F463849

General Info

Members Datasets Scaffolds Average Seq Length
561 374 489 233

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0059083|Ga0453684_0059083_4004_4807
Length 267
Sequence LSSIAHAGIIVSENAFSESFSIRRNLDAPGSRGNVPMKSAIMQPYFLPYIGYFQLMHAVDTFVVYDNIKYTKKGWINRNRILVDGKDTYITIPLANASDFLDIRERTVSPDFKREKMLHQVAEAYRKAPFFDPTYALFEKIVHCNEHNLFSYLLNSIKLVCEYLNIATSITISSGIPIDHSLKAENKVIALCKHLGSEHYINAIGGQELYSKEEFAGNAINLHFIKTGPVEYVQFNHPFVPWLSIIDVLMFNDLETVKGFLDAYTLV

Samples

Sample ID Description Type Environment
1 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
2 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
3 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
4 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
5 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
6 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
7 2643221591 Devosia sp. Root685 Isolate Unclassified
8 2643221621 Achromobacter sp. Root83 Isolate Unclassified
9 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
10 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
11 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
12 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
13 2718218423 Rhizobium sp. N941 Isolate Nodule
14 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
15 2721755809 Rhizobium sp. N541 Isolate Nodule
16 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
17 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
18 2791355265 Rhizobium sp. H4 Isolate Nodule
19 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
20 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
21 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
22 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
23 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
24 2838048938 Rhizobium pisi 27/80 Isolate Nodule
25 2838061910 Rhizobium phaseoli L15 Isolate Nodule
26 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
27 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
28 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
29 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
30 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
31 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
32 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
33 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
34 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
35 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
36 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
37 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
38 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
39 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
40 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
41 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
42 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
43 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
44 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
45 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
46 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
47 2842733646 Variovorax sp. R-72446 Isolate Unclassified
48 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
49 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
50 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
51 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
52 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
53 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
54 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
55 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
56 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
57 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
58 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
59 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
60 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
61 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
62 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
63 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
64 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
65 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
66 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
67 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
68 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
69 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
70 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
71 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
74 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
82 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
86 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
87 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
88 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
102 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
103 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
104 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
105 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
106 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
107 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
108 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
109 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
110 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
121 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
122 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
123 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
124 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
125 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
126 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
127 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
134 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
164 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
167 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
168 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
171 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
172 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
173 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
174 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
225 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
226 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
227 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
247 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
248 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
249 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
341 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
344 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
345 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
346 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
347 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
348 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
351 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
352 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
353 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
354 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
355 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
356 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
357 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
358 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
359 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
360 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
361 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
364 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
365 8005275841 Rhizobium sp. N4311 Isolate Nodule
366 8005395548 Rhizobium sp. R339 Isolate Nodule
367 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
368 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
369 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
370 8018176218 Rhizobium sp. N122 Isolate Nodule
371 8024501048 Rhizobium sp. H4 Isolate Nodule
372 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
373 8056382006 Rhizobium croatiense 13T Isolate Nodule
374 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.17
Metatranscriptomes 0
Isolates 12.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.48
Nodule 8.38
Rhizoplane 7.49
Rhizosphere 61.14
Stem 0
Stem Tuber 0.36
Unclassified 10.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1017273 3300001904 Bacteria 1145
2 JGI24735J21928_10001863 3300002067 Bacteria 7392
3 JGI25155J39150_1000028 3300002704 Bacteria 120158
4 JGI25156J39149_1000013 3300002705 Bacteria 189553
5 JGI25154J39366_1000032 3300002738 Bacteria 189265
6 JGI25157J39369_1000017 3300002741 Bacteria 189553
7 JGI25151J46595_10006611 3300003187 Bacteria 5792
8 JGI25165J46597_1014655 3300003214 Bacteria 1065
9 rootH2_10022911 3300003320 Bacteria 27500
10 rootH1_10032066 3300003323 Bacteria 1957
11 rootH1_10306814 3300003323 Bacteria 1587
12 Ga0055538_1000068 3300003751 Bacteria 97329
13 Ga0055527_1000940 3300003760 Bacteria 7171
14 Ga0055528_1002119 3300003790 Bacteria 10953
15 Ga0055531_10000007 3300003794 Bacteria 225289
16 Ga0055543_1002571 3300004625 Bacteria 5890
17 Ga0065165_1000278 3300005262 Bacteria 87353
18 Ga0065707_10277394 3300005295 Bacteria 1056
19 Ga0070658_10000427 3300005327 Bacteria 36514
20 Ga0070658_10006490 3300005327 Bacteria 9482
21 Ga0070658_10435737 3300005327 Bacteria 1128
22 Ga0070676_10291930 3300005328 Bacteria 1102
23 Ga0070690_100000691 3300005330 Bacteria 17290
24 Ga0068869_100011002 3300005334 Bacteria 5926
25 Ga0068869_100639176 3300005334 Unclassified 902
26 Ga0070666_10001834 3300005335 Bacteria 12941
27 Ga0070680_100431635 3300005336 Bacteria 1124
28 Ga0068868_100001999 3300005338 Bacteria 14029
29 Ga0070660_100581743 3300005339 Bacteria 935
30 Ga0070689_100029808 3300005340 Bacteria 4135
31 Ga0070668_100003531 3300005347 Bacteria 11532
32 Ga0070668_100005392 3300005347 Bacteria 9493
33 Ga0070668_100732622 3300005347 Unclassified 874
34 Ga0070669_100124600 3300005353 Bacteria 1970
35 Ga0070675_100100003 3300005354 Unclassified 2442
36 Ga0070671_100000001 3300005355 Bacteria 1228151
37 Ga0070671_100006127 3300005355 Bacteria 9578
38 Ga0070671_100509064 3300005355 Bacteria 1036
39 Ga0070674_100144990 3300005356 Bacteria 1786
40 Ga0070674_100254096 3300005356 Bacteria 1382
41 Ga0070688_100003007 3300005365 Bacteria 8598
42 Ga0070659_100036364 3300005366 Bacteria 3839
43 Ga0070667_100030603 3300005367 Bacteria 4489
44 Ga0070700_100560128 3300005441 Bacteria 889
45 Ga0070663_100322199 3300005455 Bacteria 1243
46 Ga0070678_100026668 3300005456 Bacteria 3911
47 Ga0070678_100073654 3300005456 Unclassified 2564
48 Ga0070662_100114572 3300005457 Unclassified 2058
49 Ga0068867_100358938 3300005459 Unclassified 1218
50 Ga0070685_10004994 3300005466 Bacteria 6716
51 Ga0070707_100001508 3300005468 Bacteria 22712
52 Ga0070699_100001291 3300005518 Bacteria 23104
53 Ga0070699_100020489 3300005518 Bacteria 5704
54 Ga0070679_100076783 3300005530 Bacteria 3329
55 Ga0070697_100040020 3300005536 Bacteria 3791
56 Ga0068853_100004714 3300005539 Bacteria 10582
57 Ga0068853_100254350 3300005539 Bacteria 1613
58 Ga0070672_100053776 3300005543 Bacteria 3149
59 Ga0070672_100571890 3300005543 Bacteria 983
60 Ga0070696_100030891 3300005546 Unclassified 3669
61 Ga0070696_100499855 3300005546 Bacteria 967
62 Ga0070693_100299989 3300005547 Unclassified 1083
63 Ga0070693_100531045 3300005547 Bacteria 839
64 Ga0070665_100000191 3300005548 Bacteria 108807
65 Ga0070665_100073513 3300005548 Bacteria 3424
66 Ga0070704_100024796 3300005549 Bacteria 3940
67 Ga0068855_100052223 3300005563 Bacteria 4813
68 Ga0068855_100074327 3300005563 Bacteria 3948
69 Ga0068857_100377113 3300005577 Bacteria 1316
70 Ga0068856_100192675 3300005614 Bacteria 2052
71 Ga0070702_100281341 3300005615 Bacteria 1142
72 Ga0070702_100475259 3300005615 Unclassified 912
73 Ga0068852_100097322 3300005616 Bacteria 2647
74 Ga0068859_100000752 3300005617 Bacteria 32637
75 Ga0068859_100038942 3300005617 Bacteria 4768
76 Ga0068864_100001479 3300005618 Bacteria 19364
77 Ga0068866_10121699 3300005718 Unclassified 1471
78 Ga0068866_10165207 3300005718 Bacteria 1294
79 Ga0068861_100198632 3300005719 Bacteria 1682
80 Ga0068851_10031595 3300005834 Bacteria 2631
81 Ga0068863_100056587 3300005841 Bacteria 3713
82 Ga0068858_100003128 3300005842 Bacteria 16565
83 Ga0068860_100005794 3300005843 Bacteria 12443
84 Ga0068860_100085237 3300005843 Bacteria 3006
85 Ga0081455_10308979 3300005937 Bacteria 1131
86 Ga0081540_1003477 3300005983 Bacteria 12428
87 Ga0070716_100125466 3300006173 Bacteria 1614
88 Ga0097621_100003468 3300006237 Bacteria 10876
89 Ga0097621_100013394 3300006237 Bacteria 6113
90 Ga0075370_10211104 3300006353 Bacteria 1146
91 Ga0068871_100002423 3300006358 Bacteria 12736
92 Ga0068871_100004395 3300006358 Bacteria 9798
93 Ga0068871_100153155 3300006358 Unclassified 1967
94 Ga0075428_100222407 3300006844 Unclassified 2038
95 Ga0075433_10203924 3300006852 Bacteria 1758
96 Ga0075434_100311406 3300006871 Bacteria 1595
97 Ga0075429_100829581 3300006880 Bacteria 809
98 Ga0097620_100000752 3300006931 Bacteria 32637
99 Ga0097620_100038942 3300006931 Bacteria 4768
100 Ga0079104_1000627 3300006946 Bacteria 34512
101 Ga0105251_10005673 3300009011 Bacteria 8104
102 Ga0105244_10004206 3300009036 Bacteria 10009
103 Ga0105244_10004943 3300009036 Bacteria 9009
104 Ga0105250_10003815 3300009092 Bacteria 7075
105 Ga0105250_10005778 3300009092 Bacteria 5506
106 Ga0105250_10015292 3300009092 Bacteria 3143
107 Ga0105245_10004921 3300009098 Bacteria 11753
108 Ga0105245_10005949 3300009098 Bacteria 10720
109 Ga0105247_10000813 3300009101 Bacteria 23797
110 Ga0105247_10032030 3300009101 Bacteria 3193
111 Ga0114129_10035722 3300009147 Bacteria 7020
112 Ga0114129_10083943 3300009147 Unclassified 4423
113 Ga0114129_10117416 3300009147 Bacteria 3666
114 Ga0105242_10004520 3300009176 Bacteria 10804
115 Ga0105242_10010848 3300009176 Bacteria 6998
116 Ga0105242_10123242 3300009176 Bacteria 2228
117 Ga0105248_10010760 3300009177 Bacteria 10100
118 Ga0105248_10198894 3300009177 Unclassified 2258
119 Ga0105248_10342474 3300009177 Unclassified 1683
120 Ga0105237_10056227 3300009545 Bacteria 3939
121 Ga0105238_10111414 3300009551 Bacteria 2717
122 Ga0105238_10472930 3300009551 Bacteria 1252
123 Ga0105249_10207736 3300009553 Bacteria 1920
124 Ga0105249_10365268 3300009553 Bacteria 1466
125 Ga0105239_10001689 3300010375 Bacteria 29111
126 Ga0105239_10122016 3300010375 Bacteria 2895
127 Ga0105239_10744571 3300010375 Bacteria 1121
128 Ga0105246_10013581 3300011119 Bacteria 5109
129 Ga0157373_10000216 3300013100 Bacteria 47143
130 Ga0157373_10045759 3300013100 Unclassified 3123
131 Ga0157373_10079870 3300013100 Bacteria 2307
132 Ga0157371_10014810 3300013102 Bacteria 5870
133 Ga0157371_10080426 3300013102 Bacteria 2308
134 Ga0157370_10000154 3300013104 Bacteria 84734
135 Ga0157370_10008545 3300013104 Bacteria 11036
136 Ga0157370_10021030 3300013104 Bacteria 6506
137 Ga0157370_10437364 3300013104 Bacteria 1203
138 Ga0157369_10084073 3300013105 Bacteria 3403
139 Ga0157369_10611862 3300013105 Bacteria 1124
140 Ga0157374_10001973 3300013296 Bacteria 17209
141 Ga0157378_10004445 3300013297 Bacteria 12331
142 Ga0157378_10006836 3300013297 Bacteria 9948
143 Ga0157378_10110488 3300013297 Bacteria 2520
144 Ga0163162_10000585 3300013306 Bacteria 33759
145 Ga0163162_10002465 3300013306 Bacteria 17469
146 Ga0163162_10037640 3300013306 Bacteria 4828
147 Ga0157372_10704034 3300013307 Bacteria 1175
148 Ga0157375_10012600 3300013308 Bacteria 7504
149 Ga0157375_10091621 3300013308 Bacteria 3102
150 Ga0157375_10404736 3300013308 Bacteria 1531
151 Ga0163163_10000541 3300014325 Bacteria 33456
152 Ga0157380_10171392 3300014326 Bacteria 1897
153 Ga0157377_10149154 3300014745 Bacteria 1444
154 Ga0157379_10000597 3300014968 Bacteria 29148
155 Ga0157379_10007200 3300014968 Bacteria 9622
156 Ga0157376_10002086 3300014969 Bacteria 13438
157 Ga0157376_10002895 3300014969 Bacteria 11764
158 Ga0157376_10436916 3300014969 Bacteria 1273
159 Ga0163161_10009956 3300017792 Bacteria 6586
160 Ga0213872_10000063 3300021361 Bacteria 97755
161 Ga0213872_10060349 3300021361 Bacteria 1715
162 Ga0209435_100003 3300025206 Bacteria 669534
163 Ga0209784_100041 3300025224 Bacteria 228573
164 Ga0209672_101610 3300025228 Bacteria 7544
165 Ga0207425_1001839 3300025245 Bacteria 8205
166 Ga0207425_1009474 3300025245 Bacteria 2418
167 Ga0209646_1000008 3300025246 Bacteria 669534
168 Ga0209026_1000007 3300025250 Bacteria 669534
169 Ga0209759_1000026 3300025256 Bacteria 311743
170 Ga0209129_1005065 3300025258 Bacteria 4838
171 Ga0209233_1001032 3300025261 Bacteria 11766
172 Ga0209455_1037151 3300025272 Unclassified 769
173 Ga0209673_1002354 3300025273 Bacteria 13319
174 Ga0209025_1001036 3300025294 Bacteria 40764
175 Ga0209758_1002328 3300025297 Bacteria 19630
176 Ga0209050_1000934 3300025298 Bacteria 38215
177 Ga0209050_1003662 3300025298 Bacteria 11100
178 Ga0209050_1015038 3300025298 Bacteria 3284
179 Ga0209256_1008392 3300025299 Bacteria 4805
180 Ga0209256_1013915 3300025299 Bacteria 2945
181 Ga0209051_1006408 3300025303 Bacteria 6634
182 Ga0209051_1011431 3300025303 Bacteria 4384
183 Ga0209257_1000021 3300025304 Bacteria 771986
184 Ga0207696_1002629 3300025711 Bacteria 8689
185 Ga0207696_1006436 3300025711 Bacteria 4734
186 Ga0207655_1000094 3300025728 Bacteria 196748
187 Ga0207655_1003666 3300025728 Bacteria 11321
188 Ga0207713_1006192 3300025735 Bacteria 7336
189 Ga0207713_1026498 3300025735 Bacteria 2654
190 Ga0207642_10065020 3300025899 Unclassified 1712
191 Ga0207680_10000531 3300025903 Bacteria 18126
192 Ga0207647_10000410 3300025904 Bacteria 35247
193 Ga0207645_10277644 3300025907 Bacteria 1112
194 Ga0207705_10000057 3300025909 Bacteria 157369
195 Ga0207695_10029730 3300025913 Bacteria 6029
196 Ga0207657_10171490 3300025919 Bacteria 1757
197 Ga0207657_10359975 3300025919 Bacteria 1147
198 Ga0207646_10002835 3300025922 Bacteria 20156
199 Ga0207681_10391987 3300025923 Bacteria 1120
200 Ga0207694_10097771 3300025924 Bacteria 2323
201 Ga0207694_10488066 3300025924 Bacteria 1031
202 Ga0207659_10226090 3300025926 Unclassified 1507
203 Ga0207687_10000968 3300025927 Bacteria 19507
204 Ga0207700_10239453 3300025928 Bacteria 1546
205 Ga0207644_10000001 3300025931 Bacteria 1243214
206 Ga0207644_10004427 3300025931 Bacteria 9119
207 Ga0207690_10004780 3300025932 Bacteria 7988
208 Ga0207686_10002019 3300025934 Bacteria 11187
209 Ga0207686_10033786 3300025934 Bacteria 3055
210 Ga0207686_10068223 3300025934 Bacteria 2278
211 Ga0207669_10063412 3300025937 Bacteria 2281
212 Ga0207669_10126473 3300025937 Unclassified 1747
213 Ga0207665_10190835 3300025939 Unclassified 1488
214 Ga0207665_10472993 3300025939 Bacteria 965
215 Ga0207691_10051811 3300025940 Bacteria 3751
216 Ga0207691_10097850 3300025940 Bacteria 2622
217 Ga0207711_10000970 3300025941 Bacteria 27457
218 Ga0207711_10076348 3300025941 Bacteria 2917
219 Ga0207689_10021042 3300025942 Bacteria 5484
220 Ga0207667_10093850 3300025949 Bacteria 3099
221 Ga0207668_10014057 3300025972 Bacteria 4949
222 Ga0207668_10028338 3300025972 Bacteria 3661
223 Ga0207677_10000206 3300026023 Bacteria 47813
224 Ga0207703_10001244 3300026035 Bacteria 23862
225 Ga0207703_10498594 3300026035 Bacteria 1143
226 Ga0207639_10003427 3300026041 Bacteria 10664
227 Ga0207639_10474509 3300026041 Bacteria 1139
228 Ga0207702_10088545 3300026078 Bacteria 2705
229 Ga0207702_10798240 3300026078 Bacteria 933
230 Ga0207641_10112932 3300026088 Bacteria 2411
231 Ga0207676_10000386 3300026095 Bacteria 37594
232 Ga0207674_10233622 3300026116 Bacteria 1786
233 Ga0207675_100167432 3300026118 Bacteria 2099
234 Ga0207683_10088794 3300026121 Unclassified 2751
235 Ga0207683_10134179 3300026121 Unclassified 2228
236 Ga0207683_10172414 3300026121 Bacteria 1960
237 Ga0209281_1000198 3300027111 Bacteria 136459
238 Ga0207428_10497169 3300027907 Bacteria 886
239 Ga0268266_10001432 3300028379 Bacteria 28461
240 Ga0268266_10024495 3300028379 Bacteria 5132
241 Ga0268266_10053925 3300028379 Bacteria 3455
242 Ga0268265_10198835 3300028380 Bacteria 1737
243 Ga0268264_10001587 3300028381 Bacteria 21048
244 Ga0268264_10139536 3300028381 Unclassified 2160
245 Ga0265326_10042209 3300028558 Bacteria 1294
246 Ga0265323_10010586 3300028653 Unclassified 3736
247 Ga0265336_10000815 3300028666 Bacteria 16376
248 Ga0265336_10082483 3300028666 Unclassified 959
249 Ga0265324_10000023 3300029957 Bacteria 164128
250 Ga0265324_10000381 3300029957 Bacteria 32068
251 Ga0265325_10000099 3300031241 Bacteria 61211
252 Ga0265325_10127913 3300031241 Bacteria 1219
253 Ga0265327_10043538 3300031251 Bacteria 2401
254 Ga0265327_10184570 3300031251 Bacteria 952
255 Ga0307509_10095354 3300031507 Bacteria 3031
256 Ga0265314_10000756 3300031711 Bacteria 38675
257 Ga0265314_10034821 3300031711 Bacteria 3674
258 Ga0307412_10000629 3300031911 Bacteria 20571
259 Ga0307414_10000030 3300032004 Bacteria 187373
260 Ga0307414_10053975 3300032004 Bacteria 2806
261 Ga0307414_10194009 3300032004 Bacteria 1646
262 Ga0307510_10010031 3300033180 Bacteria 11255
263 Ga0307510_10223706 3300033180 Bacteria 1391
264 Ga0373954_0002282 3300035118 Bacteria 7988
265 Ga0373956_0265137 3300035119 Bacteria 817
266 Ga0373943_0085674 3300035170 Bacteria 1623
267 Ga0373927_0111246 3300035695 Bacteria 1785
268 Ga0373933_0202205 3300035724 Bacteria 1271
269 Ga0373947_0081752 3300035725 Bacteria 2001
270 Ga0373937_0074707 3300036401 Bacteria 3128
271 Ga0373925_0024109 3300037068 Bacteria 4441
272 Ga0400483_096366 3300039062 Bacteria 9894
273 Ga0400483_189746 3300039062 Bacteria 26083
274 Ga0436365_1141939 3300039437 Unclassified 1149
275 Ga0436361_0552481 3300039447 Bacteria 3428
276 Ga0436361_0811061 3300039447 Bacteria 135576
277 Ga0439452_000031 3300042010 Bacteria 196691
278 Ga0439456_000119 3300042013 Bacteria 24617
279 Ga0450906_009471 3300042145 Bacteria 1858
280 Ga0439464_0003279 3300042439 Bacteria 4071
281 Ga0451577_0000052 3300042876 Bacteria 291030
282 Ga0451577_0000465 3300042876 Bacteria 70232
283 Ga0466963_0166928 3300044694 Bacteria 1534
284 Ga0453684_0001383 3300044712 Bacteria 70232
285 Ga0453684_0001941 3300044712 Bacteria 53308
286 Ga0453684_0003648 3300044712 Bacteria 34184
287 Ga0453684_0004611 3300044712 Bacteria 28699
288 Ga0453684_0021415 3300044712 Bacteria 9660
289 Ga0453684_0023286 3300044712 Bacteria 9133
290 Ga0453684_0028773 3300044712 Bacteria 7912
291 Ga0453684_0059083 3300044712 Unclassified 4948
292 Ga0453684_0074100 3300044712 Bacteria 4288
293 Ga0453684_0089833 3300044712 Bacteria 3797
294 Ga0453684_0244912 3300044712 Bacteria 2062
295 Ga0453684_0898176 3300044712 Bacteria 949
296 Ga0451576_0003894 3300045051 Bacteria 19970
297 Ga0451576_0007917 3300045051 Bacteria 12580
298 Ga0451576_0026019 3300045051 Bacteria 6297
299 Ga0451576_0417596 3300045051 Bacteria 1407
300 Ga0451576_0548679 3300045051 Bacteria 1214
301 Ga0451576_0654321 3300045051 Bacteria 1104
302 Ga0495592_0151293 3300046454 Bacteria 1605
303 Ga0495629_0004408 3300046459 Bacteria 10543
304 Ga0495629_0097112 3300046459 Bacteria 2055
305 Ga0495638_0001554 3300046460 Bacteria 20587
306 Ga0495641_0048560 3300046461 Unclassified 1946
307 Ga0495651_0035862 3300046462 Bacteria 3861
308 Ga0495651_0121069 3300046462 Bacteria 1922
309 Ga0495582_0009618 3300046473 Bacteria 5323
310 Ga0495639_0011072 3300046475 Bacteria 3887
311 Ga0495662_0072991 3300046476 Bacteria 1664
312 Ga0495585_0004565 3300046492 Bacteria 8956
313 Ga0495607_0234626 3300046501 Bacteria 890
314 Ga0495583_0077722 3300046506 Bacteria 1447
315 Ga0495606_0046214 3300046507 Bacteria 2879
316 Ga0495610_0000893 3300046512 Bacteria 27748
317 Ga0495610_0011551 3300046512 Bacteria 5390
318 Ga0495610_0037324 3300046512 Bacteria 2474
319 Ga0495616_0016554 3300046513 Bacteria 4078
320 Ga0495628_0296475 3300046516 Bacteria 1198
321 Ga0495630_0000720 3300046517 Bacteria 23449
322 Ga0495631_0123876 3300046518 Bacteria 1111
323 Ga0495643_0006006 3300046522 Bacteria 8099
324 Ga0495643_0009752 3300046522 Bacteria 5939
325 Ga0495643_0319684 3300046522 Bacteria 702
326 Ga0495648_0032906 3300046524 Bacteria 3394
327 Ga0495648_0121091 3300046524 Bacteria 1406
328 Ga0495652_0332738 3300046529 Bacteria 1094
329 Ga0495640_0039793 3300046533 Bacteria 3297
330 Ga0495640_0061103 3300046533 Bacteria 2561
331 Ga0495586_0094917 3300046535 Unclassified 1650
332 Ga0495587_0102961 3300046536 Bacteria 1644
333 Ga0495609_0003004 3300046538 Bacteria 9949
334 Ga0495609_0065880 3300046538 Bacteria 1596
335 Ga0495597_0000834 3300046542 Bacteria 24225
336 Ga0495597_0040053 3300046542 Bacteria 2095
337 Ga0495622_0002744 3300046557 Bacteria 8426
338 Ga0495622_0018053 3300046557 Bacteria 3285
339 Ga0495633_0002543 3300046558 Bacteria 12798
340 Ga0495634_0018420 3300046642 Bacteria 4971
341 Ga0495634_0120186 3300046642 Bacteria 1683
342 Ga0495611_0002210 3300046648 Bacteria 9045
343 Ga0495625_0064380 3300046660 Bacteria 2586
344 Ga0495635_0001213 3300046663 Bacteria 17235
345 Ga0495635_0179746 3300046663 Bacteria 1438
346 Ga0495661_0007280 3300046665 Bacteria 7714
347 Ga0495661_0119017 3300046665 Bacteria 1461
348 Ga0495588_0001986 3300046674 Bacteria 8748
349 Ga0495657_0022136 3300046675 Bacteria 4557
350 Ga0495658_0034983 3300046683 Unclassified 2760
351 Ga0495624_0012421 3300046690 Bacteria 5822
352 Ga0495670_0017136 3300046691 Bacteria 3563
353 Ga0495671_0000500 3300046692 Bacteria 30197
354 Ga0495671_0068424 3300046692 Bacteria 1746
355 Ga0495649_0012363 3300046694 Bacteria 4971
356 Ga0495649_0033017 3300046694 Bacteria 2849
357 Ga0495581_0103776 3300047315 Bacteria 1652
358 Ga0495604_0004387 3300047317 Bacteria 11167
359 Ga0495604_0065019 3300047317 Bacteria 2778
360 Ga0495674_0013049 3300047319 Bacteria 7821
361 Ga0495674_0014315 3300047319 Bacteria 7428
362 Ga0495676_0000093 3300047321 Bacteria 66312
363 Ga0495676_0029707 3300047321 Bacteria 4652
364 Ga0495680_0505311 3300047322 Bacteria 820
365 Ga0495687_000011 3300047443 Bacteria 397225
366 Ga0495673_0000566 3300047469 Bacteria 37632
367 Ga0495686_0000014 3300047472 Bacteria 474014
368 Ga0495686_0259959 3300047472 Bacteria 972
369 Ga0495686_0288863 3300047472 Bacteria 909
370 Ga0495593_0012371 3300047673 Bacteria 4877
371 Ga0495626_0000843 3300048091 Bacteria 27491
372 Ga0495626_0040030 3300048091 Bacteria 2215
373 Ga0496100_0002818 3300048903 Bacteria 8915
374 Ga0496100_0003277 3300048903 Bacteria 8413
375 Ga0496100_0107023 3300048903 Bacteria 1937
376 Ga0496101_0006948 3300048904 Bacteria 7313
377 Ga0496101_0066995 3300048904 Bacteria 2620
378 Ga0496102_0001727 3300048905 Bacteria 19121
379 Ga0496102_0003631 3300048905 Bacteria 13052
380 Ga0496102_0017709 3300048905 Bacteria 6245
381 Ga0496102_0078313 3300048905 Bacteria 3043
382 Ga0496102_0270139 3300048905 Bacteria 1603
383 Ga0496103_0000572 3300048906 Bacteria 29210
384 Ga0496103_0008681 3300048906 Bacteria 6034
385 Ga0496103_0117298 3300048906 Bacteria 1694
386 Ga0496104_0002691 3300048907 Bacteria 15306
387 Ga0496104_0033944 3300048907 Bacteria 4756
388 Ga0496104_0262920 3300048907 Bacteria 1638
389 Ga0496105_0004214 3300048908 Bacteria 10803
390 Ga0496105_0005455 3300048908 Bacteria 9649
391 Ga0496105_0098401 3300048908 Bacteria 2415
392 Ga0496107_0024196 3300048910 Bacteria 4296
393 Ga0496107_0376963 3300048910 Bacteria 1055
394 Ga0496108_0086509 3300048911 Bacteria 2661
395 Ga0496108_0095505 3300048911 Bacteria 2531
396 Ga0496109_0019728 3300048912 Bacteria 5948
397 Ga0496109_0041663 3300048912 Bacteria 4159
398 Ga0496109_0376707 3300048912 Bacteria 1341
399 Ga0496109_0397890 3300048912 Bacteria 1301
400 Ga0496110_0089859 3300048913 Bacteria 2746
401 Ga0496110_0227989 3300048913 Bacteria 1694
402 Ga0496111_0011447 3300048914 Bacteria 5975
403 Ga0496111_0112657 3300048914 Bacteria 2004
404 Ga0496112_0001534 3300048915 Bacteria 17824
405 Ga0496112_0045130 3300048915 Bacteria 4320
406 Ga0496112_0146334 3300048915 Unclassified 2331
407 Ga0496112_0193134 3300048915 Bacteria 1997
408 Ga0496113_0065085 3300048916 Bacteria 2758
409 Ga0496114_0000410 3300048917 Bacteria 31786
410 Ga0496114_0022380 3300048917 Bacteria 5151
411 Ga0496114_0307289 3300048917 Bacteria 1400
412 Ga0496116_0000024 3300048919 Bacteria 471420
413 Ga0496116_0078317 3300048919 Bacteria 2062
414 Ga0496116_0161808 3300048919 Bacteria 1227
415 Ga0496117_0000775 3300048920 Bacteria 50341
416 Ga0496117_0032812 3300048920 Bacteria 3938
417 Ga0496117_0059785 3300048920 Bacteria 2630
418 Ga0496118_0015783 3300048921 Bacteria 6968
419 Ga0496118_0072295 3300048921 Bacteria 2478
420 Ga0496119_0016293 3300048922 Bacteria 5665
421 Ga0496119_0071817 3300048922 Bacteria 2025
422 Ga0496119_0072319 3300048922 Bacteria 2015
423 Ga0496121_0004764 3300048924 Bacteria 17909
424 Ga0496121_0005975 3300048924 Bacteria 15379
425 Ga0496121_0011434 3300048924 Bacteria 9856
426 Ga0496122_0017192 3300048925 Bacteria 6779
427 Ga0496122_0114624 3300048925 Bacteria 1758
428 Ga0496123_0008662 3300048926 Bacteria 9299
429 Ga0496123_0268631 3300048926 Bacteria 831
430 Ga0496124_0002043 3300048927 Bacteria 27439
431 Ga0496124_0097859 3300048927 Bacteria 2382
432 Ga0496125_0000542 3300048928 Bacteria 64978
433 Ga0496126_0008482 3300048929 Bacteria 11078
434 Ga0496126_0063390 3300048929 Bacteria 3313
435 Ga0496126_0131789 3300048929 Bacteria 2160
436 Ga0496126_0370574 3300048929 Bacteria 1168
437 Ga0495682_0001416 3300049460 Bacteria 13012
438 Ga0495682_0002093 3300049460 Bacteria 9730
439 Ga0501070_0035058 3300049586 Bacteria 4194
440 Ga0501076_0363808 3300049592 Bacteria 1188
441 nmdc:mga05p37_37594_c1 3300050507 Bacteria 5936
442 nmdc:mga09592_290592_c1 3300050508 Bacteria 1417
443 nmdc:mga08y16_49514_c1 3300050511 Bacteria 4397
444 nmdc:mga0n895_26918_c1 3300050512 Bacteria 5455
445 nmdc:mga08x19_263361_c1 3300050514 Bacteria 1192
446 nmdc:mga0a205_226298_c1 3300050515 Bacteria 1755
447 nmdc:mga0sz30_164874_c1 3300050516 Bacteria 982
448 Ga0500635_0053200 3300053080 Bacteria 1392
449 Ga0500578_0012282 3300053086 Bacteria 5532
450 Ga0500578_0068684 3300053086 Bacteria 2259
451 Ga0500578_0228079 3300053086 Bacteria 1130
452 Ga0500643_000019 3300053087 Bacteria 294301
453 Ga0500643_000434 3300053087 Bacteria 31543
454 Ga0500646_0004895 3300053090 Bacteria 3395
455 Ga0500583_0050850 3300053092 Bacteria 1923
456 Ga0500651_0403285 3300053093 Bacteria 768
457 Ga0500555_004262 3300053103 Bacteria 4067
458 Ga0500556_0028662 3300053104 Bacteria 1870
459 Ga0500556_0057028 3300053104 Bacteria 1428
460 Ga0500556_0096077 3300053104 Bacteria 1136
461 Ga0500569_000485 3300053109 Bacteria 6577
462 Ga0500608_025422 3300053122 Bacteria 2771
463 Ga0500642_0000980 3300053130 Bacteria 8206
464 Ga0500658_0006868 3300053134 Bacteria 4213
465 Ga0500658_0034474 3300053134 Bacteria 1998
466 Ga0500559_0000584 3300053136 Bacteria 25005
467 Ga0500559_0002128 3300053136 Bacteria 10543
468 Ga0500559_0048652 3300053136 Bacteria 1865
469 Ga0500559_0094013 3300053136 Bacteria 1375
470 Ga0500564_024998 3300053138 Bacteria 2742
471 Ga0500564_059921 3300053138 Bacteria 1728
472 Ga0500573_0024913 3300053140 Bacteria 3440
473 Ga0500588_0062074 3300053146 Bacteria 1201
474 Ga0500588_0062497 3300053146 Bacteria 1198
475 Ga0500589_090618 3300053147 Bacteria 1348
476 Ga0500590_082614 3300053148 Bacteria 1575
477 Ga0500604_0000001 3300053151 Bacteria 174619
478 Ga0500604_0033309 3300053151 Bacteria 1523
479 Ga0500616_0003150 3300053153 Bacteria 12876
480 Ga0500619_024882 3300053154 Bacteria 1766
481 Ga0500622_0000001 3300053156 Bacteria 657715
482 Ga0500622_0008425 3300053156 Bacteria 5767
483 Ga0500622_0033263 3300053156 Bacteria 2703
484 Ga0500638_032444 3300053162 Bacteria 2522
485 Ga0500636_0000076 3300053177 Bacteria 48321
486 Ga0500611_017781 3300053727 Bacteria 1300
487 Ga0500645_011547 3300053730 Bacteria 2881
488 Ga0500599_000148 3300053736 Bacteria 6364
489 Ga0500601_000030 3300053737 Bacteria 31644

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0319684 Ga0495643_0319684_17_625 172
2 3300053146 Ga0500588_0062497 Ga0500588_0062497_608_1183 172
3 3300048907 Ga0496104_0262920 Ga0496104_0262920_156_860 199
4 3300048908 Ga0496105_0098401 Ga0496105_0098401_1197_1901 199
5 3300048911 Ga0496108_0086509 Ga0496108_0086509_1573_2277 199
6 3300048912 Ga0496109_0019728 Ga0496109_0019728_4242_4946 199
7 3300048914 Ga0496111_0112657 Ga0496111_0112657_607_1311 199
8 3300048915 Ga0496112_0045130 Ga0496112_0045130_2787_3491 199
9 3300048916 Ga0496113_0065085 Ga0496113_0065085_1726_2430 199
10 3300032004 Ga0307414_10194009 Ga0307414_101940092 200
11 iso_pu_bacteria 2929160207 2929161117 207
12 3300003751 Ga0055538_1000068 Ga0055538_100006839 208
13 iso_pu_bacteria 2969304461 2969308715 208
14 iso_pu_bacteria 8029995093 8029996858 208
15 3300005336 Ga0070680_100431635 Ga0070680_1004316352 210
16 3300009147 Ga0114129_10117416 Ga0114129_101174162 210
17 3300005330 Ga0070690_100000691 Ga0070690_1000006917 211
18 3300005334 Ga0068869_100011002 Ga0068869_1000110022 211
19 3300005334 Ga0068869_100639176 Ga0068869_1006391761 211
20 3300005335 Ga0070666_10001834 Ga0070666_100018348 211
21 3300005338 Ga0068868_100001999 Ga0068868_1000019998 211
22 3300005339 Ga0070660_100581743 Ga0070660_1005817432 211
23 3300005340 Ga0070689_100029808 Ga0070689_1000298081 211
24 3300005347 Ga0070668_100732622 Ga0070668_1007326221 211
25 3300005355 Ga0070671_100006127 Ga0070671_1000061275 211
26 3300005355 Ga0070671_100509064 Ga0070671_1005090641 211
27 3300005365 Ga0070688_100003007 Ga0070688_1000030073 211
28 3300005456 Ga0070678_100073654 Ga0070678_1000736542 211
29 3300005457 Ga0070662_100114572 Ga0070662_1001145723 211
30 3300005466 Ga0070685_10004994 Ga0070685_100049947 211
31 3300005536 Ga0070697_100040020 Ga0070697_1000400203 211
32 3300005539 Ga0068853_100004714 Ga0068853_1000047147 211
33 3300005539 Ga0068853_100254350 Ga0068853_1002543502 211
34 3300005543 Ga0070672_100053776 Ga0070672_1000537764 211
35 3300005546 Ga0070696_100030891 Ga0070696_1000308914 211
36 3300005547 Ga0070693_100531045 Ga0070693_1005310451 211
37 3300005548 Ga0070665_100073513 Ga0070665_1000735132 211
38 3300005577 Ga0068857_100377113 Ga0068857_1003771132 211
39 3300005615 Ga0070702_100281341 Ga0070702_1002813412 211
40 3300005615 Ga0070702_100475259 Ga0070702_1004752591 211
41 3300005616 Ga0068852_100097322 Ga0068852_1000973221 211
42 3300005617 Ga0068859_100000752 Ga0068859_1000007527 211
43 3300005618 Ga0068864_100001479 Ga0068864_10000147913 211
44 3300005718 Ga0068866_10121699 Ga0068866_101216992 211
45 3300005718 Ga0068866_10165207 Ga0068866_101652072 211
46 3300005834 Ga0068851_10031595 Ga0068851_100315952 211
47 3300005841 Ga0068863_100056587 Ga0068863_1000565872 211
48 3300005842 Ga0068858_100003128 Ga0068858_1000031289 211
49 3300005843 Ga0068860_100005794 Ga0068860_1000057948 211
50 3300005843 Ga0068860_100085237 Ga0068860_1000852372 211
51 3300006237 Ga0097621_100003468 Ga0097621_1000034689 211
52 3300006237 Ga0097621_100013394 Ga0097621_1000133945 211
53 3300006358 Ga0068871_100002423 Ga0068871_1000024238 211
54 3300006358 Ga0068871_100004395 Ga0068871_1000043959 211
55 3300006852 Ga0075433_10203924 Ga0075433_102039242 211
56 3300006871 Ga0075434_100311406 Ga0075434_1003114062 211
57 3300006931 Ga0097620_100000752 Ga0097620_1000007527 211
58 3300009036 Ga0105244_10004943 Ga0105244_100049433 211
59 3300009092 Ga0105250_10005778 Ga0105250_100057783 211
60 3300009092 Ga0105250_10015292 Ga0105250_100152922 211
61 3300009098 Ga0105245_10004921 Ga0105245_100049215 211
62 3300009098 Ga0105245_10005949 Ga0105245_100059497 211
63 3300009101 Ga0105247_10032030 Ga0105247_100320304 211
64 3300009176 Ga0105242_10004520 Ga0105242_100045204 211
65 3300009176 Ga0105242_10010848 Ga0105242_100108486 211
66 3300009176 Ga0105242_10123242 Ga0105242_101232422 211
67 3300009177 Ga0105248_10010760 Ga0105248_100107608 211
68 3300009177 Ga0105248_10198894 Ga0105248_101988942 211
69 3300010375 Ga0105239_10744571 Ga0105239_107445711 211
70 3300011119 Ga0105246_10013581 Ga0105246_100135815 211
71 3300013102 Ga0157371_10080426 Ga0157371_100804263 211
72 3300013104 Ga0157370_10437364 Ga0157370_104373642 211
73 3300013296 Ga0157374_10001973 Ga0157374_100019738 211
74 3300013297 Ga0157378_10004445 Ga0157378_100044458 211
75 3300013297 Ga0157378_10006836 Ga0157378_100068364 211
76 3300013306 Ga0163162_10000585 Ga0163162_1000058526 211
77 3300013306 Ga0163162_10002465 Ga0163162_1000246510 211
78 3300013308 Ga0157375_10012600 Ga0157375_100126007 211
79 3300013308 Ga0157375_10091621 Ga0157375_100916212 211
80 3300014325 Ga0163163_10000541 Ga0163163_100005418 211
81 3300014745 Ga0157377_10149154 Ga0157377_101491542 211
82 3300014968 Ga0157379_10000597 Ga0157379_1000059723 211
83 3300014969 Ga0157376_10002086 Ga0157376_100020868 211
84 3300014969 Ga0157376_10002895 Ga0157376_100028955 211
85 3300025728 Ga0207655_1003666 Ga0207655_10036662 211
86 3300025899 Ga0207642_10065020 Ga0207642_100650202 211
87 3300025903 Ga0207680_10000531 Ga0207680_100005318 211
88 3300025913 Ga0207695_10029730 Ga0207695_100297304 211
89 3300025919 Ga0207657_10171490 Ga0207657_101714903 211
90 3300025927 Ga0207687_10000968 Ga0207687_1000096810 211
91 3300025928 Ga0207700_10239453 Ga0207700_102394532 211
92 3300025931 Ga0207644_10004427 Ga0207644_100044276 211
93 3300025934 Ga0207686_10002019 Ga0207686_100020194 211
94 3300025934 Ga0207686_10033786 Ga0207686_100337863 211
95 3300025934 Ga0207686_10068223 Ga0207686_100682233 211
96 3300025939 Ga0207665_10190835 Ga0207665_101908352 211
97 3300025939 Ga0207665_10472993 Ga0207665_104729932 211
98 3300025940 Ga0207691_10097850 Ga0207691_100978503 211
99 3300025941 Ga0207711_10000970 Ga0207711_1000097014 211
100 3300025942 Ga0207689_10021042 Ga0207689_100210425 211
101 3300025972 Ga0207668_10014057 Ga0207668_100140573 211
102 3300026023 Ga0207677_10000206 Ga0207677_1000020617 211
103 3300026035 Ga0207703_10001244 Ga0207703_1000124410 211
104 3300026078 Ga0207702_10088545 Ga0207702_100885453 211
105 3300026088 Ga0207641_10112932 Ga0207641_101129322 211
106 3300026095 Ga0207676_10000386 Ga0207676_1000038617 211
107 3300026121 Ga0207683_10088794 Ga0207683_100887942 211
108 3300026121 Ga0207683_10134179 Ga0207683_101341792 211
109 3300028379 Ga0268266_10053925 Ga0268266_100539254 211
110 3300028381 Ga0268264_10001587 Ga0268264_1000158713 211
111 3300028381 Ga0268264_10139536 Ga0268264_101395362 211
112 3300035724 Ga0373933_0202205 Ga0373933_0202205_557_1240 211
113 3300045051 Ga0451576_0654321 Ga0451576_0654321_39_722 211
114 3300047317 Ga0495604_0065019 Ga0495604_0065019_482_1165 211
115 3300047472 Ga0495686_0288863 Ga0495686_0288863_174_899 211
116 3300048919 Ga0496116_0000024 Ga0496116_0000024_156737_157420 211
117 3300048925 Ga0496122_0114624 Ga0496122_0114624_515_1207 211
118 3300049460 Ga0495682_0001416 Ga0495682_0001416_11939_12622 211
119 3300050516 nmdc:mga0sz30_164874_c1 nmdc:mga0sz30_164874_c1_54_749 211
120 3300053736 Ga0500599_000148 Ga0500599_000148_4477_5202 211
121 iso_pu_bacteria 2571042143 2571529885 211
122 iso_pu_bacteria 2599185240 2599747869 211
123 iso_pu_bacteria 2599185355 2600209780 211
124 iso_pu_bacteria 2675903129 2676745956 211
125 3300003760 Ga0055527_1000940 Ga0055527_10009402 212
126 3300025228 Ga0209672_101610 Ga0209672_1016102 212
127 3300042013 Ga0439456_000119 Ga0439456_000119_15095_15781 212
128 iso_pu_bacteria 2516653085 2517081510 212
129 iso_pu_bacteria 2585427526 2585526598 212
130 iso_pu_bacteria 2643221591 2643964962 212
131 iso_pu_bacteria 2643221621 2644123297 212
132 iso_pu_bacteria 2718217997 2719664692 212
133 iso_pu_bacteria 2718218199 2720491112 212
134 iso_pu_bacteria 2718218232 2720612479 212
135 iso_pu_bacteria 2718218423 2721398665 212
136 iso_pu_bacteria 2721755556 2723026138 212
137 iso_pu_bacteria 2721755809 2724037478 212
138 iso_pu_bacteria 2721755823 2724109402 212
139 iso_pu_bacteria 2728369352 2730107074 212
140 iso_pu_bacteria 2791355265 2793355127 212
141 iso_pu_bacteria 2802429605 2805926505 212
142 iso_pu_bacteria 2824704595 2824707748 212
143 iso_pu_bacteria 2824753945 2824758056 212
144 iso_pu_bacteria 2824763712 2824766194 212
145 iso_pu_bacteria 2838016132 2838017361 212
146 iso_pu_bacteria 2838048938 2838049157 212
147 iso_pu_bacteria 2838061910 2838063397 212
148 iso_pu_bacteria 2838668709 2838670920 212
149 iso_pu_bacteria 2838686498 2838688529 212
150 iso_pu_bacteria 2838701080 2838703291 212
151 iso_pu_bacteria 2838729681 2838736894 212
152 iso_pu_bacteria 2838742623 2838746796 212
153 iso_pu_bacteria 2841851746 2841852270 212
154 iso_pu_bacteria 2842146304 2842147485 212
155 iso_pu_bacteria 2842156927 2842158656 212
156 iso_pu_bacteria 2842180545 2842182270 212
157 iso_pu_bacteria 2842192696 2842198022 212
158 iso_pu_bacteria 2842229732 2842234719 212
159 iso_pu_bacteria 2842243621 2842248450 212
160 iso_pu_bacteria 2842250916 2842252551 212
161 iso_pu_bacteria 2842257432 2842262377 212
162 iso_pu_bacteria 2842271015 2842272521 212
163 iso_pu_bacteria 2842304105 2842310906 212
164 iso_pu_bacteria 2842317721 2842318579 212
165 iso_pu_bacteria 2842395702 2842398180 212
166 iso_pu_bacteria 2842447887 2842452615 212
167 iso_pu_bacteria 2842489311 2842493830 212
168 iso_pu_bacteria 2842495871 2842497214 212
169 iso_pu_bacteria 2842733646 2842734430 212
170 iso_pu_bacteria 2844425489 2844428082 212
171 iso_pu_bacteria 2844454524 2844461418 212
172 iso_pu_bacteria 2874628541 2874636014 212
173 iso_pu_bacteria 2891670763 2891671335 212
174 iso_pu_bacteria 2904711408 2904718454 212
175 iso_pu_bacteria 2933570622 2933577401 212
176 iso_pu_bacteria 2933594066 2933597151 212
177 iso_pu_bacteria 2939642701 2939643295 212
178 iso_pu_bacteria 8005275841 8005279666 212
179 iso_pu_bacteria 8005395548 8005400298 212
180 iso_pu_bacteria 8005430974 8005437154 212
181 iso_pu_bacteria 8005619151 8005620601 212
182 iso_pu_bacteria 8005695170 8005698703 212
183 iso_pu_bacteria 8018176218 8018182584 212
184 iso_pu_bacteria 8024501048 8024503179 212
185 iso_pu_bacteria 8056382006 8056384673 212
186 iso_pu_bacteria 8056967851 8056969561 212
187 3300005327 Ga0070658_10000427 Ga0070658_1000042723 213
188 3300013100 Ga0157373_10000216 Ga0157373_1000021628 213
189 3300025224 Ga0209784_100041 Ga0209784_100041173 213
190 3300025937 Ga0207669_10063412 Ga0207669_100634123 213
191 3300027907 Ga0207428_10497169 Ga0207428_104971692 213
192 3300044712 Ga0453684_0074100 Ga0453684_0074100_2819_3511 213
193 3300044712 Ga0453684_0089833 Ga0453684_0089833_360_1049 213
194 3300046692 Ga0495671_0000500 Ga0495671_0000500_16022_16717 213
195 3300048091 Ga0495626_0000843 Ga0495626_0000843_10765_11460 213
196 3300050511 nmdc:mga08y16_49514_c1 nmdc:mga08y16_49514_c1_3384_4073 213
197 iso_pu_bacteria 2855195626 2855197035 213
198 iso_pu_bacteria 2871272651 2871275659 213
199 iso_pu_bacteria 2977268062 2977272034 213
200 3300046542 Ga0495597_0000834 Ga0495597_0000834_11386_12081 214
201 3300002067 JGI24735J21928_10001863 JGI24735J21928_100018635 215
202 3300005328 Ga0070676_10291930 Ga0070676_102919301 215
203 3300005347 Ga0070668_100003531 Ga0070668_10000353111 215
204 3300005354 Ga0070675_100100003 Ga0070675_1001000031 215
205 3300005356 Ga0070674_100144990 Ga0070674_1001449903 215
206 3300005459 Ga0068867_100358938 Ga0068867_1003589381 215
207 3300005543 Ga0070672_100571890 Ga0070672_1005718902 215
208 3300005719 Ga0068861_100198632 Ga0068861_1001986323 215
209 3300005937 Ga0081455_10308979 Ga0081455_103089791 215
210 3300009011 Ga0105251_10005673 Ga0105251_100056736 215
211 3300009551 Ga0105238_10472930 Ga0105238_104729301 215
212 3300009553 Ga0105249_10365268 Ga0105249_103652682 215
213 3300025735 Ga0207713_1006192 Ga0207713_10061926 215
214 3300025907 Ga0207645_10277644 Ga0207645_102776442 215
215 3300025924 Ga0207694_10488066 Ga0207694_104880662 215
216 3300025926 Ga0207659_10226090 Ga0207659_102260902 215
217 3300025937 Ga0207669_10126473 Ga0207669_101264732 215
218 3300025940 Ga0207691_10051811 Ga0207691_100518112 215
219 3300025972 Ga0207668_10028338 Ga0207668_100283382 215
220 3300026118 Ga0207675_100167432 Ga0207675_1001674323 215
221 3300028666 Ga0265336_10000815 Ga0265336_100008156 215
222 3300029957 Ga0265324_10000023 Ga0265324_1000002372 215
223 3300031241 Ga0265325_10000099 Ga0265325_1000009915 215
224 3300031711 Ga0265314_10034821 Ga0265314_100348214 215
225 3300035725 Ga0373947_0081752 Ga0373947_0081752_673_1377 215
226 3300039062 Ga0400483_096366 Ga0400483_096366_304_1062 215
227 3300039062 Ga0400483_189746 Ga0400483_189746_11510_12268 215
228 3300044694 Ga0466963_0166928 Ga0466963_0166928_592_1296 215
229 3300044712 Ga0453684_0004611 Ga0453684_0004611_23930_24628 215
230 3300044712 Ga0453684_0898176 Ga0453684_0898176_171_866 215
231 3300046459 Ga0495629_0097112 Ga0495629_0097112_156_860 215
232 3300046461 Ga0495641_0048560 Ga0495641_0048560_912_1616 215
233 3300046473 Ga0495582_0009618 Ga0495582_0009618_1698_2402 215
234 3300046476 Ga0495662_0072991 Ga0495662_0072991_479_1183 215
235 3300046517 Ga0495630_0000720 Ga0495630_0000720_2604_3308 215
236 3300046529 Ga0495652_0332738 Ga0495652_0332738_216_920 215
237 3300046533 Ga0495640_0039793 Ga0495640_0039793_836_1540 215
238 3300046535 Ga0495586_0094917 Ga0495586_0094917_903_1607 215
239 3300046642 Ga0495634_0018420 Ga0495634_0018420_765_1469 215
240 3300046683 Ga0495658_0034983 Ga0495658_0034983_257_961 215
241 3300047319 Ga0495674_0013049 Ga0495674_0013049_5559_6254 215
242 3300047319 Ga0495674_0014315 Ga0495674_0014315_986_1690 215
243 3300047443 Ga0495687_000011 Ga0495687_000011_5669_6364 215
244 3300047472 Ga0495686_0000014 Ga0495686_0000014_15754_16485 215
245 3300047673 Ga0495593_0012371 Ga0495593_0012371_1543_2238 215
246 3300048903 Ga0496100_0002818 Ga0496100_0002818_3635_4330 215
247 3300048904 Ga0496101_0066995 Ga0496101_0066995_1553_2248 215
248 3300048905 Ga0496102_0003631 Ga0496102_0003631_5579_6274 215
249 3300048906 Ga0496103_0117298 Ga0496103_0117298_944_1639 215
250 3300048915 Ga0496112_0193134 Ga0496112_0193134_307_1002 215
251 3300048919 Ga0496116_0161808 Ga0496116_0161808_88_783 215
252 3300048920 Ga0496117_0059785 Ga0496117_0059785_1176_1871 215
253 3300048926 Ga0496123_0268631 Ga0496123_0268631_10_705 215
254 3300048927 Ga0496124_0002043 Ga0496124_0002043_369_1151 215
255 iso_pu_bacteria 2919509842 2919510877 215
256 3300002704 JGI25155J39150_1000028 JGI25155J39150_100002849 216
257 3300002705 JGI25156J39149_1000013 JGI25156J39149_100001364 216
258 3300002738 JGI25154J39366_1000032 JGI25154J39366_100003264 216
259 3300002741 JGI25157J39369_1000017 JGI25157J39369_100001764 216
260 3300003187 JGI25151J46595_10006611 JGI25151J46595_100066115 216
261 3300003214 JGI25165J46597_1014655 JGI25165J46597_10146551 216
262 3300003320 rootH2_10022911 rootH2_1002291116 216
263 3300003323 rootH1_10032066 rootH1_100320662 216
264 3300003790 Ga0055528_1002119 Ga0055528_100211910 216
265 3300003794 Ga0055531_10000007 Ga0055531_10000007195 216
266 3300004625 Ga0055543_1002571 Ga0055543_10025712 216
267 3300005262 Ga0065165_1000278 Ga0065165_100027824 216
268 3300005327 Ga0070658_10435737 Ga0070658_104357371 216
269 3300005347 Ga0070668_100005392 Ga0070668_1000053925 216
270 3300005366 Ga0070659_100036364 Ga0070659_1000363643 216
271 3300005367 Ga0070667_100030603 Ga0070667_1000306036 216
272 3300005468 Ga0070707_100001508 Ga0070707_10000150817 216
273 3300005518 Ga0070699_100020489 Ga0070699_1000204896 216
274 3300005546 Ga0070696_100499855 Ga0070696_1004998551 216
275 3300005547 Ga0070693_100299989 Ga0070693_1002999892 216
276 3300005548 Ga0070665_100000191 Ga0070665_10000019163 216
277 3300005563 Ga0068855_100052223 Ga0068855_1000522232 216
278 3300005563 Ga0068855_100074327 Ga0068855_1000743272 216
279 3300005617 Ga0068859_100038942 Ga0068859_1000389426 216
280 3300005983 Ga0081540_1003477 Ga0081540_10034774 216
281 3300006353 Ga0075370_10211104 Ga0075370_102111042 216
282 3300006358 Ga0068871_100153155 Ga0068871_1001531552 216
283 3300006931 Ga0097620_100038942 Ga0097620_1000389426 216
284 3300009036 Ga0105244_10004206 Ga0105244_100042069 216
285 3300009092 Ga0105250_10003815 Ga0105250_100038155 216
286 3300009101 Ga0105247_10000813 Ga0105247_100008134 216
287 3300009147 Ga0114129_10035722 Ga0114129_100357225 216
288 3300009177 Ga0105248_10342474 Ga0105248_103424742 216
289 3300009545 Ga0105237_10056227 Ga0105237_100562274 216
290 3300009551 Ga0105238_10111414 Ga0105238_101114144 216
291 3300010375 Ga0105239_10001689 Ga0105239_100016899 216
292 3300010375 Ga0105239_10122016 Ga0105239_101220162 216
293 3300013100 Ga0157373_10079870 Ga0157373_100798702 216
294 3300013102 Ga0157371_10014810 Ga0157371_100148108 216
295 3300013104 Ga0157370_10008545 Ga0157370_100085453 216
296 3300013105 Ga0157369_10084073 Ga0157369_100840732 216
297 3300013306 Ga0163162_10037640 Ga0163162_100376404 216
298 3300013307 Ga0157372_10704034 Ga0157372_107040342 216
299 3300013308 Ga0157375_10404736 Ga0157375_104047362 216
300 3300017792 Ga0163161_10009956 Ga0163161_100099562 216
301 3300021361 Ga0213872_10000063 Ga0213872_1000006323 216
302 3300021361 Ga0213872_10060349 Ga0213872_100603492 216
303 3300025206 Ga0209435_100003 Ga0209435_100003107 216
304 3300025245 Ga0207425_1009474 Ga0207425_10094742 216
305 3300025246 Ga0209646_1000008 Ga0209646_1000008107 216
306 3300025250 Ga0209026_1000007 Ga0209026_1000007107 216
307 3300025256 Ga0209759_1000026 Ga0209759_1000026172 216
308 3300025258 Ga0209129_1005065 Ga0209129_10050652 216
309 3300025261 Ga0209233_1001032 Ga0209233_10010326 216
310 3300025272 Ga0209455_1037151 Ga0209455_10371511 216
311 3300025273 Ga0209673_1002354 Ga0209673_100235411 216
312 3300025294 Ga0209025_1001036 Ga0209025_100103634 216
313 3300025297 Ga0209758_1002328 Ga0209758_100232821 216
314 3300025298 Ga0209050_1000934 Ga0209050_100093433 216
315 3300025298 Ga0209050_1003662 Ga0209050_10036623 216
316 3300025299 Ga0209256_1008392 Ga0209256_10083923 216
317 3300025299 Ga0209256_1013915 Ga0209256_10139153 216
318 3300025303 Ga0209051_1006408 Ga0209051_10064082 216
319 3300025303 Ga0209051_1011431 Ga0209051_10114313 216
320 3300025304 Ga0209257_1000021 Ga0209257_100002133 216
321 3300025711 Ga0207696_1002629 Ga0207696_10026295 216
322 3300025711 Ga0207696_1006436 Ga0207696_10064362 216
323 3300025728 Ga0207655_1000094 Ga0207655_100009453 216
324 3300025735 Ga0207713_1026498 Ga0207713_10264983 216
325 3300025919 Ga0207657_10359975 Ga0207657_103599751 216
326 3300025922 Ga0207646_10002835 Ga0207646_1000283513 216
327 3300025924 Ga0207694_10097771 Ga0207694_100977712 216
328 3300025932 Ga0207690_10004780 Ga0207690_100047808 216
329 3300025941 Ga0207711_10076348 Ga0207711_100763482 216
330 3300025949 Ga0207667_10093850 Ga0207667_100938502 216
331 3300026035 Ga0207703_10498594 Ga0207703_104985941 216
332 3300026041 Ga0207639_10474509 Ga0207639_104745092 216
333 3300028379 Ga0268266_10001432 Ga0268266_1000143219 216
334 3300028379 Ga0268266_10024495 Ga0268266_100244954 216
335 3300028666 Ga0265336_10082483 Ga0265336_100824832 216
336 3300029957 Ga0265324_10000381 Ga0265324_1000038115 216
337 3300031241 Ga0265325_10127913 Ga0265325_101279132 216
338 3300031251 Ga0265327_10043538 Ga0265327_100435382 216
339 3300031251 Ga0265327_10184570 Ga0265327_101845701 216
340 3300031711 Ga0265314_10000756 Ga0265314_1000075623 216
341 3300032004 Ga0307414_10053975 Ga0307414_100539753 216
342 3300033180 Ga0307510_10010031 Ga0307510_100100316 216
343 3300033180 Ga0307510_10223706 Ga0307510_102237061 216
344 3300035118 Ga0373954_0002282 Ga0373954_0002282_5239_5937 216
345 3300035119 Ga0373956_0265137 Ga0373956_0265137_91_789 216
346 3300035170 Ga0373943_0085674 Ga0373943_0085674_294_992 216
347 3300035695 Ga0373927_0111246 Ga0373927_0111246_507_1205 216
348 3300036401 Ga0373937_0074707 Ga0373937_0074707_2163_2861 216
349 3300037068 Ga0373925_0024109 Ga0373925_0024109_2590_3288 216
350 3300039447 Ga0436361_0552481 Ga0436361_0552481_920_1618 216
351 3300039447 Ga0436361_0811061 Ga0436361_0811061_130729_131427 216
352 3300042010 Ga0439452_000031 Ga0439452_000031_50342_51040 216
353 3300042439 Ga0439464_0003279 Ga0439464_0003279_2866_3564 216
354 3300042876 Ga0451577_0000465 Ga0451577_0000465_55537_56238 216
355 3300044712 Ga0453684_0001383 Ga0453684_0001383_13995_14696 216
356 3300044712 Ga0453684_0028773 Ga0453684_0028773_4420_5121 216
357 3300044712 Ga0453684_0059083 Ga0453684_0059083_4004_4807 216
358 3300045051 Ga0451576_0026019 Ga0451576_0026019_4520_5230 216
359 3300045051 Ga0451576_0417596 Ga0451576_0417596_426_1124 216
360 3300045051 Ga0451576_0548679 Ga0451576_0548679_484_1182 216
361 3300046454 Ga0495592_0151293 Ga0495592_0151293_442_1149 216
362 3300046459 Ga0495629_0004408 Ga0495629_0004408_5954_6661 216
363 3300046460 Ga0495638_0001554 Ga0495638_0001554_8637_9335 216
364 3300046462 Ga0495651_0035862 Ga0495651_0035862_760_1467 216
365 3300046462 Ga0495651_0121069 Ga0495651_0121069_505_1203 216
366 3300046475 Ga0495639_0011072 Ga0495639_0011072_31_729 216
367 3300046492 Ga0495585_0004565 Ga0495585_0004565_625_1323 216
368 3300046501 Ga0495607_0234626 Ga0495607_0234626_90_788 216
369 3300046506 Ga0495583_0077722 Ga0495583_0077722_90_830 216
370 3300046507 Ga0495606_0046214 Ga0495606_0046214_1942_2682 216
371 3300046512 Ga0495610_0000893 Ga0495610_0000893_19621_20319 216
372 3300046512 Ga0495610_0011551 Ga0495610_0011551_134_832 216
373 3300046512 Ga0495610_0037324 Ga0495610_0037324_937_1635 216
374 3300046513 Ga0495616_0016554 Ga0495616_0016554_1040_1738 216
375 3300046516 Ga0495628_0296475 Ga0495628_0296475_286_993 216
376 3300046522 Ga0495643_0006006 Ga0495643_0006006_7142_7840 216
377 3300046522 Ga0495643_0009752 Ga0495643_0009752_4810_5511 216
378 3300046524 Ga0495648_0032906 Ga0495648_0032906_29_769 216
379 3300046533 Ga0495640_0061103 Ga0495640_0061103_29_736 216
380 3300046536 Ga0495587_0102961 Ga0495587_0102961_140_847 216
381 3300046538 Ga0495609_0003004 Ga0495609_0003004_5139_5837 216
382 3300046542 Ga0495597_0040053 Ga0495597_0040053_243_941 216
383 3300046557 Ga0495622_0018053 Ga0495622_0018053_668_1375 216
384 3300046558 Ga0495633_0002543 Ga0495633_0002543_3086_3784 216
385 3300046642 Ga0495634_0120186 Ga0495634_0120186_788_1495 216
386 3300046648 Ga0495611_0002210 Ga0495611_0002210_560_1258 216
387 3300046660 Ga0495625_0064380 Ga0495625_0064380_366_1064 216
388 3300046663 Ga0495635_0001213 Ga0495635_0001213_11429_12136 216
389 3300046663 Ga0495635_0179746 Ga0495635_0179746_252_950 216
390 3300046665 Ga0495661_0007280 Ga0495661_0007280_6618_7316 216
391 3300046675 Ga0495657_0022136 Ga0495657_0022136_2266_2973 216
392 3300046690 Ga0495624_0012421 Ga0495624_0012421_3352_4059 216
393 3300046691 Ga0495670_0017136 Ga0495670_0017136_2529_3227 216
394 3300046692 Ga0495671_0068424 Ga0495671_0068424_69_809 216
395 3300046694 Ga0495649_0012363 Ga0495649_0012363_3803_4501 216
396 3300046694 Ga0495649_0033017 Ga0495649_0033017_198_938 216
397 3300047315 Ga0495581_0103776 Ga0495581_0103776_831_1538 216
398 3300047317 Ga0495604_0004387 Ga0495604_0004387_8441_9148 216
399 3300047321 Ga0495676_0029707 Ga0495676_0029707_3754_4461 216
400 3300047322 Ga0495680_0505311 Ga0495680_0505311_18_716 216
401 3300047469 Ga0495673_0000566 Ga0495673_0000566_31341_32039 216
402 3300047472 Ga0495686_0259959 Ga0495686_0259959_111_851 216
403 3300048903 Ga0496100_0003277 Ga0496100_0003277_5141_5839 216
404 3300048903 Ga0496100_0107023 Ga0496100_0107023_532_1230 216
405 3300048904 Ga0496101_0006948 Ga0496101_0006948_3344_4042 216
406 3300048905 Ga0496102_0001727 Ga0496102_0001727_11200_11898 216
407 3300048905 Ga0496102_0017709 Ga0496102_0017709_171_869 216
408 3300048905 Ga0496102_0078313 Ga0496102_0078313_1373_2116 216
409 3300048905 Ga0496102_0270139 Ga0496102_0270139_852_1559 216
410 3300048906 Ga0496103_0000572 Ga0496103_0000572_11177_11875 216
411 3300048906 Ga0496103_0008681 Ga0496103_0008681_4226_4924 216
412 3300048907 Ga0496104_0002691 Ga0496104_0002691_1388_2086 216
413 3300048907 Ga0496104_0033944 Ga0496104_0033944_3208_3915 216
414 3300048908 Ga0496105_0004214 Ga0496105_0004214_9912_10619 216
415 3300048908 Ga0496105_0005455 Ga0496105_0005455_3216_3914 216
416 3300048910 Ga0496107_0024196 Ga0496107_0024196_758_1456 216
417 3300048910 Ga0496107_0376963 Ga0496107_0376963_134_877 216
418 3300048911 Ga0496108_0095505 Ga0496108_0095505_112_810 216
419 3300048912 Ga0496109_0041663 Ga0496109_0041663_2108_2806 216
420 3300048912 Ga0496109_0376707 Ga0496109_0376707_302_1000 216
421 3300048912 Ga0496109_0397890 Ga0496109_0397890_18_716 216
422 3300048913 Ga0496110_0089859 Ga0496110_0089859_1747_2490 216
423 3300048913 Ga0496110_0227989 Ga0496110_0227989_827_1549 216
424 3300048914 Ga0496111_0011447 Ga0496111_0011447_1608_2306 216
425 3300048915 Ga0496112_0001534 Ga0496112_0001534_1111_1809 216
426 3300048915 Ga0496112_0146334 Ga0496112_0146334_1344_2066 216
427 3300048917 Ga0496114_0000410 Ga0496114_0000410_69_767 216
428 3300048917 Ga0496114_0022380 Ga0496114_0022380_4015_4713 216
429 3300048917 Ga0496114_0307289 Ga0496114_0307289_86_784 216
430 3300048919 Ga0496116_0078317 Ga0496116_0078317_55_753 216
431 3300048920 Ga0496117_0032812 Ga0496117_0032812_2449_3147 216
432 3300048921 Ga0496118_0015783 Ga0496118_0015783_1101_1841 216
433 3300048921 Ga0496118_0072295 Ga0496118_0072295_1505_2203 216
434 3300048922 Ga0496119_0016293 Ga0496119_0016293_1990_2697 216
435 3300048922 Ga0496119_0071817 Ga0496119_0071817_1271_2011 216
436 3300048922 Ga0496119_0072319 Ga0496119_0072319_988_1686 216
437 3300048924 Ga0496121_0005975 Ga0496121_0005975_11385_12083 216
438 3300048924 Ga0496121_0011434 Ga0496121_0011434_6147_6857 216
439 3300048925 Ga0496122_0017192 Ga0496122_0017192_1822_2574 216
440 3300048926 Ga0496123_0008662 Ga0496123_0008662_3827_4579 216
441 3300048927 Ga0496124_0097859 Ga0496124_0097859_128_835 216
442 3300048928 Ga0496125_0000542 Ga0496125_0000542_30788_31540 216
443 3300048929 Ga0496126_0008482 Ga0496126_0008482_7083_7781 216
444 3300048929 Ga0496126_0063390 Ga0496126_0063390_1105_1812 216
445 3300048929 Ga0496126_0131789 Ga0496126_0131789_90_788 216
446 3300048929 Ga0496126_0370574 Ga0496126_0370574_271_969 216
447 3300049460 Ga0495682_0002093 Ga0495682_0002093_8064_8804 216
448 3300049592 Ga0501076_0363808 Ga0501076_0363808_113_823 216
449 3300050512 nmdc:mga0n895_26918_c1 nmdc:mga0n895_26918_c1_4008_4706 216
450 3300050515 nmdc:mga0a205_226298_c1 nmdc:mga0a205_226298_c1_613_1311 216
451 3300053080 Ga0500635_0053200 Ga0500635_0053200_664_1374 216
452 3300053086 Ga0500578_0012282 Ga0500578_0012282_271_969 216
453 3300053086 Ga0500578_0068684 Ga0500578_0068684_388_1128 216
454 3300053086 Ga0500578_0228079 Ga0500578_0228079_360_1058 216
455 3300053087 Ga0500643_000019 Ga0500643_000019_67657_68364 216
456 3300053087 Ga0500643_000434 Ga0500643_000434_11230_11940 216
457 3300053090 Ga0500646_0004895 Ga0500646_0004895_588_1286 216
458 3300053092 Ga0500583_0050850 Ga0500583_0050850_1053_1760 216
459 3300053093 Ga0500651_0403285 Ga0500651_0403285_56_754 216
460 3300053103 Ga0500555_004262 Ga0500555_004262_2243_2950 216
461 3300053104 Ga0500556_0028662 Ga0500556_0028662_227_940 216
462 3300053104 Ga0500556_0057028 Ga0500556_0057028_198_938 216
463 3300053104 Ga0500556_0096077 Ga0500556_0096077_199_897 216
464 3300053109 Ga0500569_000485 Ga0500569_000485_4865_5563 216
465 3300053122 Ga0500608_025422 Ga0500608_025422_553_1263 216
466 3300053130 Ga0500642_0000980 Ga0500642_0000980_4013_4720 216
467 3300053134 Ga0500658_0006868 Ga0500658_0006868_3145_3852 216
468 3300053134 Ga0500658_0034474 Ga0500658_0034474_145_843 216
469 3300053136 Ga0500559_0000584 Ga0500559_0000584_13941_14639 216
470 3300053136 Ga0500559_0002128 Ga0500559_0002128_5719_6417 216
471 3300053136 Ga0500559_0048652 Ga0500559_0048652_229_939 216
472 3300053136 Ga0500559_0094013 Ga0500559_0094013_560_1258 216
473 3300053138 Ga0500564_024998 Ga0500564_024998_931_1629 216
474 3300053138 Ga0500564_059921 Ga0500564_059921_1000_1710 216
475 3300053140 Ga0500573_0024913 Ga0500573_0024913_721_1419 216
476 3300053146 Ga0500588_0062074 Ga0500588_0062074_181_888 216
477 3300053147 Ga0500589_090618 Ga0500589_090618_297_1004 216
478 3300053151 Ga0500604_0033309 Ga0500604_0033309_476_1183 216
479 3300053153 Ga0500616_0003150 Ga0500616_0003150_11908_12606 216
480 3300053154 Ga0500619_024882 Ga0500619_024882_504_1214 216
481 3300053156 Ga0500622_0000001 Ga0500622_0000001_171263_171961 216
482 3300053156 Ga0500622_0008425 Ga0500622_0008425_333_1073 216
483 3300053156 Ga0500622_0033263 Ga0500622_0033263_583_1281 216
484 3300053162 Ga0500638_032444 Ga0500638_032444_928_1638 216
485 3300053177 Ga0500636_0000076 Ga0500636_0000076_17017_17727 216
486 3300053730 Ga0500645_011547 Ga0500645_011547_1076_1789 216
487 3300053737 Ga0500601_000030 Ga0500601_000030_15995_16693 216
488 iso_pu_bacteria 2861691609 2861695117 216
489 3300006173 Ga0070716_100125466 Ga0070716_1001254662 217
490 3300006946 Ga0079104_1000627 Ga0079104_100062713 217
491 3300009553 Ga0105249_10207736 Ga0105249_102077362 217
492 3300013100 Ga0157373_10045759 Ga0157373_100457592 217
493 3300013104 Ga0157370_10000154 Ga0157370_1000015416 217
494 3300013105 Ga0157369_10611862 Ga0157369_106118622 217
495 3300014968 Ga0157379_10007200 Ga0157379_1000720010 217
496 3300025245 Ga0207425_1001839 Ga0207425_10018395 217
497 3300025298 Ga0209050_1015038 Ga0209050_10150381 217
498 3300026116 Ga0207674_10233622 Ga0207674_102336222 217
499 3300027111 Ga0209281_1000198 Ga0209281_1000198115 217
500 3300028380 Ga0268265_10198835 Ga0268265_101988352 217
501 3300028558 Ga0265326_10042209 Ga0265326_100422092 217
502 3300028653 Ga0265323_10010586 Ga0265323_100105862 217
503 3300031911 Ga0307412_10000629 Ga0307412_1000062911 217
504 3300032004 Ga0307414_10000030 Ga0307414_10000030107 217
505 3300042145 Ga0450906_009471 Ga0450906_009471_609_1379 217
506 3300044712 Ga0453684_0001941 Ga0453684_0001941_20503_21291 217
507 3300044712 Ga0453684_0021415 Ga0453684_0021415_2531_3229 217
508 3300045051 Ga0451576_0003894 Ga0451576_0003894_14038_14736 217
509 3300046518 Ga0495631_0123876 Ga0495631_0123876_133_873 217
510 3300046524 Ga0495648_0121091 Ga0495648_0121091_88_828 217
511 3300046538 Ga0495609_0065880 Ga0495609_0065880_293_1033 217
512 3300046557 Ga0495622_0002744 Ga0495622_0002744_469_1209 217
513 3300046665 Ga0495661_0119017 Ga0495661_0119017_188_928 217
514 3300046674 Ga0495588_0001986 Ga0495588_0001986_7932_8672 217
515 3300047321 Ga0495676_0000093 Ga0495676_0000093_14471_15211 217
516 3300048091 Ga0495626_0040030 Ga0495626_0040030_353_1093 217
517 3300048920 Ga0496117_0000775 Ga0496117_0000775_22531_23232 217
518 3300048924 Ga0496121_0004764 Ga0496121_0004764_10291_10992 217
519 3300049586 Ga0501070_0035058 Ga0501070_0035058_1823_2530 217
520 3300050514 nmdc:mga08x19_263361_c1 nmdc:mga08x19_263361_c1_415_1122 217
521 3300053148 Ga0500590_082614 Ga0500590_082614_533_1279 217
522 3300053151 Ga0500604_0000001 Ga0500604_0000001_33111_33878 217
523 iso_pu_bacteria 2574179768 2574431873 217
524 3300003323 rootH1_10306814 rootH1_103068142 218
525 3300005295 Ga0065707_10277394 Ga0065707_102773942 218
526 3300005353 Ga0070669_100124600 Ga0070669_1001246003 218
527 3300005355 Ga0070671_100000001 Ga0070671_1000000011123 218
528 3300005356 Ga0070674_100254096 Ga0070674_1002540961 218
529 3300005441 Ga0070700_100560128 Ga0070700_1005601281 218
530 3300005455 Ga0070663_100322199 Ga0070663_1003221991 218
531 3300005456 Ga0070678_100026668 Ga0070678_1000266683 218
532 3300005518 Ga0070699_100001291 Ga0070699_10000129117 218
533 3300005549 Ga0070704_100024796 Ga0070704_1000247963 218
534 3300006844 Ga0075428_100222407 Ga0075428_1002224072 218
535 3300009147 Ga0114129_10083943 Ga0114129_100839432 218
536 3300013104 Ga0157370_10021030 Ga0157370_100210303 218
537 3300013297 Ga0157378_10110488 Ga0157378_101104883 218
538 3300014326 Ga0157380_10171392 Ga0157380_101713923 218
539 3300014969 Ga0157376_10436916 Ga0157376_104369162 218
540 3300025923 Ga0207681_10391987 Ga0207681_103919872 218
541 3300025931 Ga0207644_10000001 Ga0207644_10000001314 218
542 3300026041 Ga0207639_10003427 Ga0207639_100034278 218
543 3300026121 Ga0207683_10172414 Ga0207683_101724143 218
544 3300031507 Ga0307509_10095354 Ga0307509_100953544 218
545 3300042876 Ga0451577_0000052 Ga0451577_0000052_190568_191287 218
546 3300044712 Ga0453684_0003648 Ga0453684_0003648_25953_26657 218
547 3300044712 Ga0453684_0244912 Ga0453684_0244912_629_1333 218
548 3300045051 Ga0451576_0007917 Ga0451576_0007917_4693_5397 218
549 3300050507 nmdc:mga05p37_37594_c1 nmdc:mga05p37_37594_c1_777_1478 218
550 3300050508 nmdc:mga09592_290592_c1 nmdc:mga09592_290592_c1_615_1316 218
551 3300001904 JGI24736J21556_1017273 JGI24736J21556_10172732 219
552 3300005327 Ga0070658_10006490 Ga0070658_100064902 219
553 3300005530 Ga0070679_100076783 Ga0070679_1000767833 219
554 3300005614 Ga0068856_100192675 Ga0068856_1001926753 219
555 3300006880 Ga0075429_100829581 Ga0075429_1008295811 219
556 3300025904 Ga0207647_10000410 Ga0207647_1000041013 219
557 3300025909 Ga0207705_10000057 Ga0207705_10000057104 219
558 3300026078 Ga0207702_10798240 Ga0207702_107982402 219
559 3300039437 Ga0436365_1141939 Ga0436365_1141939_318_1040 219
560 3300044712 Ga0453684_0023286 Ga0453684_0023286_7685_8398 219
561 3300053727 Ga0500611_017781 Ga0500611_017781_431_1135 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08889

WbqC

WbqC-like protein family

43

259

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e5q-assembly2.cif.gz_D ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine 0.5525 1 30
3wse-assembly1.cif.gz_A reduced hcgd from methanocaldococcus jannaschii 0.5469 1 29
6ihd-assembly1.cif.gz_A-2 crystal structure of malate dehydrogenase from metallosphaera sedula 0.5345 3 170
6ihd-assembly1.cif.gz_B crystal structure of malate dehydrogenase from metallosphaera sedula 0.5236 3 157
4j3c-assembly1.cif.gz_A crystal structure of 16s ribosomal rna methyltransferase rsme 0.5234 2 33
ID Description Score Start End Superfamily
af_P9WLW5_8_225_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.896 8 211 3.40.50.620
af_P9WLW5_8_225_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8378 8 211 3.40.50.620
af_Q94HW2_515_690_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6386 149 181 3.30.420.10
af_O88712_64_123_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.5658 129 174 3.90.180.10
af_Q5TIN9_33_321_3.90.1480.20 Alpha Beta;Alpha-Beta Complex;sialyltransferase cstii, chain A;Glycosyl transferase family 29 0.5653 2 32 3.90.1480.20
ID Description Score Start End GO Terms
AF-A0A367RHY6-F1-model_v4 WbqC-like protein 0.9622 3 219
AF-A0A418X0J1-F1-model_v4 Glycine transferase 0.962 2 219 GO:0016020
AF-A0A0Q8Q7J6-F1-model_v4 WbqC-like protein 0.9616 2 219
AF-A0A2T5ZP05-F1-model_v4 deleted 0.9606 1 219
AF-A0A7C1D088-F1-model_v4 Glycine transferase 0.9599 1 219

Feature Viewer

pLDDT pTM Quality
88.63 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map