912 | Bacteria | 1341 |
| 399 | Ga0496109_0397890 | 3300048912 | Bacteria | 1301 |
| 400 | Ga0496110_0089859 | 3300048913 | Bacteria | 2746 |
| 401 | Ga0496110_0227989 | 3300048913 | Bacteria | 1694 |
| 402 | Ga0496111_0011447 | 3300048914 | Bacteria | 5975 |
| 403 | Ga0496111_0112657 | 3300048914 | Bacteria | 2004 |
| 404 | Ga0496112_0001534 | 3300048915 | Bacteria | 17824 |
| 405 | Ga0496112_0045130 | 3300048915 | Bacteria | 4320 |
| 406 | Ga0496112_0146334 | 3300048915 | Unclassified | 2331 |
| 407 | Ga0496112_0193134 | 3300048915 | Bacteria | 1997 |
| 408 | Ga0496113_0065085 | 3300048916 | Bacteria | 2758 |
| 409 | Ga0496114_0000410 | 3300048917 | Bacteria | 31786 |
| 410 | Ga0496114_0022380 | 3300048917 | Bacteria | 5151 |
| 411 | Ga0496114_0307289 | 3300048917 | Bacteria | 1400 |
| 412 | Ga0496116_0000024 | 3300048919 | Bacteria | 471420 |
| 413 | Ga0496116_0078317 | 3300048919 | Bacteria | 2062 |
| 414 | Ga0496116_0161808 | 3300048919 | Bacteria | 1227 |
| 415 | Ga0496117_0000775 | 3300048920 | Bacteria | 50341 |
| 416 | Ga0496117_0032812 | 3300048920 | Bacteria | 3938 |
| 417 | Ga0496117_0059785 | 3300048920 | Bacteria | 2630 |
| 418 | Ga0496118_0015783 | 3300048921 | Bacteria | 6968 |
| 419 | Ga0496118_0072295 | 3300048921 | Bacteria | 2478 |
| 420 | Ga0496119_0016293 | 3300048922 | Bacteria | 5665 |
| 421 | Ga0496119_0071817 | 3300048922 | Bacteria | 2025 |
| 422 | Ga0496119_0072319 | 3300048922 | Bacteria | 2015 |
| 423 | Ga0496121_0004764 | 3300048924 | Bacteria | 17909 |
| 424 | Ga0496121_0005975 | 3300048924 | Bacteria | 15379 |
| 425 | Ga0496121_0011434 | 3300048924 | Bacteria | 9856 |
| 426 | Ga0496122_0017192 | 3300048925 | Bacteria | 6779 |
| 427 | Ga0496122_0114624 | 3300048925 | Bacteria | 1758 |
| 428 | Ga0496123_0008662 | 3300048926 | Bacteria | 9299 |
| 429 | Ga0496123_0268631 | 3300048926 | Bacteria | 831 |
| 430 | Ga0496124_0002043 | 3300048927 | Bacteria | 27439 |
| 431 | Ga0496124_0097859 | 3300048927 | Bacteria | 2382 |
| 432 | Ga0496125_0000542 | 3300048928 | Bacteria | 64978 |
| 433 | Ga0496126_0008482 | 3300048929 | Bacteria | 11078 |
| 434 | Ga0496126_0063390 | 3300048929 | Bacteria | 3313 |
| 435 | Ga0496126_0131789 | 3300048929 | Bacteria | 2160 |
| 436 | Ga0496126_0370574 | 3300048929 | Bacteria | 1168 |
| 437 | Ga0495682_0001416 | 3300049460 | Bacteria | 13012 |
| 438 | Ga0495682_0002093 | 3300049460 | Bacteria | 9730 |
| 439 | Ga0501070_0035058 | 3300049586 | Bacteria | 4194 |
| 440 | Ga0501076_0363808 | 3300049592 | Bacteria | 1188 |
| 441 | nmdc:mga05p37_37594_c1 | 3300050507 | Bacteria | 5936 |
| 442 | nmdc:mga09592_290592_c1 | 3300050508 | Bacteria | 1417 |
| 443 | nmdc:mga08y16_49514_c1 | 3300050511 | Bacteria | 4397 |
| 444 | nmdc:mga0n895_26918_c1 | 3300050512 | Bacteria | 5455 |
| 445 | nmdc:mga08x19_263361_c1 | 3300050514 | Bacteria | 1192 |
| 446 | nmdc:mga0a205_226298_c1 | 3300050515 | Bacteria | 1755 |
| 447 | nmdc:mga0sz30_164874_c1 | 3300050516 | Bacteria | 982 |
| 448 | Ga0500635_0053200 | 3300053080 | Bacteria | 1392 |
| 449 | Ga0500578_0012282 | 3300053086 | Bacteria | 5532 |
| 450 | Ga0500578_0068684 | 3300053086 | Bacteria | 2259 |
| 451 | Ga0500578_0228079 | 3300053086 | Bacteria | 1130 |
| 452 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 453 | Ga0500643_000434 | 3300053087 | Bacteria | 31543 |
| 454 | Ga0500646_0004895 | 3300053090 | Bacteria | 3395 |
| 455 | Ga0500583_0050850 | 3300053092 | Bacteria | 1923 |
| 456 | Ga0500651_0403285 | 3300053093 | Bacteria | 768 |
| 457 | Ga0500555_004262 | 3300053103 | Bacteria | 4067 |
| 458 | Ga0500556_0028662 | 3300053104 | Bacteria | 1870 |
| 459 | Ga0500556_0057028 | 3300053104 | Bacteria | 1428 |
| 460 | Ga0500556_0096077 | 3300053104 | Bacteria | 1136 |
| 461 | Ga0500569_000485 | 3300053109 | Bacteria | 6577 |
| 462 | Ga0500608_025422 | 3300053122 | Bacteria | 2771 |
| 463 | Ga0500642_0000980 | 3300053130 | Bacteria | 8206 |
| 464 | Ga0500658_0006868 | 3300053134 | Bacteria | 4213 |
| 465 | Ga0500658_0034474 | 3300053134 | Bacteria | 1998 |
| 466 | Ga0500559_0000584 | 3300053136 | Bacteria | 25005 |
| 467 | Ga0500559_0002128 | 3300053136 | Bacteria | 10543 |
| 468 | Ga0500559_0048652 | 3300053136 | Bacteria | 1865 |
| 469 | Ga0500559_0094013 | 3300053136 | Bacteria | 1375 |
| 470 | Ga0500564_024998 | 3300053138 | Bacteria | 2742 |
| 471 | Ga0500564_059921 | 3300053138 | Bacteria | 1728 |
| 472 | Ga0500573_0024913 | 3300053140 | Bacteria | 3440 |
| 473 | Ga0500588_0062074 | 3300053146 | Bacteria | 1201 |
| 474 | Ga0500588_0062497 | 3300053146 | Bacteria | 1198 |
| 475 | Ga0500589_090618 | 3300053147 | Bacteria | 1348 |
| 476 | Ga0500590_082614 | 3300053148 | Bacteria | 1575 |
| 477 | Ga0500604_0000001 | 3300053151 | Bacteria | 174619 |
| 478 | Ga0500604_0033309 | 3300053151 | Bacteria | 1523 |
| 479 | Ga0500616_0003150 | 3300053153 | Bacteria | 12876 |
| 480 | Ga0500619_024882 | 3300053154 | Bacteria | 1766 |
| 481 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 482 | Ga0500622_0008425 | 3300053156 | Bacteria | 5767 |
| 483 | Ga0500622_0033263 | 3300053156 | Bacteria | 2703 |
| 484 | Ga0500638_032444 | 3300053162 | Bacteria | 2522 |
| 485 | Ga0500636_0000076 | 3300053177 | Bacteria | 48321 |
| 486 | Ga0500611_017781 | 3300053727 | Bacteria | 1300 |
| 487 | Ga0500645_011547 | 3300053730 | Bacteria | 2881 |
| 488 | Ga0500599_000148 | 3300053736 | Bacteria | 6364 |
| 489 | Ga0500601_000030 | 3300053737 | Bacteria | 31644 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046522 | Ga0495643_0319684 | Ga0495643_0319684_17_625 | 172 |
| 2 | 3300053146 | Ga0500588_0062497 | Ga0500588_0062497_608_1183 | 172 |
| 3 | 3300048907 | Ga0496104_0262920 | Ga0496104_0262920_156_860 | 199 |
| 4 | 3300048908 | Ga0496105_0098401 | Ga0496105_0098401_1197_1901 | 199 |
| 5 | 3300048911 | Ga0496108_0086509 | Ga0496108_0086509_1573_2277 | 199 |
| 6 | 3300048912 | Ga0496109_0019728 | Ga0496109_0019728_4242_4946 | 199 |
| 7 | 3300048914 | Ga0496111_0112657 | Ga0496111_0112657_607_1311 | 199 |
| 8 | 3300048915 | Ga0496112_0045130 | Ga0496112_0045130_2787_3491 | 199 |
| 9 | 3300048916 | Ga0496113_0065085 | Ga0496113_0065085_1726_2430 | 199 |
| 10 | 3300032004 | Ga0307414_10194009 | Ga0307414_101940092 | 200 |
| 11 | iso_pu_bacteria | 2929160207 | 2929161117 | 207 |
| 12 | 3300003751 | Ga0055538_1000068 | Ga0055538_100006839 | 208 |
| 13 | iso_pu_bacteria | 2969304461 | 2969308715 | 208 |
| 14 | iso_pu_bacteria | 8029995093 | 8029996858 | 208 |
| 15 | 3300005336 | Ga0070680_100431635 | Ga0070680_1004316352 | 210 |
| 16 | 3300009147 | Ga0114129_10117416 | Ga0114129_101174162 | 210 |
| 17 | 3300005330 | Ga0070690_100000691 | Ga0070690_1000006917 | 211 |
| 18 | 3300005334 | Ga0068869_100011002 | Ga0068869_1000110022 | 211 |
| 19 | 3300005334 | Ga0068869_100639176 | Ga0068869_1006391761 | 211 |
| 20 | 3300005335 | Ga0070666_10001834 | Ga0070666_100018348 | 211 |
| 21 | 3300005338 | Ga0068868_100001999 | Ga0068868_1000019998 | 211 |
| 22 | 3300005339 | Ga0070660_100581743 | Ga0070660_1005817432 | 211 |
| 23 | 3300005340 | Ga0070689_100029808 | Ga0070689_1000298081 | 211 |
| 24 | 3300005347 | Ga0070668_100732622 | Ga0070668_1007326221 | 211 |
| 25 | 3300005355 | Ga0070671_100006127 | Ga0070671_1000061275 | 211 |
| 26 | 3300005355 | Ga0070671_100509064 | Ga0070671_1005090641 | 211 |
| 27 | 3300005365 | Ga0070688_100003007 | Ga0070688_1000030073 | 211 |
| 28 | 3300005456 | Ga0070678_100073654 | Ga0070678_1000736542 | 211 |
| 29 | 3300005457 | Ga0070662_100114572 | Ga0070662_1001145723 | 211 |
| 30 | 3300005466 | Ga0070685_10004994 | Ga0070685_100049947 | 211 |
| 31 | 3300005536 | Ga0070697_100040020 | Ga0070697_1000400203 | 211 |
| 32 | 3300005539 | Ga0068853_100004714 | Ga0068853_1000047147 | 211 |
| 33 | 3300005539 | Ga0068853_100254350 | Ga0068853_1002543502 | 211 |
| 34 | 3300005543 | Ga0070672_100053776 | Ga0070672_1000537764 | 211 |
| 35 | 3300005546 | Ga0070696_100030891 | Ga0070696_1000308914 | 211 |
| 36 | 3300005547 | Ga0070693_100531045 | Ga0070693_1005310451 | 211 |
| 37 | 3300005548 | Ga0070665_100073513 | Ga0070665_1000735132 | 211 |
| 38 | 3300005577 | Ga0068857_100377113 | Ga0068857_1003771132 | 211 |
| 39 | 3300005615 | Ga0070702_100281341 | Ga0070702_1002813412 | 211 |
| 40 | 3300005615 | Ga0070702_100475259 | Ga0070702_1004752591 | 211 |
| 41 | 3300005616 | Ga0068852_100097322 | Ga0068852_1000973221 | 211 |
| 42 | 3300005617 | Ga0068859_100000752 | Ga0068859_1000007527 | 211 |
| 43 | 3300005618 | Ga0068864_100001479 | Ga0068864_10000147913 | 211 |
| 44 | 3300005718 | Ga0068866_10121699 | Ga0068866_101216992 | 211 |
| 45 | 3300005718 | Ga0068866_10165207 | Ga0068866_101652072 | 211 |
| 46 | 3300005834 | Ga0068851_10031595 | Ga0068851_100315952 | 211 |
| 47 | 3300005841 | Ga0068863_100056587 | Ga0068863_1000565872 | 211 |
| 48 | 3300005842 | Ga0068858_100003128 | Ga0068858_1000031289 | 211 |
| 49 | 3300005843 | Ga0068860_100005794 | Ga0068860_1000057948 | 211 |
| 50 | 3300005843 | Ga0068860_100085237 | Ga0068860_1000852372 | 211 |
| 51 | 3300006237 | Ga0097621_100003468 | Ga0097621_1000034689 | 211 |
| 52 | 3300006237 | Ga0097621_100013394 | Ga0097621_1000133945 | 211 |
| 53 | 3300006358 | Ga0068871_100002423 | Ga0068871_1000024238 | 211 |
| 54 | 3300006358 | Ga0068871_100004395 | Ga0068871_1000043959 | 211 |
| 55 | 3300006852 | Ga0075433_10203924 | Ga0075433_102039242 | 211 |
| 56 | 3300006871 | Ga0075434_100311406 | Ga0075434_1003114062 | 211 |
| 57 | 3300006931 | Ga0097620_100000752 | Ga0097620_1000007527 | 211 |
| 58 | 3300009036 | Ga0105244_10004943 | Ga0105244_100049433 | 211 |
| 59 | 3300009092 | Ga0105250_10005778 | Ga0105250_100057783 | 211 |
| 60 | 3300009092 | Ga0105250_10015292 | Ga0105250_100152922 | 211 |
| 61 | 3300009098 | Ga0105245_10004921 | Ga0105245_100049215 | 211 |
| 62 | 3300009098 | Ga0105245_10005949 | Ga0105245_100059497 | 211 |
| 63 | 3300009101 | Ga0105247_10032030 | Ga0105247_100320304 | 211 |
| 64 | 3300009176 | Ga0105242_10004520 | Ga0105242_100045204 | 211 |
| 65 | 3300009176 | Ga0105242_10010848 | Ga0105242_100108486 | 211 |
| 66 | 3300009176 | Ga0105242_10123242 | Ga0105242_101232422 | 211 |
| 67 | 3300009177 | Ga0105248_10010760 | Ga0105248_100107608 | 211 |
| 68 | 3300009177 | Ga0105248_10198894 | Ga0105248_101988942 | 211 |
| 69 | 3300010375 | Ga0105239_10744571 | Ga0105239_107445711 | 211 |
| 70 | 3300011119 | Ga0105246_10013581 | Ga0105246_100135815 | 211 |
| 71 | 3300013102 | Ga0157371_10080426 | Ga0157371_100804263 | 211 |
| 72 | 3300013104 | Ga0157370_10437364 | Ga0157370_104373642 | 211 |
| 73 | 3300013296 | Ga0157374_10001973 | Ga0157374_100019738 | 211 |
| 74 | 3300013297 | Ga0157378_10004445 | Ga0157378_100044458 | 211 |
| 75 | 3300013297 | Ga0157378_10006836 | Ga0157378_100068364 | 211 |
| 76 | 3300013306 | Ga0163162_10000585 | Ga0163162_1000058526 | 211 |
| 77 | 3300013306 | Ga0163162_10002465 | Ga0163162_1000246510 | 211 |
| 78 | 3300013308 | Ga0157375_10012600 | Ga0157375_100126007 | 211 |
| 79 | 3300013308 | Ga0157375_10091621 | Ga0157375_100916212 | 211 |
| 80 | 3300014325 | Ga0163163_10000541 | Ga0163163_100005418 | 211 |
| 81 | 3300014745 | Ga0157377_10149154 | Ga0157377_101491542 | 211 |
| 82 | 3300014968 | Ga0157379_10000597 | Ga0157379_1000059723 | 211 |
| 83 | 3300014969 | Ga0157376_10002086 | Ga0157376_100020868 | 211 |
| 84 | 3300014969 | Ga0157376_10002895 | Ga0157376_100028955 | 211 |
| 85 | 3300025728 | Ga0207655_1003666 | Ga0207655_10036662 | 211 |
| 86 | 3300025899 | Ga0207642_10065020 | Ga0207642_100650202 | 211 |
| 87 | 3300025903 | Ga0207680_10000531 | Ga0207680_100005318 | 211 |
| 88 | 3300025913 | Ga0207695_10029730 | Ga0207695_100297304 | 211 |
| 89 | 3300025919 | Ga0207657_10171490 | Ga0207657_101714903 | 211 |
| 90 | 3300025927 | Ga0207687_10000968 | Ga0207687_1000096810 | 211 |
| 91 | 3300025928 | Ga0207700_10239453 | Ga0207700_102394532 | 211 |
| 92 | 3300025931 | Ga0207644_10004427 | Ga0207644_100044276 | 211 |
| 93 | 3300025934 | Ga0207686_10002019 | Ga0207686_100020194 | 211 |
| 94 | 3300025934 | Ga0207686_10033786 | Ga0207686_100337863 | 211 |
| 95 | 3300025934 | Ga0207686_10068223 | Ga0207686_100682233 | 211 |
| 96 | 3300025939 | Ga0207665_10190835 | Ga0207665_101908352 | 211 |
| 97 | 3300025939 | Ga0207665_10472993 | Ga0207665_104729932 | 211 |
| 98 | 3300025940 | Ga0207691_10097850 | Ga0207691_100978503 | 211 |
| 99 | 3300025941 | Ga0207711_10000970 | Ga0207711_1000097014 | 211 |
| 100 | 3300025942 | Ga0207689_10021042 | Ga0207689_100210425 | 211 |
| 101 | 3300025972 | Ga0207668_10014057 | Ga0207668_100140573 | 211 |
| 102 | 3300026023 | Ga0207677_10000206 | Ga0207677_1000020617 | 211 |
| 103 | 3300026035 | Ga0207703_10001244 | Ga0207703_1000124410 | 211 |
| 104 | 3300026078 | Ga0207702_10088545 | Ga0207702_100885453 | 211 |
| 105 | 3300026088 | Ga0207641_10112932 | Ga0207641_101129322 | 211 |
| 106 | 3300026095 | Ga0207676_10000386 | Ga0207676_1000038617 | 211 |
| 107 | 3300026121 | Ga0207683_10088794 | Ga0207683_100887942 | 211 |
| 108 | 3300026121 | Ga0207683_10134179 | Ga0207683_101341792 | 211 |
| 109 | 3300028379 | Ga0268266_10053925 | Ga0268266_100539254 | 211 |
| 110 | 3300028381 | Ga0268264_10001587 | Ga0268264_1000158713 | 211 |
| 111 | 3300028381 | Ga0268264_10139536 | Ga0268264_101395362 | 211 |
| 112 | 3300035724 | Ga0373933_0202205 | Ga0373933_0202205_557_1240 | 211 |
| 113 | 3300045051 | Ga0451576_0654321 | Ga0451576_0654321_39_722 | 211 |
| 114 | 3300047317 | Ga0495604_0065019 | Ga0495604_0065019_482_1165 | 211 |
| 115 | 3300047472 | Ga0495686_0288863 | Ga0495686_0288863_174_899 | 211 |
| 116 | 3300048919 | Ga0496116_0000024 | Ga0496116_0000024_156737_157420 | 211 |
| 117 | 3300048925 | Ga0496122_0114624 | Ga0496122_0114624_515_1207 | 211 |
| 118 | 3300049460 | Ga0495682_0001416 | Ga0495682_0001416_11939_12622 | 211 |
| 119 | 3300050516 | nmdc:mga0sz30_164874_c1 | nmdc:mga0sz30_164874_c1_54_749 | 211 |
| 120 | 3300053736 | Ga0500599_000148 | Ga0500599_000148_4477_5202 | 211 |
| 121 | iso_pu_bacteria | 2571042143 | 2571529885 | 211 |
| 122 | iso_pu_bacteria | 2599185240 | 2599747869 | 211 |
| 123 | iso_pu_bacteria | 2599185355 | 2600209780 | 211 |
| 124 | iso_pu_bacteria | 2675903129 | 2676745956 | 211 |
| 125 | 3300003760 | Ga0055527_1000940 | Ga0055527_10009402 | 212 |
| 126 | 3300025228 | Ga0209672_101610 | Ga0209672_1016102 | 212 |
| 127 | 3300042013 | Ga0439456_000119 | Ga0439456_000119_15095_15781 | 212 |
| 128 | iso_pu_bacteria | 2516653085 | 2517081510 | 212 |
| 129 | iso_pu_bacteria | 2585427526 | 2585526598 | 212 |
| 130 | iso_pu_bacteria | 2643221591 | 2643964962 | 212 |
| 131 | iso_pu_bacteria | 2643221621 | 2644123297 | 212 |
| 132 | iso_pu_bacteria | 2718217997 | 2719664692 | 212 |
| 133 | iso_pu_bacteria | 2718218199 | 2720491112 | 212 |
| 134 | iso_pu_bacteria | 2718218232 | 2720612479 | 212 |
| 135 | iso_pu_bacteria | 2718218423 | 2721398665 | 212 |
| 136 | iso_pu_bacteria | 2721755556 | 2723026138 | 212 |
| 137 | iso_pu_bacteria | 2721755809 | 2724037478 | 212 |
| 138 | iso_pu_bacteria | 2721755823 | 2724109402 | 212 |
| 139 | iso_pu_bacteria | 2728369352 | 2730107074 | 212 |
| 140 | iso_pu_bacteria | 2791355265 | 2793355127 | 212 |
| 141 | iso_pu_bacteria | 2802429605 | 2805926505 | 212 |
| 142 | iso_pu_bacteria | 2824704595 | 2824707748 | 212 |
| 143 | iso_pu_bacteria | 2824753945 | 2824758056 | 212 |
| 144 | iso_pu_bacteria | 2824763712 | 2824766194 | 212 |
| 145 | iso_pu_bacteria | 2838016132 | 2838017361 | 212 |
| 146 | iso_pu_bacteria | 2838048938 | 2838049157 | 212 |
| 147 | iso_pu_bacteria | 2838061910 | 2838063397 | 212 |
| 148 | iso_pu_bacteria | 2838668709 | 2838670920 | 212 |
| 149 | iso_pu_bacteria | 2838686498 | 2838688529 | 212 |
| 150 | iso_pu_bacteria | 2838701080 | 2838703291 | 212 |
| 151 | iso_pu_bacteria | 2838729681 | 2838736894 | 212 |
| 152 | iso_pu_bacteria | 2838742623 | 2838746796 | 212 |
| 153 | iso_pu_bacteria | 2841851746 | 2841852270 | 212 |
| 154 | iso_pu_bacteria | 2842146304 | 2842147485 | 212 |
| 155 | iso_pu_bacteria | 2842156927 | 2842158656 | 212 |
| 156 | iso_pu_bacteria | 2842180545 | 2842182270 | 212 |
| 157 | iso_pu_bacteria | 2842192696 | 2842198022 | 212 |
| 158 | iso_pu_bacteria | 2842229732 | 2842234719 | 212 |
| 159 | iso_pu_bacteria | 2842243621 | 2842248450 | 212 |
| 160 | iso_pu_bacteria | 2842250916 | 2842252551 | 212 |
| 161 | iso_pu_bacteria | 2842257432 | 2842262377 | 212 |
| 162 | iso_pu_bacteria | 2842271015 | 2842272521 | 212 |
| 163 | iso_pu_bacteria | 2842304105 | 2842310906 | 212 |
| 164 | iso_pu_bacteria | 2842317721 | 2842318579 | 212 |
| 165 | iso_pu_bacteria | 2842395702 | 2842398180 | 212 |
| 166 | iso_pu_bacteria | 2842447887 | 2842452615 | 212 |
| 167 | iso_pu_bacteria | 2842489311 | 2842493830 | 212 |
| 168 | iso_pu_bacteria | 2842495871 | 2842497214 | 212 |
| 169 | iso_pu_bacteria | 2842733646 | 2842734430 | 212 |
| 170 | iso_pu_bacteria | 2844425489 | 2844428082 | 212 |
| 171 | iso_pu_bacteria | 2844454524 | 2844461418 | 212 |
| 172 | iso_pu_bacteria | 2874628541 | 2874636014 | 212 |
| 173 | iso_pu_bacteria | 2891670763 | 2891671335 | 212 |
| 174 | iso_pu_bacteria | 2904711408 | 2904718454 | 212 |
| 175 | iso_pu_bacteria | 2933570622 | 2933577401 | 212 |
| 176 | iso_pu_bacteria | 2933594066 | 2933597151 | 212 |
| 177 | iso_pu_bacteria | 2939642701 | 2939643295 | 212 |
| 178 | iso_pu_bacteria | 8005275841 | 8005279666 | 212 |
| 179 | iso_pu_bacteria | 8005395548 | 8005400298 | 212 |
| 180 | iso_pu_bacteria | 8005430974 | 8005437154 | 212 |
| 181 | iso_pu_bacteria | 8005619151 | 8005620601 | 212 |
| 182 | iso_pu_bacteria | 8005695170 | 8005698703 | 212 |
| 183 | iso_pu_bacteria | 8018176218 | 8018182584 | 212 |
| 184 | iso_pu_bacteria | 8024501048 | 8024503179 | 212 |
| 185 | iso_pu_bacteria | 8056382006 | 8056384673 | 212 |
| 186 | iso_pu_bacteria | 8056967851 | 8056969561 | 212 |
| 187 | 3300005327 | Ga0070658_10000427 | Ga0070658_1000042723 | 213 |
| 188 | 3300013100 | Ga0157373_10000216 | Ga0157373_1000021628 | 213 |
| 189 | 3300025224 | Ga0209784_100041 | Ga0209784_100041173 | 213 |
| 190 | 3300025937 | Ga0207669_10063412 | Ga0207669_100634123 | 213 |
| 191 | 3300027907 | Ga0207428_10497169 | Ga0207428_104971692 | 213 |
| 192 | 3300044712 | Ga0453684_0074100 | Ga0453684_0074100_2819_3511 | 213 |
| 193 | 3300044712 | Ga0453684_0089833 | Ga0453684_0089833_360_1049 | 213 |
| 194 | 3300046692 | Ga0495671_0000500 | Ga0495671_0000500_16022_16717 | 213 |
| 195 | 3300048091 | Ga0495626_0000843 | Ga0495626_0000843_10765_11460 | 213 |
| 196 | 3300050511 | nmdc:mga08y16_49514_c1 | nmdc:mga08y16_49514_c1_3384_4073 | 213 |
| 197 | iso_pu_bacteria | 2855195626 | 2855197035 | 213 |
| 198 | iso_pu_bacteria | 2871272651 | 2871275659 | 213 |
| 199 | iso_pu_bacteria | 2977268062 | 2977272034 | 213 |
| 200 | 3300046542 | Ga0495597_0000834 | Ga0495597_0000834_11386_12081 | 214 |
| 201 | 3300002067 | JGI24735J21928_10001863 | JGI24735J21928_100018635 | 215 |
| 202 | 3300005328 | Ga0070676_10291930 | Ga0070676_102919301 | 215 |
| 203 | 3300005347 | Ga0070668_100003531 | Ga0070668_10000353111 | 215 |
| 204 | 3300005354 | Ga0070675_100100003 | Ga0070675_1001000031 | 215 |
| 205 | 3300005356 | Ga0070674_100144990 | Ga0070674_1001449903 | 215 |
| 206 | 3300005459 | Ga0068867_100358938 | Ga0068867_1003589381 | 215 |
| 207 | 3300005543 | Ga0070672_100571890 | Ga0070672_1005718902 | 215 |
| 208 | 3300005719 | Ga0068861_100198632 | Ga0068861_1001986323 | 215 |
| 209 | 3300005937 | Ga0081455_10308979 | Ga0081455_103089791 | 215 |
| 210 | 3300009011 | Ga0105251_10005673 | Ga0105251_100056736 | 215 |
| 211 | 3300009551 | Ga0105238_10472930 | Ga0105238_104729301 | 215 |
| 212 | 3300009553 | Ga0105249_10365268 | Ga0105249_103652682 | 215 |
| 213 | 3300025735 | Ga0207713_1006192 | Ga0207713_10061926 | 215 |
| 214 | 3300025907 | Ga0207645_10277644 | Ga0207645_102776442 | 215 |
| 215 | 3300025924 | Ga0207694_10488066 | Ga0207694_104880662 | 215 |
| 216 | 3300025926 | Ga0207659_10226090 | Ga0207659_102260902 | 215 |
| 217 | 3300025937 | Ga0207669_10126473 | Ga0207669_101264732 | 215 |
| 218 | 3300025940 | Ga0207691_10051811 | Ga0207691_100518112 | 215 |
| 219 | 3300025972 | Ga0207668_10028338 | Ga0207668_100283382 | 215 |
| 220 | 3300026118 | Ga0207675_100167432 | Ga0207675_1001674323 | 215 |
| 221 | 3300028666 | Ga0265336_10000815 | Ga0265336_100008156 | 215 |
| 222 | 3300029957 | Ga0265324_10000023 | Ga0265324_1000002372 | 215 |
| 223 | 3300031241 | Ga0265325_10000099 | Ga0265325_1000009915 | 215 |
| 224 | 3300031711 | Ga0265314_10034821 | Ga0265314_100348214 | 215 |
| 225 | 3300035725 | Ga0373947_0081752 | Ga0373947_0081752_673_1377 | 215 |
| 226 | 3300039062 | Ga0400483_096366 | Ga0400483_096366_304_1062 | 215 |
| 227 | 3300039062 | Ga0400483_189746 | Ga0400483_189746_11510_12268 | 215 |
| 228 | 3300044694 | Ga0466963_0166928 | Ga0466963_0166928_592_1296 | 215 |
| 229 | 3300044712 | Ga0453684_0004611 | Ga0453684_0004611_23930_24628 | 215 |
| 230 | 3300044712 | Ga0453684_0898176 | Ga0453684_0898176_171_866 | 215 |
| 231 | 3300046459 | Ga0495629_0097112 | Ga0495629_0097112_156_860 | 215 |
| 232 | 3300046461 | Ga0495641_0048560 | Ga0495641_0048560_912_1616 | 215 |
| 233 | 3300046473 | Ga0495582_0009618 | Ga0495582_0009618_1698_2402 | 215 |
| 234 | 3300046476 | Ga0495662_0072991 | Ga0495662_0072991_479_1183 | 215 |
| 235 | 3300046517 | Ga0495630_0000720 | Ga0495630_0000720_2604_3308 | 215 |
| 236 | 3300046529 | Ga0495652_0332738 | Ga0495652_0332738_216_920 | 215 |
| 237 | 3300046533 | Ga0495640_0039793 | Ga0495640_0039793_836_1540 | 215 |
| 238 | 3300046535 | Ga0495586_0094917 | Ga0495586_0094917_903_1607 | 215 |
| 239 | 3300046642 | Ga0495634_0018420 | Ga0495634_0018420_765_1469 | 215 |
| 240 | 3300046683 | Ga0495658_0034983 | Ga0495658_0034983_257_961 | 215 |
| 241 | 3300047319 | Ga0495674_0013049 | Ga0495674_0013049_5559_6254 | 215 |
| 242 | 3300047319 | Ga0495674_0014315 | Ga0495674_0014315_986_1690 | 215 |
| 243 | 3300047443 | Ga0495687_000011 | Ga0495687_000011_5669_6364 | 215 |
| 244 | 3300047472 | Ga0495686_0000014 | Ga0495686_0000014_15754_16485 | 215 |
| 245 | 3300047673 | Ga0495593_0012371 | Ga0495593_0012371_1543_2238 | 215 |
| 246 | 3300048903 | Ga0496100_0002818 | Ga0496100_0002818_3635_4330 | 215 |
| 247 | 3300048904 | Ga0496101_0066995 | Ga0496101_0066995_1553_2248 | 215 |
| 248 | 3300048905 | Ga0496102_0003631 | Ga0496102_0003631_5579_6274 | 215 |
| 249 | 3300048906 | Ga0496103_0117298 | Ga0496103_0117298_944_1639 | 215 |
| 250 | 3300048915 | Ga0496112_0193134 | Ga0496112_0193134_307_1002 | 215 |
| 251 | 3300048919 | Ga0496116_0161808 | Ga0496116_0161808_88_783 | 215 |
| 252 | 3300048920 | Ga0496117_0059785 | Ga0496117_0059785_1176_1871 | 215 |
| 253 | 3300048926 | Ga0496123_0268631 | Ga0496123_0268631_10_705 | 215 |
| 254 | 3300048927 | Ga0496124_0002043 | Ga0496124_0002043_369_1151 | 215 |
| 255 | iso_pu_bacteria | 2919509842 | 2919510877 | 215 |
| 256 | 3300002704 | JGI25155J39150_1000028 | JGI25155J39150_100002849 | 216 |
| 257 | 3300002705 | JGI25156J39149_1000013 | JGI25156J39149_100001364 | 216 |
| 258 | 3300002738 | JGI25154J39366_1000032 | JGI25154J39366_100003264 | 216 |
| 259 | 3300002741 | JGI25157J39369_1000017 | JGI25157J39369_100001764 | 216 |
| 260 | 3300003187 | JGI25151J46595_10006611 | JGI25151J46595_100066115 | 216 |
| 261 | 3300003214 | JGI25165J46597_1014655 | JGI25165J46597_10146551 | 216 |
| 262 | 3300003320 | rootH2_10022911 | rootH2_1002291116 | 216 |
| 263 | 3300003323 | rootH1_10032066 | rootH1_100320662 | 216 |
| 264 | 3300003790 | Ga0055528_1002119 | Ga0055528_100211910 | 216 |
| 265 | 3300003794 | Ga0055531_10000007 | Ga0055531_10000007195 | 216 |
| 266 | 3300004625 | Ga0055543_1002571 | Ga0055543_10025712 | 216 |
| 267 | 3300005262 | Ga0065165_1000278 | Ga0065165_100027824 | 216 |
| 268 | 3300005327 | Ga0070658_10435737 | Ga0070658_104357371 | 216 |
| 269 | 3300005347 | Ga0070668_100005392 | Ga0070668_1000053925 | 216 |
| 270 | 3300005366 | Ga0070659_100036364 | Ga0070659_1000363643 | 216 |
| 271 | 3300005367 | Ga0070667_100030603 | Ga0070667_1000306036 | 216 |
| 272 | 3300005468 | Ga0070707_100001508 | Ga0070707_10000150817 | 216 |
| 273 | 3300005518 | Ga0070699_100020489 | Ga0070699_1000204896 | 216 |
| 274 | 3300005546 | Ga0070696_100499855 | Ga0070696_1004998551 | 216 |
| 275 | 3300005547 | Ga0070693_100299989 | Ga0070693_1002999892 | 216 |
| 276 | 3300005548 | Ga0070665_100000191 | Ga0070665_10000019163 | 216 |
| 277 | 3300005563 | Ga0068855_100052223 | Ga0068855_1000522232 | 216 |
| 278 | 3300005563 | Ga0068855_100074327 | Ga0068855_1000743272 | 216 |
| 279 | 3300005617 | Ga0068859_100038942 | Ga0068859_1000389426 | 216 |
| 280 | 3300005983 | Ga0081540_1003477 | Ga0081540_10034774 | 216 |
| 281 | 3300006353 | Ga0075370_10211104 | Ga0075370_102111042 | 216 |
| 282 | 3300006358 | Ga0068871_100153155 | Ga0068871_1001531552 | 216 |
| 283 | 3300006931 | Ga0097620_100038942 | Ga0097620_1000389426 | 216 |
| 284 | 3300009036 | Ga0105244_10004206 | Ga0105244_100042069 | 216 |
| 285 | 3300009092 | Ga0105250_10003815 | Ga0105250_100038155 | 216 |
| 286 | 3300009101 | Ga0105247_10000813 | Ga0105247_100008134 | 216 |
| 287 | 3300009147 | Ga0114129_10035722 | Ga0114129_100357225 | 216 |
| 288 | 3300009177 | Ga0105248_10342474 | Ga0105248_103424742 | 216 |
| 289 | 3300009545 | Ga0105237_10056227 | Ga0105237_100562274 | 216 |
| 290 | 3300009551 | Ga0105238_10111414 | Ga0105238_101114144 | 216 |
| 291 | 3300010375 | Ga0105239_10001689 | Ga0105239_100016899 | 216 |
| 292 | 3300010375 | Ga0105239_10122016 | Ga0105239_101220162 | 216 |
| 293 | 3300013100 | Ga0157373_10079870 | Ga0157373_100798702 | 216 |
| 294 | 3300013102 | Ga0157371_10014810 | Ga0157371_100148108 | 216 |
| 295 | 3300013104 | Ga0157370_10008545 | Ga0157370_100085453 | 216 |
| 296 | 3300013105 | Ga0157369_10084073 | Ga0157369_100840732 | 216 |
| 297 | 3300013306 | Ga0163162_10037640 | Ga0163162_100376404 | 216 |
| 298 | 3300013307 | Ga0157372_10704034 | Ga0157372_107040342 | 216 |
| 299 | 3300013308 | Ga0157375_10404736 | Ga0157375_104047362 | 216 |
| 300 | 3300017792 | Ga0163161_10009956 | Ga0163161_100099562 | 216 |
| 301 | 3300021361 | Ga0213872_10000063 | Ga0213872_1000006323 | 216 |
| 302 | 3300021361 | Ga0213872_10060349 | Ga0213872_100603492 | 216 |
| 303 | 3300025206 | Ga0209435_100003 | Ga0209435_100003107 | 216 |
| 304 | 3300025245 | Ga0207425_1009474 | Ga0207425_10094742 | 216 |
| 305 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008107 | 216 |
| 306 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007107 | 216 |
| 307 | 3300025256 | Ga0209759_1000026 | Ga0209759_1000026172 | 216 |
| 308 | 3300025258 | Ga0209129_1005065 | Ga0209129_10050652 | 216 |
| 309 | 3300025261 | Ga0209233_1001032 | Ga0209233_10010326 | 216 |
| 310 | 3300025272 | Ga0209455_1037151 | Ga0209455_10371511 | 216 |
| 311 | 3300025273 | Ga0209673_1002354 | Ga0209673_100235411 | 216 |
| 312 | 3300025294 | Ga0209025_1001036 | Ga0209025_100103634 | 216 |
| 313 | 3300025297 | Ga0209758_1002328 | Ga0209758_100232821 | 216 |
| 314 | 3300025298 | Ga0209050_1000934 | Ga0209050_100093433 | 216 |
| 315 | 3300025298 | Ga0209050_1003662 | Ga0209050_10036623 | 216 |
| 316 | 3300025299 | Ga0209256_1008392 | Ga0209256_10083923 | 216 |
| 317 | 3300025299 | Ga0209256_1013915 | Ga0209256_10139153 | 216 |
| 318 | 3300025303 | Ga0209051_1006408 | Ga0209051_10064082 | 216 |
| 319 | 3300025303 | Ga0209051_1011431 | Ga0209051_10114313 | 216 |
| 320 | 3300025304 | Ga0209257_1000021 | Ga0209257_100002133 | 216 |
| 321 | 3300025711 | Ga0207696_1002629 | Ga0207696_10026295 | 216 |
| 322 | 3300025711 | Ga0207696_1006436 | Ga0207696_10064362 | 216 |
| 323 | 3300025728 | Ga0207655_1000094 | Ga0207655_100009453 | 216 |
| 324 | 3300025735 | Ga0207713_1026498 | Ga0207713_10264983 | 216 |
| 325 | 3300025919 | Ga0207657_10359975 | Ga0207657_103599751 | 216 |
| 326 | 3300025922 | Ga0207646_10002835 | Ga0207646_1000283513 | 216 |
| 327 | 3300025924 | Ga0207694_10097771 | Ga0207694_100977712 | 216 |
| 328 | 3300025932 | Ga0207690_10004780 | Ga0207690_100047808 | 216 |
| 329 | 3300025941 | Ga0207711_10076348 | Ga0207711_100763482 | 216 |
| 330 | 3300025949 | Ga0207667_10093850 | Ga0207667_100938502 | 216 |
| 331 | 3300026035 | Ga0207703_10498594 | Ga0207703_104985941 | 216 |
| 332 | 3300026041 | Ga0207639_10474509 | Ga0207639_104745092 | 216 |
| 333 | 3300028379 | Ga0268266_10001432 | Ga0268266_1000143219 | 216 |
| 334 | 3300028379 | Ga0268266_10024495 | Ga0268266_100244954 | 216 |
| 335 | 3300028666 | Ga0265336_10082483 | Ga0265336_100824832 | 216 |
| 336 | 3300029957 | Ga0265324_10000381 | Ga0265324_1000038115 | 216 |
| 337 | 3300031241 | Ga0265325_10127913 | Ga0265325_101279132 | 216 |
| 338 | 3300031251 | Ga0265327_10043538 | Ga0265327_100435382 | 216 |
| 339 | 3300031251 | Ga0265327_10184570 | Ga0265327_101845701 | 216 |
| 340 | 3300031711 | Ga0265314_10000756 | Ga0265314_1000075623 | 216 |
| 341 | 3300032004 | Ga0307414_10053975 | Ga0307414_100539753 | 216 |
| 342 | 3300033180 | Ga0307510_10010031 | Ga0307510_100100316 | 216 |
| 343 | 3300033180 | Ga0307510_10223706 | Ga0307510_102237061 | 216 |
| 344 | 3300035118 | Ga0373954_0002282 | Ga0373954_0002282_5239_5937 | 216 |
| 345 | 3300035119 | Ga0373956_0265137 | Ga0373956_0265137_91_789 | 216 |
| 346 | 3300035170 | Ga0373943_0085674 | Ga0373943_0085674_294_992 | 216 |
| 347 | 3300035695 | Ga0373927_0111246 | Ga0373927_0111246_507_1205 | 216 |
| 348 | 3300036401 | Ga0373937_0074707 | Ga0373937_0074707_2163_2861 | 216 |
| 349 | 3300037068 | Ga0373925_0024109 | Ga0373925_0024109_2590_3288 | 216 |
| 350 | 3300039447 | Ga0436361_0552481 | Ga0436361_0552481_920_1618 | 216 |
| 351 | 3300039447 | Ga0436361_0811061 | Ga0436361_0811061_130729_131427 | 216 |
| 352 | 3300042010 | Ga0439452_000031 | Ga0439452_000031_50342_51040 | 216 |
| 353 | 3300042439 | Ga0439464_0003279 | Ga0439464_0003279_2866_3564 | 216 |
| 354 | 3300042876 | Ga0451577_0000465 | Ga0451577_0000465_55537_56238 | 216 |
| 355 | 3300044712 | Ga0453684_0001383 | Ga0453684_0001383_13995_14696 | 216 |
| 356 | 3300044712 | Ga0453684_0028773 | Ga0453684_0028773_4420_5121 | 216 |
| 357 | 3300044712 | Ga0453684_0059083 | Ga0453684_0059083_4004_4807 | 216 |
| 358 | 3300045051 | Ga0451576_0026019 | Ga0451576_0026019_4520_5230 | 216 |
| 359 | 3300045051 | Ga0451576_0417596 | Ga0451576_0417596_426_1124 | 216 |
| 360 | 3300045051 | Ga0451576_0548679 | Ga0451576_0548679_484_1182 | 216 |
| 361 | 3300046454 | Ga0495592_0151293 | Ga0495592_0151293_442_1149 | 216 |
| 362 | 3300046459 | Ga0495629_0004408 | Ga0495629_0004408_5954_6661 | 216 |
| 363 | 3300046460 | Ga0495638_0001554 | Ga0495638_0001554_8637_9335 | 216 |
| 364 | 3300046462 | Ga0495651_0035862 | Ga0495651_0035862_760_1467 | 216 |
| 365 | 3300046462 | Ga0495651_0121069 | Ga0495651_0121069_505_1203 | 216 |
| 366 | 3300046475 | Ga0495639_0011072 | Ga0495639_0011072_31_729 | 216 |
| 367 | 3300046492 | Ga0495585_0004565 | Ga0495585_0004565_625_1323 | 216 |
| 368 | 3300046501 | Ga0495607_0234626 | Ga0495607_0234626_90_788 | 216 |
| 369 | 3300046506 | Ga0495583_0077722 | Ga0495583_0077722_90_830 | 216 |
| 370 | 3300046507 | Ga0495606_0046214 | Ga0495606_0046214_1942_2682 | 216 |
| 371 | 3300046512 | Ga0495610_0000893 | Ga0495610_0000893_19621_20319 | 216 |
| 372 | 3300046512 | Ga0495610_0011551 | Ga0495610_0011551_134_832 | 216 |
| 373 | 3300046512 | Ga0495610_0037324 | Ga0495610_0037324_937_1635 | 216 |
| 374 | 3300046513 | Ga0495616_0016554 | Ga0495616_0016554_1040_1738 | 216 |
| 375 | 3300046516 | Ga0495628_0296475 | Ga0495628_0296475_286_993 | 216 |
| 376 | 3300046522 | Ga0495643_0006006 | Ga0495643_0006006_7142_7840 | 216 |
| 377 | 3300046522 | Ga0495643_0009752 | Ga0495643_0009752_4810_5511 | 216 |
| 378 | 3300046524 | Ga0495648_0032906 | Ga0495648_0032906_29_769 | 216 |
| 379 | 3300046533 | Ga0495640_0061103 | Ga0495640_0061103_29_736 | 216 |
| 380 | 3300046536 | Ga0495587_0102961 | Ga0495587_0102961_140_847 | 216 |
| 381 | 3300046538 | Ga0495609_0003004 | Ga0495609_0003004_5139_5837 | 216 |
| 382 | 3300046542 | Ga0495597_0040053 | Ga0495597_0040053_243_941 | 216 |
| 383 | 3300046557 | Ga0495622_0018053 | Ga0495622_0018053_668_1375 | 216 |
| 384 | 3300046558 | Ga0495633_0002543 | Ga0495633_0002543_3086_3784 | 216 |
| 385 | 3300046642 | Ga0495634_0120186 | Ga0495634_0120186_788_1495 | 216 |
| 386 | 3300046648 | Ga0495611_0002210 | Ga0495611_0002210_560_1258 | 216 |
| 387 | 3300046660 | Ga0495625_0064380 | Ga0495625_0064380_366_1064 | 216 |
| 388 | 3300046663 | Ga0495635_0001213 | Ga0495635_0001213_11429_12136 | 216 |
| 389 | 3300046663 | Ga0495635_0179746 | Ga0495635_0179746_252_950 | 216 |
| 390 | 3300046665 | Ga0495661_0007280 | Ga0495661_0007280_6618_7316 | 216 |
| 391 | 3300046675 | Ga0495657_0022136 | Ga0495657_0022136_2266_2973 | 216 |
| 392 | 3300046690 | Ga0495624_0012421 | Ga0495624_0012421_3352_4059 | 216 |
| 393 | 3300046691 | Ga0495670_0017136 | Ga0495670_0017136_2529_3227 | 216 |
| 394 | 3300046692 | Ga0495671_0068424 | Ga0495671_0068424_69_809 | 216 |
| 395 | 3300046694 | Ga0495649_0012363 | Ga0495649_0012363_3803_4501 | 216 |
| 396 | 3300046694 | Ga0495649_0033017 | Ga0495649_0033017_198_938 | 216 |
| 397 | 3300047315 | Ga0495581_0103776 | Ga0495581_0103776_831_1538 | 216 |
| 398 | 3300047317 | Ga0495604_0004387 | Ga0495604_0004387_8441_9148 | 216 |
| 399 | 3300047321 | Ga0495676_0029707 | Ga0495676_0029707_3754_4461 | 216 |
| 400 | 3300047322 | Ga0495680_0505311 | Ga0495680_0505311_18_716 | 216 |
| 401 | 3300047469 | Ga0495673_0000566 | Ga0495673_0000566_31341_32039 | 216 |
| 402 | 3300047472 | Ga0495686_0259959 | Ga0495686_0259959_111_851 | 216 |
| 403 | 3300048903 | Ga0496100_0003277 | Ga0496100_0003277_5141_5839 | 216 |
| 404 | 3300048903 | Ga0496100_0107023 | Ga0496100_0107023_532_1230 | 216 |
| 405 | 3300048904 | Ga0496101_0006948 | Ga0496101_0006948_3344_4042 | 216 |
| 406 | 3300048905 | Ga0496102_0001727 | Ga0496102_0001727_11200_11898 | 216 |
| 407 | 3300048905 | Ga0496102_0017709 | Ga0496102_0017709_171_869 | 216 |
| 408 | 3300048905 | Ga0496102_0078313 | Ga0496102_0078313_1373_2116 | 216 |
| 409 | 3300048905 | Ga0496102_0270139 | Ga0496102_0270139_852_1559 | 216 |
| 410 | 3300048906 | Ga0496103_0000572 | Ga0496103_0000572_11177_11875 | 216 |
| 411 | 3300048906 | Ga0496103_0008681 | Ga0496103_0008681_4226_4924 | 216 |
| 412 | 3300048907 | Ga0496104_0002691 | Ga0496104_0002691_1388_2086 | 216 |
| 413 | 3300048907 | Ga0496104_0033944 | Ga0496104_0033944_3208_3915 | 216 |
| 414 | 3300048908 | Ga0496105_0004214 | Ga0496105_0004214_9912_10619 | 216 |
| 415 | 3300048908 | Ga0496105_0005455 | Ga0496105_0005455_3216_3914 | 216 |
| 416 | 3300048910 | Ga0496107_0024196 | Ga0496107_0024196_758_1456 | 216 |
| 417 | 3300048910 | Ga0496107_0376963 | Ga0496107_0376963_134_877 | 216 |
| 418 | 3300048911 | Ga0496108_0095505 | Ga0496108_0095505_112_810 | 216 |
| 419 | 3300048912 | Ga0496109_0041663 | Ga0496109_0041663_2108_2806 | 216 |
| 420 | 3300048912 | Ga0496109_0376707 | Ga0496109_0376707_302_1000 | 216 |
| 421 | 3300048912 | Ga0496109_0397890 | Ga0496109_0397890_18_716 | 216 |
| 422 | 3300048913 | Ga0496110_0089859 | Ga0496110_0089859_1747_2490 | 216 |
| 423 | 3300048913 | Ga0496110_0227989 | Ga0496110_0227989_827_1549 | 216 |
| 424 | 3300048914 | Ga0496111_0011447 | Ga0496111_0011447_1608_2306 | 216 |
| 425 | 3300048915 | Ga0496112_0001534 | Ga0496112_0001534_1111_1809 | 216 |
| 426 | 3300048915 | Ga0496112_0146334 | Ga0496112_0146334_1344_2066 | 216 |
| 427 | 3300048917 | Ga0496114_0000410 | Ga0496114_0000410_69_767 | 216 |
| 428 | 3300048917 | Ga0496114_0022380 | Ga0496114_0022380_4015_4713 | 216 |
| 429 | 3300048917 | Ga0496114_0307289 | Ga0496114_0307289_86_784 | 216 |
| 430 | 3300048919 | Ga0496116_0078317 | Ga0496116_0078317_55_753 | 216 |
| 431 | 3300048920 | Ga0496117_0032812 | Ga0496117_0032812_2449_3147 | 216 |
| 432 | 3300048921 | Ga0496118_0015783 | Ga0496118_0015783_1101_1841 | 216 |
| 433 | 3300048921 | Ga0496118_0072295 | Ga0496118_0072295_1505_2203 | 216 |
| 434 | 3300048922 | Ga0496119_0016293 | Ga0496119_0016293_1990_2697 | 216 |
| 435 | 3300048922 | Ga0496119_0071817 | Ga0496119_0071817_1271_2011 | 216 |
| 436 | 3300048922 | Ga0496119_0072319 | Ga0496119_0072319_988_1686 | 216 |
| 437 | 3300048924 | Ga0496121_0005975 | Ga0496121_0005975_11385_12083 | 216 |
| 438 | 3300048924 | Ga0496121_0011434 | Ga0496121_0011434_6147_6857 | 216 |
| 439 | 3300048925 | Ga0496122_0017192 | Ga0496122_0017192_1822_2574 | 216 |
| 440 | 3300048926 | Ga0496123_0008662 | Ga0496123_0008662_3827_4579 | 216 |
| 441 | 3300048927 | Ga0496124_0097859 | Ga0496124_0097859_128_835 | 216 |
| 442 | 3300048928 | Ga0496125_0000542 | Ga0496125_0000542_30788_31540 | 216 |
| 443 | 3300048929 | Ga0496126_0008482 | Ga0496126_0008482_7083_7781 | 216 |
| 444 | 3300048929 | Ga0496126_0063390 | Ga0496126_0063390_1105_1812 | 216 |
| 445 | 3300048929 | Ga0496126_0131789 | Ga0496126_0131789_90_788 | 216 |
| 446 | 3300048929 | Ga0496126_0370574 | Ga0496126_0370574_271_969 | 216 |
| 447 | 3300049460 | Ga0495682_0002093 | Ga0495682_0002093_8064_8804 | 216 |
| 448 | 3300049592 | Ga0501076_0363808 | Ga0501076_0363808_113_823 | 216 |
| 449 | 3300050512 | nmdc:mga0n895_26918_c1 | nmdc:mga0n895_26918_c1_4008_4706 | 216 |
| 450 | 3300050515 | nmdc:mga0a205_226298_c1 | nmdc:mga0a205_226298_c1_613_1311 | 216 |
| 451 | 3300053080 | Ga0500635_0053200 | Ga0500635_0053200_664_1374 | 216 |
| 452 | 3300053086 | Ga0500578_0012282 | Ga0500578_0012282_271_969 | 216 |
| 453 | 3300053086 | Ga0500578_0068684 | Ga0500578_0068684_388_1128 | 216 |
| 454 | 3300053086 | Ga0500578_0228079 | Ga0500578_0228079_360_1058 | 216 |
| 455 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_67657_68364 | 216 |
| 456 | 3300053087 | Ga0500643_000434 | Ga0500643_000434_11230_11940 | 216 |
| 457 | 3300053090 | Ga0500646_0004895 | Ga0500646_0004895_588_1286 | 216 |
| 458 | 3300053092 | Ga0500583_0050850 | Ga0500583_0050850_1053_1760 | 216 |
| 459 | 3300053093 | Ga0500651_0403285 | Ga0500651_0403285_56_754 | 216 |
| 460 | 3300053103 | Ga0500555_004262 | Ga0500555_004262_2243_2950 | 216 |
| 461 | 3300053104 | Ga0500556_0028662 | Ga0500556_0028662_227_940 | 216 |
| 462 | 3300053104 | Ga0500556_0057028 | Ga0500556_0057028_198_938 | 216 |
| 463 | 3300053104 | Ga0500556_0096077 | Ga0500556_0096077_199_897 | 216 |
| 464 | 3300053109 | Ga0500569_000485 | Ga0500569_000485_4865_5563 | 216 |
| 465 | 3300053122 | Ga0500608_025422 | Ga0500608_025422_553_1263 | 216 |
| 466 | 3300053130 | Ga0500642_0000980 | Ga0500642_0000980_4013_4720 | 216 |
| 467 | 3300053134 | Ga0500658_0006868 | Ga0500658_0006868_3145_3852 | 216 |
| 468 | 3300053134 | Ga0500658_0034474 | Ga0500658_0034474_145_843 | 216 |
| 469 | 3300053136 | Ga0500559_0000584 | Ga0500559_0000584_13941_14639 | 216 |
| 470 | 3300053136 | Ga0500559_0002128 | Ga0500559_0002128_5719_6417 | 216 |
| 471 | 3300053136 | Ga0500559_0048652 | Ga0500559_0048652_229_939 | 216 |
| 472 | 3300053136 | Ga0500559_0094013 | Ga0500559_0094013_560_1258 | 216 |
| 473 | 3300053138 | Ga0500564_024998 | Ga0500564_024998_931_1629 | 216 |
| 474 | 3300053138 | Ga0500564_059921 | Ga0500564_059921_1000_1710 | 216 |
| 475 | 3300053140 | Ga0500573_0024913 | Ga0500573_0024913_721_1419 | 216 |
| 476 | 3300053146 | Ga0500588_0062074 | Ga0500588_0062074_181_888 | 216 |
| 477 | 3300053147 | Ga0500589_090618 | Ga0500589_090618_297_1004 | 216 |
| 478 | 3300053151 | Ga0500604_0033309 | Ga0500604_0033309_476_1183 | 216 |
| 479 | 3300053153 | Ga0500616_0003150 | Ga0500616_0003150_11908_12606 | 216 |
| 480 | 3300053154 | Ga0500619_024882 | Ga0500619_024882_504_1214 | 216 |
| 481 | 3300053156 | Ga0500622_0000001 | Ga0500622_0000001_171263_171961 | 216 |
| 482 | 3300053156 | Ga0500622_0008425 | Ga0500622_0008425_333_1073 | 216 |
| 483 | 3300053156 | Ga0500622_0033263 | Ga0500622_0033263_583_1281 | 216 |
| 484 | 3300053162 | Ga0500638_032444 | Ga0500638_032444_928_1638 | 216 |
| 485 | 3300053177 | Ga0500636_0000076 | Ga0500636_0000076_17017_17727 | 216 |
| 486 | 3300053730 | Ga0500645_011547 | Ga0500645_011547_1076_1789 | 216 |
| 487 | 3300053737 | Ga0500601_000030 | Ga0500601_000030_15995_16693 | 216 |
| 488 | iso_pu_bacteria | 2861691609 | 2861695117 | 216 |
| 489 | 3300006173 | Ga0070716_100125466 | Ga0070716_1001254662 | 217 |
| 490 | 3300006946 | Ga0079104_1000627 | Ga0079104_100062713 | 217 |
| 491 | 3300009553 | Ga0105249_10207736 | Ga0105249_102077362 | 217 |
| 492 | 3300013100 | Ga0157373_10045759 | Ga0157373_100457592 | 217 |
| 493 | 3300013104 | Ga0157370_10000154 | Ga0157370_1000015416 | 217 |
| 494 | 3300013105 | Ga0157369_10611862 | Ga0157369_106118622 | 217 |
| 495 | 3300014968 | Ga0157379_10007200 | Ga0157379_1000720010 | 217 |
| 496 | 3300025245 | Ga0207425_1001839 | Ga0207425_10018395 | 217 |
| 497 | 3300025298 | Ga0209050_1015038 | Ga0209050_10150381 | 217 |
| 498 | 3300026116 | Ga0207674_10233622 | Ga0207674_102336222 | 217 |
| 499 | 3300027111 | Ga0209281_1000198 | Ga0209281_1000198115 | 217 |
| 500 | 3300028380 | Ga0268265_10198835 | Ga0268265_101988352 | 217 |
| 501 | 3300028558 | Ga0265326_10042209 | Ga0265326_100422092 | 217 |
| 502 | 3300028653 | Ga0265323_10010586 | Ga0265323_100105862 | 217 |
| 503 | 3300031911 | Ga0307412_10000629 | Ga0307412_1000062911 | 217 |
| 504 | 3300032004 | Ga0307414_10000030 | Ga0307414_10000030107 | 217 |
| 505 | 3300042145 | Ga0450906_009471 | Ga0450906_009471_609_1379 | 217 |
| 506 | 3300044712 | Ga0453684_0001941 | Ga0453684_0001941_20503_21291 | 217 |
| 507 | 3300044712 | Ga0453684_0021415 | Ga0453684_0021415_2531_3229 | 217 |
| 508 | 3300045051 | Ga0451576_0003894 | Ga0451576_0003894_14038_14736 | 217 |
| 509 | 3300046518 | Ga0495631_0123876 | Ga0495631_0123876_133_873 | 217 |
| 510 | 3300046524 | Ga0495648_0121091 | Ga0495648_0121091_88_828 | 217 |
| 511 | 3300046538 | Ga0495609_0065880 | Ga0495609_0065880_293_1033 | 217 |
| 512 | 3300046557 | Ga0495622_0002744 | Ga0495622_0002744_469_1209 | 217 |
| 513 | 3300046665 | Ga0495661_0119017 | Ga0495661_0119017_188_928 | 217 |
| 514 | 3300046674 | Ga0495588_0001986 | Ga0495588_0001986_7932_8672 | 217 |
| 515 | 3300047321 | Ga0495676_0000093 | Ga0495676_0000093_14471_15211 | 217 |
| 516 | 3300048091 | Ga0495626_0040030 | Ga0495626_0040030_353_1093 | 217 |
| 517 | 3300048920 | Ga0496117_0000775 | Ga0496117_0000775_22531_23232 | 217 |
| 518 | 3300048924 | Ga0496121_0004764 | Ga0496121_0004764_10291_10992 | 217 |
| 519 | 3300049586 | Ga0501070_0035058 | Ga0501070_0035058_1823_2530 | 217 |
| 520 | 3300050514 | nmdc:mga08x19_263361_c1 | nmdc:mga08x19_263361_c1_415_1122 | 217 |
| 521 | 3300053148 | Ga0500590_082614 | Ga0500590_082614_533_1279 | 217 |
| 522 | 3300053151 | Ga0500604_0000001 | Ga0500604_0000001_33111_33878 | 217 |
| 523 | iso_pu_bacteria | 2574179768 | 2574431873 | 217 |
| 524 | 3300003323 | rootH1_10306814 | rootH1_103068142 | 218 |
| 525 | 3300005295 | Ga0065707_10277394 | Ga0065707_102773942 | 218 |
| 526 | 3300005353 | Ga0070669_100124600 | Ga0070669_1001246003 | 218 |
| 527 | 3300005355 | Ga0070671_100000001 | Ga0070671_1000000011123 | 218 |
| 528 | 3300005356 | Ga0070674_100254096 | Ga0070674_1002540961 | 218 |
| 529 | 3300005441 | Ga0070700_100560128 | Ga0070700_1005601281 | 218 |
| 530 | 3300005455 | Ga0070663_100322199 | Ga0070663_1003221991 | 218 |
| 531 | 3300005456 | Ga0070678_100026668 | Ga0070678_1000266683 | 218 |
| 532 | 3300005518 | Ga0070699_100001291 | Ga0070699_10000129117 | 218 |
| 533 | 3300005549 | Ga0070704_100024796 | Ga0070704_1000247963 | 218 |
| 534 | 3300006844 | Ga0075428_100222407 | Ga0075428_1002224072 | 218 |
| 535 | 3300009147 | Ga0114129_10083943 | Ga0114129_100839432 | 218 |
| 536 | 3300013104 | Ga0157370_10021030 | Ga0157370_100210303 | 218 |
| 537 | 3300013297 | Ga0157378_10110488 | Ga0157378_101104883 | 218 |
| 538 | 3300014326 | Ga0157380_10171392 | Ga0157380_101713923 | 218 |
| 539 | 3300014969 | Ga0157376_10436916 | Ga0157376_104369162 | 218 |
| 540 | 3300025923 | Ga0207681_10391987 | Ga0207681_103919872 | 218 |
| 541 | 3300025931 | Ga0207644_10000001 | Ga0207644_10000001314 | 218 |
| 542 | 3300026041 | Ga0207639_10003427 | Ga0207639_100034278 | 218 |
| 543 | 3300026121 | Ga0207683_10172414 | Ga0207683_101724143 | 218 |
| 544 | 3300031507 | Ga0307509_10095354 | Ga0307509_100953544 | 218 |
| 545 | 3300042876 | Ga0451577_0000052 | Ga0451577_0000052_190568_191287 | 218 |
| 546 | 3300044712 | Ga0453684_0003648 | Ga0453684_0003648_25953_26657 | 218 |
| 547 | 3300044712 | Ga0453684_0244912 | Ga0453684_0244912_629_1333 | 218 |
| 548 | 3300045051 | Ga0451576_0007917 | Ga0451576_0007917_4693_5397 | 218 |
| 549 | 3300050507 | nmdc:mga05p37_37594_c1 | nmdc:mga05p37_37594_c1_777_1478 | 218 |
| 550 | 3300050508 | nmdc:mga09592_290592_c1 | nmdc:mga09592_290592_c1_615_1316 | 218 |
| 551 | 3300001904 | JGI24736J21556_1017273 | JGI24736J21556_10172732 | 219 |
| 552 | 3300005327 | Ga0070658_10006490 | Ga0070658_100064902 | 219 |
| 553 | 3300005530 | Ga0070679_100076783 | Ga0070679_1000767833 | 219 |
| 554 | 3300005614 | Ga0068856_100192675 | Ga0068856_1001926753 | 219 |
| 555 | 3300006880 | Ga0075429_100829581 | Ga0075429_1008295811 | 219 |
| 556 | 3300025904 | Ga0207647_10000410 | Ga0207647_1000041013 | 219 |
| 557 | 3300025909 | Ga0207705_10000057 | Ga0207705_10000057104 | 219 |
| 558 | 3300026078 | Ga0207702_10798240 | Ga0207702_107982402 | 219 |
| 559 | 3300039437 | Ga0436365_1141939 | Ga0436365_1141939_318_1040 | 219 |
| 560 | 3300044712 | Ga0453684_0023286 | Ga0453684_0023286_7685_8398 | 219 |
| 561 | 3300053727 | Ga0500611_017781 | Ga0500611_017781_431_1135 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1e5q-assembly2.cif.gz_D | ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine | 0.5525 | 1 | 30 |
| 3wse-assembly1.cif.gz_A | reduced hcgd from methanocaldococcus jannaschii | 0.5469 | 1 | 29 |
| 6ihd-assembly1.cif.gz_A-2 | crystal structure of malate dehydrogenase from metallosphaera sedula | 0.5345 | 3 | 170 |
| 6ihd-assembly1.cif.gz_B | crystal structure of malate dehydrogenase from metallosphaera sedula | 0.5236 | 3 | 157 |
| 4j3c-assembly1.cif.gz_A | crystal structure of 16s ribosomal rna methyltransferase rsme | 0.5234 | 2 | 33 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLW5_8_225_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.896 | 8 | 211 | 3.40.50.620 |
| af_P9WLW5_8_225_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8378 | 8 | 211 | 3.40.50.620 |
| af_Q94HW2_515_690_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.6386 | 149 | 181 | 3.30.420.10 |
| af_O88712_64_123_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.5658 | 129 | 174 | 3.90.180.10 |
| af_Q5TIN9_33_321_3.90.1480.20 | Alpha Beta;Alpha-Beta Complex;sialyltransferase cstii, chain A;Glycosyl transferase family 29 | 0.5653 | 2 | 32 | 3.90.1480.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A367RHY6-F1-model_v4 | WbqC-like protein | 0.9622 | 3 | 219 |
|
| AF-A0A418X0J1-F1-model_v4 | Glycine transferase | 0.962 | 2 | 219 |
GO:0016020
|
| AF-A0A0Q8Q7J6-F1-model_v4 | WbqC-like protein | 0.9616 | 2 | 219 |
|
| AF-A0A2T5ZP05-F1-model_v4 | deleted | 0.9606 | 1 | 219 |
|
| AF-A0A7C1D088-F1-model_v4 | Glycine transferase | 0.9599 | 1 | 219 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar