F463793

General Info

Members Datasets Scaffolds Average Seq Length
561 293 1122 121

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100074408|Ga0070705_1000744082
Length 141
Sequence MLNPESRVHMSSPQPPAPSNQSVTHHRWDDMPRERVSDLLERRLVCGERMMLAHVYLKKGCIVPKHSHHNEQLTYILEGALRFWIGEDQQETLVVRAGEVLHIPGNVPHKAEALEDTLDVDVFSPPRQDWLDKSDDYLRRK

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
101 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
102 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
103 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
264 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
287 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
288 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
289 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0
Rhizoplane 3.39
Rhizosphere 92.34
Stem 0
Stem Tuber 0
Unclassified 23.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100074408 3300005440 Bacteria 2065
2 ARcpr5oldR_c011158 3300000041 Unclassified 767
3 ARcpr5yngRDRAFT_c020591 3300000043 Unclassified 559
4 ARSoilOldRDRAFT_c012914 3300000044 Unclassified 704
5 Ga0065712_10150476 3300005290 Unclassified 1374
6 Ga0065715_10372889 3300005293 Unclassified 918
7 Ga0065715_10412601 3300005293 Unclassified 868
8 Ga0070658_10162442 3300005327 Bacteria 1874
9 Ga0070676_10066953 3300005328 Bacteria 2146
10 Ga0070676_10120078 3300005328 Unclassified 1649
11 Ga0070683_100622257 3300005329 Bacteria 1033
12 Ga0070690_100172090 3300005330 Unclassified 1491
13 Ga0070690_100545284 3300005330 Bacteria 874
14 Ga0070670_100352274 3300005331 Unclassified 1293
15 Ga0068869_100015168 3300005334 Bacteria 5162
16 Ga0070666_10421091 3300005335 Bacteria 962
17 Ga0070680_100075568 3300005336 Unclassified 2773
18 Ga0070682_100716450 3300005337 Bacteria 804
19 Ga0068868_100316433 3300005338 Unclassified 1329
20 Ga0068868_100612262 3300005338 Bacteria 966
21 Ga0070660_100059696 3300005339 Bacteria 2958
22 Ga0070660_100225079 3300005339 Bacteria 1525
23 Ga0070689_100012739 3300005340 Bacteria 6069
24 Ga0070689_100042167 3300005340 Unclassified 3504
25 Ga0070689_100268865 3300005340 Bacteria 1411
26 Ga0070691_10037807 3300005341 Unclassified 2278
27 Ga0070687_100054795 3300005343 Bacteria 2079
28 Ga0070661_100045493 3300005344 Unclassified 3209
29 Ga0070661_100896430 3300005344 Bacteria 732
30 Ga0070692_10490194 3300005345 Unclassified 794
31 Ga0070668_100061349 3300005347 Bacteria 2913
32 Ga0070669_100138690 3300005353 Bacteria 1873
33 Ga0070669_100664179 3300005353 Unclassified 878
34 Ga0070675_100015731 3300005354 Bacteria 5986
35 Ga0070675_100225202 3300005354 Bacteria 1634
36 Ga0070675_100364996 3300005354 Unclassified 1283
37 Ga0070675_101126246 3300005354 Bacteria 722
38 Ga0070671_100527006 3300005355 Unclassified 1018
39 Ga0070671_100684777 3300005355 Bacteria 889
40 Ga0070671_101149140 3300005355 Unclassified 683
41 Ga0070674_100063386 3300005356 Bacteria 2587
42 Ga0070674_100123064 3300005356 Bacteria 1923
43 Ga0070674_101609037 3300005356 Unclassified 586
44 Ga0070673_100266749 3300005364 Bacteria 1497
45 Ga0070673_100487359 3300005364 Unclassified 1114
46 Ga0070688_100002321 3300005365 Bacteria 9605
47 Ga0070688_100016808 3300005365 Bacteria 4189
48 Ga0070688_100050615 3300005365 Bacteria 2589
49 Ga0070688_100854021 3300005365 Unclassified 715
50 Ga0070688_101119935 3300005365 Bacteria 630
51 Ga0070667_100436813 3300005367 Unclassified 1195
52 Ga0070703_10031450 3300005406 Bacteria 1605
53 Ga0070713_100085804 3300005436 Bacteria 2697
54 Ga0070701_10006292 3300005438 Bacteria 4985
55 Ga0070701_10130939 3300005438 Unclassified 1425
56 Ga0070701_10245079 3300005438 Bacteria 1080
57 Ga0070711_100453978 3300005439 Bacteria 1050
58 Ga0070705_100141089 3300005440 Bacteria 1586
59 Ga0070705_100745014 3300005440 Unclassified 774
60 Ga0070700_100014707 3300005441 Bacteria 4422
61 Ga0070694_100093327 3300005444 Bacteria 2116
62 Ga0070694_100141535 3300005444 Bacteria 1748
63 Ga0070694_100144756 3300005444 Bacteria 1730
64 Ga0070694_100599219 3300005444 Bacteria 887
65 Ga0070694_101072572 3300005444 Bacteria 671
66 Ga0070708_100094310 3300005445 Bacteria 2730
67 Ga0070708_100149578 3300005445 Bacteria 2171
68 Ga0070708_101459318 3300005445 Bacteria 638
69 Ga0070663_100006737 3300005455 Bacteria 6937
70 Ga0070663_100468854 3300005455 Bacteria 1041
71 Ga0070663_100904347 3300005455 Unclassified 763
72 Ga0070678_100421437 3300005456 Unclassified 1164
73 Ga0070678_101536180 3300005456 Bacteria 624
74 Ga0070681_10022837 3300005458 Bacteria 6287
75 Ga0070681_11120454 3300005458 Unclassified 708
76 Ga0070681_11285822 3300005458 Unclassified 654
77 Ga0068867_100036949 3300005459 Bacteria 3548
78 Ga0070685_10896538 3300005466 Unclassified 660
79 Ga0070706_100174057 3300005467 Bacteria 2010
80 Ga0070706_100185404 3300005467 Bacteria 1944
81 Ga0070706_100230234 3300005467 Unclassified 1730
82 Ga0070706_100356911 3300005467 Bacteria 1362
83 Ga0070706_100771535 3300005467 Bacteria 890
84 Ga0070706_101340546 3300005467 Bacteria 656
85 Ga0070706_101804841 3300005467 Bacteria 556
86 Ga0070707_100002753 3300005468 Bacteria 16744
87 Ga0070707_100003939 3300005468 Bacteria 13973
88 Ga0070707_100004176 3300005468 Bacteria 13533
89 Ga0070707_100119844 3300005468 Bacteria 2555
90 Ga0070707_100161343 3300005468 Bacteria 2184
91 Ga0070707_100260094 3300005468 Unclassified 1689
92 Ga0070707_101748941 3300005468 Bacteria 589
93 Ga0070698_100005330 3300005471 Bacteria 14077
94 Ga0070698_100064762 3300005471 Bacteria 3681
95 Ga0070698_100068519 3300005471 Unclassified 3565
96 Ga0070698_100228569 3300005471 Bacteria 1794
97 Ga0070698_100449264 3300005471 Bacteria 1224
98 Ga0070698_102228091 3300005471 Bacteria 501
99 Ga0070699_100000131 3300005518 Bacteria 69337
100 Ga0070699_100004611 3300005518 Bacteria 12194
101 Ga0070699_100006961 3300005518 Bacteria 9831
102 Ga0070699_100029246 3300005518 Bacteria 4751
103 Ga0070699_100162411 3300005518 Bacteria 1977
104 Ga0070699_100498472 3300005518 Unclassified 1106
105 Ga0070699_101289054 3300005518 Bacteria 670
106 Ga0070699_101805132 3300005518 Unclassified 560
107 Ga0070697_100001302 3300005536 Bacteria 18809
108 Ga0070697_100019286 3300005536 Bacteria 5387
109 Ga0070697_100264239 3300005536 Unclassified 1474
110 Ga0070672_100309531 3300005543 Bacteria 1340
111 Ga0070686_100014309 3300005544 Bacteria 4572
112 Ga0070686_100088962 3300005544 Bacteria 2062
113 Ga0070686_100109902 3300005544 Bacteria 1876
114 Ga0070686_100274812 3300005544 Bacteria 1240
115 Ga0070695_100009559 3300005545 Bacteria 5777
116 Ga0070695_100204588 3300005545 Bacteria 1413
117 Ga0070696_100071960 3300005546 Bacteria 2434
118 Ga0070696_100099064 3300005546 Bacteria 2086
119 Ga0070696_100144466 3300005546 Bacteria 1742
120 Ga0070696_100324304 3300005546 Bacteria 1186
121 Ga0070696_101147668 3300005546 Bacteria 655
122 Ga0070665_100291357 3300005548 Bacteria 1635
123 Ga0070665_101611909 3300005548 Unclassified 657
124 Ga0070704_100025894 3300005549 Bacteria 3868
125 Ga0070704_100217307 3300005549 Bacteria 1552
126 Ga0070704_100259096 3300005549 Bacteria 1432
127 Ga0070704_101001376 3300005549 Unclassified 756
128 Ga0068855_100162231 3300005563 Bacteria 2536
129 Ga0070664_100739389 3300005564 Bacteria 918
130 Ga0068857_100517378 3300005577 Unclassified 1121
131 Ga0068854_100015220 3300005578 Bacteria 5091
132 Ga0068854_100130989 3300005578 Bacteria 1915
133 Ga0070702_100042812 3300005615 Bacteria 2548
134 Ga0068852_100047648 3300005616 Bacteria 3657
135 Ga0068859_100044655 3300005617 Bacteria 4452
136 Ga0068859_100126341 3300005617 Bacteria 2627
137 Ga0068859_100340411 3300005617 Bacteria 1594
138 Ga0068859_100579429 3300005617 Bacteria 1216
139 Ga0068859_101369719 3300005617 Bacteria 780
140 Ga0068864_100374748 3300005618 Bacteria 1347
141 Ga0068866_10119025 3300005718 Bacteria 1485
142 Ga0068861_100025655 3300005719 Bacteria 4277
143 Ga0068861_100036391 3300005719 Bacteria 3653
144 Ga0068861_100231734 3300005719 Bacteria 1566
145 Ga0068861_100497873 3300005719 Bacteria 1101
146 Ga0068861_102248421 3300005719 Unclassified 547
147 Ga0068870_10012426 3300005840 Unclassified 3980
148 Ga0068870_11364655 3300005840 Unclassified 518
149 Ga0068870_11418676 3300005840 Bacteria 509
150 Ga0068863_100093615 3300005841 Bacteria 2851
151 Ga0068863_102528274 3300005841 Unclassified 523
152 Ga0068858_100019582 3300005842 Bacteria 6327
153 Ga0068860_100048147 3300005843 Bacteria 4063
154 Ga0068860_100090378 3300005843 Bacteria 2917
155 Ga0068860_100246339 3300005843 Unclassified 1739
156 Ga0068860_100604379 3300005843 Bacteria 1102
157 Ga0068862_100017112 3300005844 Bacteria 6032
158 Ga0068862_100066164 3300005844 Bacteria 3113
159 Ga0068862_100270715 3300005844 Unclassified 1553
160 Ga0068862_100413242 3300005844 Bacteria 1265
161 Ga0081455_10308298 3300005937 Unclassified 1132
162 Ga0070717_10081060 3300006028 Bacteria 2724
163 Ga0075365_10067025 3300006038 Bacteria 2409
164 Ga0075363_100025427 3300006048 Bacteria 3020
165 Ga0075364_10117258 3300006051 Bacteria 1780
166 Ga0075362_10143185 3300006177 Bacteria 1143
167 Ga0075367_10002010 3300006178 Bacteria 9072
168 Ga0075366_10000407 3300006195 Bacteria 20072
169 Ga0097621_100376988 3300006237 Bacteria 1266
170 Ga0075428_100981717 3300006844 Unclassified 894
171 Ga0075430_100062349 3300006846 Bacteria 3132
172 Ga0075431_100006910 3300006847 Bacteria 11281
173 Ga0075433_10072851 3300006852 Bacteria 3021
174 Ga0075433_10269583 3300006852 Bacteria 1509
175 Ga0075433_10280994 3300006852 Bacteria 1475
176 Ga0075434_100045467 3300006871 Bacteria 4356
177 Ga0075434_100084365 3300006871 Unclassified 3176
178 Ga0075434_100209143 3300006871 Bacteria 1971
179 Ga0075434_101285119 3300006871 Bacteria 743
180 Ga0075429_100006106 3300006880 Bacteria 10413
181 Ga0075429_100070734 3300006880 Unclassified 3038
182 Ga0068865_100019076 3300006881 Bacteria 4435
183 Ga0075436_100009243 3300006914 Bacteria 6745
184 Ga0075436_100309666 3300006914 Bacteria 1133
185 Ga0075436_100666138 3300006914 Bacteria 769
186 Ga0075436_100713824 3300006914 Bacteria 743
187 Ga0075436_100799918 3300006914 Bacteria 702
188 Ga0097620_100044656 3300006931 Bacteria 4452
189 Ga0097620_100126334 3300006931 Bacteria 2627
190 Ga0097620_100340423 3300006931 Bacteria 1594
191 Ga0097620_100579365 3300006931 Bacteria 1216
192 Ga0097620_101369821 3300006931 Bacteria 780
193 Ga0075435_100010233 3300007076 Bacteria 6852
194 Ga0075435_100823865 3300007076 Bacteria 808
195 Ga0075435_101013884 3300007076 Bacteria 725
196 Ga0105240_10056782 3300009093 Bacteria 4896
197 Ga0105240_10300297 3300009093 Bacteria 1837
198 Ga0105240_10669611 3300009093 Unclassified 1135
199 Ga0105240_11540660 3300009093 Unclassified 696
200 Ga0111539_10000117 3300009094 Bacteria 88188
201 Ga0111539_10002983 3300009094 Bacteria 22447
202 Ga0111539_10008457 3300009094 Bacteria 13091
203 Ga0111539_10194175 3300009094 Bacteria 2368
204 Ga0111539_12188982 3300009094 Bacteria 641
205 Ga0105245_10050546 3300009098 Bacteria 3726
206 Ga0105245_10708066 3300009098 Unclassified 1041
207 Ga0105245_12665230 3300009098 Unclassified 553
208 Ga0105247_10118441 3300009101 Bacteria 1713
209 Ga0105247_10708375 3300009101 Bacteria 758
210 Ga0114129_10015411 3300009147 Bacteria 10876
211 Ga0114129_10027608 3300009147 Bacteria 8037
212 Ga0114129_10096391 3300009147 Bacteria 4095
213 Ga0114129_10134224 3300009147 Bacteria 3397
214 Ga0114129_10266929 3300009147 Bacteria 2291
215 Ga0114129_10321362 3300009147 Bacteria 2057
216 Ga0114129_10634988 3300009147 Bacteria 1380
217 Ga0105243_10006709 3300009148 Bacteria 8885
218 Ga0105243_10749653 3300009148 Bacteria 957
219 Ga0105243_10947546 3300009148 Bacteria 860
220 Ga0105242_10035399 3300009176 Bacteria 4004
221 Ga0105248_10422062 3300009177 Bacteria 1502
222 Ga0105248_10578836 3300009177 Bacteria 1267
223 Ga0105237_10026760 3300009545 Bacteria 5895
224 Ga0105238_10067536 3300009551 Unclassified 3576
225 Ga0105238_11079777 3300009551 Bacteria 825
226 Ga0105238_11351075 3300009551 Bacteria 739
227 Ga0105249_10065424 3300009553 Bacteria 3344
228 Ga0105249_10068708 3300009553 Bacteria 3268
229 Ga0105249_12188602 3300009553 Bacteria 626
230 Ga0105246_10210700 3300011119 Bacteria 1517
231 Ga0105246_10653686 3300011119 Bacteria 915
232 Ga0105246_10984137 3300011119 Unclassified 762
233 Ga0157340_1006025 3300012473 Bacteria 749
234 Ga0157324_1047761 3300012506 Unclassified 547
235 Ga0157327_1010739 3300012512 Bacteria 870
236 Ga0157326_1020107 3300012513 Bacteria 818
237 Ga0157373_11169435 3300013100 Bacteria 579
238 Ga0157371_10024148 3300013102 Unclassified 4441
239 Ga0157371_11257936 3300013102 Unclassified 572
240 Ga0157370_10175730 3300013104 Bacteria 1990
241 Ga0157370_11880277 3300013104 Bacteria 537
242 Ga0157369_10004652 3300013105 Bacteria 16126
243 Ga0157369_10079794 3300013105 Unclassified 3505
244 Ga0157369_10223412 3300013105 Bacteria 1970
245 Ga0157369_11147720 3300013105 Archaea 794
246 Ga0157369_11549652 3300013105 Bacteria 674
247 Ga0157374_10261820 3300013296 Unclassified 1703
248 Ga0157374_12904246 3300013296 Unclassified 506
249 Ga0157378_10350122 3300013297 Unclassified 1443
250 Ga0157378_10404956 3300013297 Bacteria 1345
251 Ga0163162_10219627 3300013306 Bacteria 2031
252 Ga0157372_10007892 3300013307 Bacteria 11314
253 Ga0157372_10026051 3300013307 Bacteria 6360
254 Ga0157372_10090243 3300013307 Bacteria 3483
255 Ga0157372_12042431 3300013307 Bacteria 659
256 Ga0157375_10153401 3300013308 Unclassified 2441
257 Ga0157375_10285818 3300013308 Bacteria 1812
258 Ga0157375_13762834 3300013308 Bacteria 504
259 Ga0163163_11200487 3300014325 Archaea 821
260 Ga0157380_10027350 3300014326 Unclassified 4338
261 Ga0157380_10406741 3300014326 Bacteria 1293
262 Ga0182008_10009210 3300014497 Bacteria 5338
263 Ga0157377_10413669 3300014745 Bacteria 921
264 Ga0157377_10841321 3300014745 Bacteria 680
265 Ga0157379_10192552 3300014968 Bacteria 1843
266 Ga0157376_10679187 3300014969 Unclassified 1033
267 Ga0163161_11233737 3300017792 Bacteria 648
268 Ga0207697_10161063 3300025315 Unclassified 979
269 Ga0207653_10234158 3300025885 Bacteria 700
270 Ga0207642_10365971 3300025899 Bacteria 854
271 Ga0207710_10253440 3300025900 Unclassified 880
272 Ga0207688_10311821 3300025901 Unclassified 964
273 Ga0207680_10486882 3300025903 Bacteria 878
274 Ga0207647_10123731 3300025904 Bacteria 1524
275 Ga0207645_10149661 3300025907 Unclassified 1523
276 Ga0207643_10045503 3300025908 Bacteria 2479
277 Ga0207643_10276603 3300025908 Bacteria 1040
278 Ga0207705_10018216 3300025909 Bacteria 5020
279 Ga0207705_10117373 3300025909 Bacteria 1971
280 Ga0207705_10835808 3300025909 Bacteria 714
281 Ga0207684_10000013 3300025910 Bacteria 443468
282 Ga0207684_10001354 3300025910 Bacteria 26829
283 Ga0207684_10075818 3300025910 Bacteria 2858
284 Ga0207684_10418947 3300025910 Bacteria 1151
285 Ga0207684_10682758 3300025910 Unclassified 874
286 Ga0207707_10037677 3300025912 Bacteria 4225
287 Ga0207707_10907691 3300025912 Unclassified 728
288 Ga0207695_10004255 3300025913 Bacteria 19659
289 Ga0207695_10318378 3300025913 Bacteria 1445
290 Ga0207671_10176488 3300025914 Bacteria 1661
291 Ga0207662_10002497 3300025918 Bacteria 9245
292 Ga0207662_10258051 3300025918 Bacteria 1146
293 Ga0207657_10002949 3300025919 Bacteria 18256
294 Ga0207657_10482112 3300025919 Unclassified 972
295 Ga0207649_10097035 3300025920 Unclassified 1943
296 Ga0207646_10001318 3300025922 Bacteria 30776
297 Ga0207646_10009206 3300025922 Bacteria 9789
298 Ga0207646_10022036 3300025922 Bacteria 5877
299 Ga0207646_10319850 3300025922 Bacteria 1402
300 Ga0207646_10324200 3300025922 Bacteria 1392
301 Ga0207681_10478323 3300025923 Bacteria 1017
302 Ga0207694_10291839 3300025924 Bacteria 1341
303 Ga0207694_10895066 3300025924 Bacteria 750
304 Ga0207650_10552408 3300025925 Unclassified 966
305 Ga0207659_10183822 3300025926 Bacteria 1658
306 Ga0207659_10313442 3300025926 Unclassified 1292
307 Ga0207687_10067559 3300025927 Bacteria 2543
308 Ga0207687_11269297 3300025927 Unclassified 633
309 Ga0207700_10254349 3300025928 Bacteria 1502
310 Ga0207664_10005221 3300025929 Bacteria 8859
311 Ga0207644_10401464 3300025931 Unclassified 1120
312 Ga0207706_10265144 3300025933 Bacteria 1499
313 Ga0207706_10878281 3300025933 Bacteria 758
314 Ga0207686_10097975 3300025934 Bacteria 1951
315 Ga0207686_10477599 3300025934 Bacteria 963
316 Ga0207709_10372759 3300025935 Bacteria 1084
317 Ga0207709_10689642 3300025935 Bacteria 816
318 Ga0207670_10816736 3300025936 Bacteria 777
319 Ga0207669_10011528 3300025937 Bacteria 4306
320 Ga0207704_10799912 3300025938 Bacteria 787
321 Ga0207691_10051978 3300025940 Bacteria 3744
322 Ga0207711_10071427 3300025941 Bacteria 3012
323 Ga0207689_10018588 3300025942 Bacteria 5863
324 Ga0207689_10282904 3300025942 Bacteria 1373
325 Ga0207689_10375988 3300025942 Bacteria 1183
326 Ga0207689_11749475 3300025942 Bacteria 514
327 Ga0207661_10077728 3300025944 Bacteria 2730
328 Ga0207661_10120247 3300025944 Bacteria 2235
329 Ga0207679_10650886 3300025945 Unclassified 953
330 Ga0207667_10002805 3300025949 Bacteria 21585
331 Ga0207667_10084758 3300025949 Unclassified 3281
332 Ga0207667_10189066 3300025949 Bacteria 2113
333 Ga0207667_10224326 3300025949 Unclassified 1925
334 Ga0207667_11180468 3300025949 Unclassified 746
335 Ga0207651_10553786 3300025960 Unclassified 1000
336 Ga0207712_10075541 3300025961 Bacteria 2436
337 Ga0207712_11791379 3300025961 Bacteria 550
338 Ga0207668_10234021 3300025972 Bacteria 1483
339 Ga0207668_11995944 3300025972 Bacteria 523
340 Ga0207658_11098462 3300025986 Unclassified 726
341 Ga0207677_10049827 3300026023 Bacteria 2829
342 Ga0207677_10439599 3300026023 Unclassified 1115
343 Ga0207703_10287134 3300026035 Bacteria 1496
344 Ga0207639_11932168 3300026041 Bacteria 551
345 Ga0207678_10000490 3300026067 Bacteria 35927
346 Ga0207678_10309482 3300026067 Bacteria 1358
347 Ga0207708_10070881 3300026075 Bacteria 2669
348 Ga0207708_12042290 3300026075 Bacteria 502
349 Ga0207702_10055468 3300026078 Bacteria 3361
350 Ga0207702_11971779 3300026078 Unclassified 575
351 Ga0207641_11326826 3300026088 Bacteria 720
352 Ga0207641_11777505 3300026088 Unclassified 618
353 Ga0207648_10004013 3300026089 Bacteria 15276
354 Ga0207674_10302251 3300026116 Bacteria 1549
355 Ga0207674_11179092 3300026116 Unclassified 735
356 Ga0207675_100011412 3300026118 Bacteria 8316
357 Ga0207675_100147520 3300026118 Bacteria 2237
358 Ga0207675_102379366 3300026118 Unclassified 542
359 Ga0207683_10030385 3300026121 Unclassified 4681
360 Ga0207683_10301055 3300026121 Unclassified 1467
361 Ga0207683_10897212 3300026121 Bacteria 823
362 Ga0207698_10513589 3300026142 Bacteria 1168
363 Ga0209813_10039502 3300027866 Bacteria 1430
364 Ga0207428_10000122 3300027907 Bacteria 106165
365 Ga0207428_10024422 3300027907 Bacteria 5075
366 Ga0268266_10755529 3300028379 Unclassified 938
367 Ga0268266_11400622 3300028379 Unclassified 675
368 Ga0268265_10107784 3300028380 Bacteria 2266
369 Ga0268265_11409108 3300028380 Unclassified 699
370 Ga0268264_10097963 3300028381 Bacteria 2542
371 Ga0268264_10454490 3300028381 Bacteria 1242
372 Ga0268264_10597458 3300028381 Bacteria 1087
373 Ga0307517_10052193 3300028786 Bacteria 4105
374 Ga0316182_1059196 3300030745 Bacteria 724
375 Ga0307509_10239191 3300031507 Bacteria 1610
376 Ga0307408_100510112 3300031548 Bacteria 1054
377 Ga0316576_10357518 3300031727 Unclassified 1086
378 Ga0307405_10229647 3300031731 Bacteria 1367
379 Ga0307405_10617487 3300031731 Bacteria 887
380 Ga0307413_10125969 3300031824 Bacteria 1744
381 Ga0307413_11258589 3300031824 Bacteria 646
382 Ga0307410_10026520 3300031852 Unclassified 3649
383 Ga0307406_11018990 3300031901 Unclassified 711
384 Ga0307407_10016192 3300031903 Bacteria 3707
385 Ga0307407_10329542 3300031903 Unclassified 1074
386 Ga0307412_10021688 3300031911 Unclassified 3928
387 Ga0307412_10083022 3300031911 Bacteria 2220
388 Ga0307409_100061928 3300031995 Bacteria 2927
389 Ga0307409_100193458 3300031995 Bacteria 1813
390 Ga0307409_100267359 3300031995 Bacteria 1573
391 Ga0307409_100889352 3300031995 Bacteria 904
392 Ga0307416_100070864 3300032002 Bacteria 2893
393 Ga0307416_101481137 3300032002 Unclassified 784
394 Ga0307414_10286236 3300032004 Bacteria 1387
395 Ga0307411_10167747 3300032005 Bacteria 1652
396 Ga0307411_11663675 3300032005 Bacteria 590
397 Ga0307415_100048861 3300032126 Bacteria 2857
398 Ga0307415_100065390 3300032126 Bacteria 2534
399 Ga0373958_0094450 3300034819 Bacteria 694
400 Ga0373936_0000043 3300035113 Bacteria 87319
401 Ga0373943_0784557 3300035170 Bacteria 567
402 Ga0316574_0429108 3300035398 Bacteria 830
403 Ga0316574_0759472 3300035398 Bacteria 592
404 Ga0373931_0015839 3300035691 Bacteria 3702
405 Ga0373931_0357357 3300035691 Unclassified 916
406 Ga0373947_0104703 3300035725 Unclassified 1782
407 Ga0373937_1224479 3300036401 Bacteria 699
408 Ga0316584_0285905 3300036712 Unclassified 1197
409 Ga0395899_0428473 3300037312 Bacteria 870
410 Ga0395900_1274615 3300037418 Bacteria 649
411 Ga0395905_0009602 3300037471 Bacteria 9449
412 Ga0436364_0169726 3300037853 Bacteria 7787
413 Ga0395901_0491244 3300038443 Bacteria 1251
414 Ga0395901_0596901 3300038443 Bacteria 1114
415 Ga0436365_0299300 3300039437 Unclassified 603
416 Ga0436365_1023238 3300039437 Bacteria 817
417 Ga0439439_0016227 3300041406 Unclassified 1823
418 Ga0451800_1555646 3300041459 Unclassified 595
419 Ga0439446_0341931 3300042156 Bacteria 532
420 Ga0466963_0498864 3300044694 Bacteria 859
421 Ga0466963_0550629 3300044694 Bacteria 815
422 Ga0453684_0218339 3300044712 Bacteria 2210
423 Ga0466967_1711028 3300045976 Bacteria 626
424 Ga0495629_0059806 3300046459 Bacteria 2663
425 Ga0495580_0318154 3300046472 Unclassified 1058
426 Ga0495583_0263129 3300046506 Bacteria 690
427 Ga0495630_0540465 3300046517 Unclassified 894
428 Ga0495652_0359055 3300046529 Unclassified 1042
429 Ga0495652_0710234 3300046529 Bacteria 676
430 Ga0495598_0466300 3300046537 Unclassified 502
431 Ga0495645_0000061 3300046543 Bacteria 79047
432 Ga0495633_0524039 3300046558 Unclassified 534
433 Ga0495656_0384465 3300046615 Bacteria 732
434 Ga0495625_0198226 3300046660 Bacteria 1327
435 Ga0495588_0013090 3300046674 Bacteria 3944
436 Ga0495599_0747589 3300046678 Bacteria 561
437 Ga0495658_0097194 3300046683 Bacteria 1752
438 Ga0495600_0004987 3300046809 Bacteria 7975
439 Ga0495600_0292493 3300046809 Unclassified 1029
440 Ga0495675_0794845 3300047444 Bacteria 524
441 Ga0496100_0754015 3300048903 Unclassified 761
442 Ga0496101_0575244 3300048904 Unclassified 891
443 Ga0496101_0767353 3300048904 Bacteria 761
444 Ga0496102_0607746 3300048905 Unclassified 1016
445 Ga0496104_0199717 3300048907 Bacteria 1912
446 Ga0496104_0870023 3300048907 Unclassified 806
447 Ga0496105_0142340 3300048908 Unclassified 1974
448 Ga0496106_0352627 3300048909 Unclassified 1182
449 Ga0496108_0123261 3300048911 Bacteria 2224
450 Ga0496108_0486908 3300048911 Unclassified 1077
451 Ga0496109_0146401 3300048912 Unclassified 2210
452 Ga0496110_0104227 3300048913 Unclassified 2545
453 Ga0496110_0774932 3300048913 Bacteria 863
454 Ga0496111_0224343 3300048914 Unclassified 1396
455 Ga0496111_0872283 3300048914 Bacteria 649
456 Ga0496112_0000517 3300048915 Bacteria 26259
457 Ga0496113_0070489 3300048916 Bacteria 2657
458 Ga0496113_0289458 3300048916 Bacteria 1310
459 Ga0501292_030719 3300049515 Unclassified 902
460 Ga0501032_0011883 3300049569 Bacteria 6236
461 Ga0501033_0180449 3300049570 Bacteria 1513
462 Ga0501033_0994094 3300049570 Bacteria 561
463 Ga0501034_0007715 3300049571 Bacteria 11447
464 Ga0501034_0091417 3300049571 Bacteria 3041
465 Ga0501036_0069769 3300049572 Bacteria 2972
466 Ga0501038_0553496 3300049574 Bacteria 874
467 Ga0501038_0833666 3300049574 Bacteria 684
468 Ga0501038_1178438 3300049574 Bacteria 557
469 Ga0501041_0009853 3300049577 Bacteria 5626
470 Ga0501043_0009045 3300049579 Bacteria 7837
471 Ga0501046_0017581 3300049580 Bacteria 5963
472 Ga0501047_0306943 3300049581 Bacteria 1428
473 Ga0501047_0890111 3300049581 Bacteria 704
474 Ga0501047_0910821 3300049581 Bacteria 693
475 Ga0501048_0032405 3300049582 Bacteria 3776
476 Ga0501067_0014155 3300049583 Bacteria 4418
477 Ga0501067_0161728 3300049583 Bacteria 1247
478 Ga0501068_0069292 3300049584 Bacteria 2150
479 Ga0501069_0029957 3300049585 Bacteria 2987
480 Ga0501069_0762390 3300049585 Bacteria 585
481 Ga0501070_0022780 3300049586 Bacteria 5243
482 Ga0501070_0023584 3300049586 Bacteria 5155
483 Ga0501070_0151482 3300049586 Bacteria 1913
484 Ga0501070_0645656 3300049586 Bacteria 841
485 Ga0501071_0421923 3300049587 Bacteria 1019
486 Ga0501072_0010373 3300049588 Bacteria 7098
487 Ga0501072_0023633 3300049588 Bacteria 4774
488 Ga0501072_0128081 3300049588 Bacteria 2023
489 Ga0501072_0380950 3300049588 Bacteria 1119
490 Ga0501073_0020119 3300049589 Bacteria 4813
491 Ga0501073_0022513 3300049589 Bacteria 4537
492 Ga0501073_0028115 3300049589 Bacteria 4017
493 Ga0501074_0010448 3300049590 Bacteria 6737
494 Ga0501074_0057924 3300049590 Bacteria 2791
495 Ga0501075_0446561 3300049591 Bacteria 986
496 Ga0501076_0272163 3300049592 Unclassified 1387
497 Ga0501076_0304276 3300049592 Bacteria 1307
498 Ga0501217_044677 3300049661 Bacteria 1139
499 Ga0501221_039615 3300049704 Bacteria 1022
500 Ga0501079_0010628 3300049741 Bacteria 7005
501 Ga0501079_0881013 3300049741 Unclassified 705
502 Ga0501080_0002078 3300049742 Bacteria 17369
503 Ga0501080_0065754 3300049742 Bacteria 3372
504 Ga0501080_1363985 3300049742 Unclassified 606
505 Ga0501081_0096073 3300049743 Bacteria 2090
506 Ga0501081_0111491 3300049743 Bacteria 1941
507 Ga0501081_0377539 3300049743 Bacteria 1047
508 Ga0501083_0007689 3300049744 Bacteria 7644
509 Ga0501083_0019905 3300049744 Bacteria 4670
510 Ga0501035_0180193 3300049822 Bacteria 1820
511 Ga0501044_0615355 3300049823 Bacteria 978
512 Ga0501045_0040451 3300049824 Bacteria 3392
513 Ga0501045_0068300 3300049824 Bacteria 2611
514 nmdc:mga03683_12474_c1 3300050489 Bacteria 3106
515 nmdc:mga03n38_5847_c1 3300050490 Bacteria 4225
516 nmdc:mga00v17_20716_c1 3300050491 Bacteria 3771
517 nmdc:mga0yw44_545008_c1 3300050492 Unclassified 788
518 nmdc:mga0k408_1762_c1 3300050493 Bacteria 11601
519 nmdc:mga06z11_79398_c1 3300050494 Bacteria 1757
520 nmdc:mga05p37_109242_c1 3300050507 Bacteria 3402
521 nmdc:mga05p37_275390_c1 3300050507 Bacteria 2009
522 nmdc:mga05p37_353284_c1 3300050507 Bacteria 1730
523 nmdc:mga05p37_61249_c1 3300050507 Bacteria 4633
524 nmdc:mga05p37_741033_c1 3300050507 Bacteria 1085
525 nmdc:mga05p37_85233_c1 3300050507 Unclassified 3893
526 nmdc:mga09592_392228_c1 3300050508 Bacteria 1200
527 nmdc:mga09592_87564_c1 3300050508 Bacteria 2659
528 nmdc:mga06r32_337684_c1 3300050510 Bacteria 1491
529 nmdc:mga06r32_360626_c1 3300050510 Bacteria 1437
530 nmdc:mga06r32_611711_c1 3300050510 Bacteria 1060
531 nmdc:mga06r32_9724_c1 3300050510 Bacteria 8685
532 nmdc:mga08y16_1200392_c1 3300050511 Bacteria 729
533 nmdc:mga08y16_23627_c1 3300050511 Bacteria 6493
534 nmdc:mga08y16_49380_c1 3300050511 Unclassified 4403
535 nmdc:mga08y16_9948_c1 3300050511 Bacteria 9983
536 nmdc:mga0n895_223968_c1 3300050512 Bacteria 1909
537 nmdc:mga0n895_247497_c1 3300050512 Bacteria 1809
538 nmdc:mga0n895_798614_c1 3300050512 Bacteria 934
539 nmdc:mga0n895_985067_c1 3300050512 Bacteria 825
540 nmdc:mga0rr50_1205561_c1 3300050513 Bacteria 643
541 nmdc:mga0rr50_28515_c1 3300050513 Bacteria 3925
542 nmdc:mga0rr50_686060_c1 3300050513 Bacteria 874
543 nmdc:mga08x19_153563_c1 3300050514 Bacteria 1560
544 nmdc:mga08x19_45672_c1 3300050514 Bacteria 2799
545 nmdc:mga0a205_112339_c1 3300050515 Bacteria 2624
546 nmdc:mga0a205_25300_c1 3300050515 Bacteria 5653
547 nmdc:mga0a205_335324_c1 3300050515 Bacteria 1381
548 nmdc:mga0a205_891610_c1 3300050515 Unclassified 736
549 nmdc:mga0a205_95957_c1 3300050515 Bacteria 2864
550 nmdc:mga0sz30_182089_c1 3300050516 Unclassified 932
551 Ga0500646_0004469 3300053090 Bacteria 3544
552 Ga0500583_0187018 3300053092 Bacteria 1031
553 Ga0500654_119764 3300053099 Bacteria 1041
554 Ga0500562_045159 3300053108 Bacteria 1174
555 Ga0500636_0056292 3300053177 Bacteria 2304
556 Ga0501084_0018159 3300054114 Bacteria 5856
557 Ga0501084_0511293 3300054114 Bacteria 1015
558 Ga0501082_0195071 3300060353 Bacteria 1761
559 Ga0501082_0273692 3300060353 Bacteria 1470
560 Ga0501082_0449457 3300060353 Unclassified 1126
561 Ga0501082_1862026 3300060353 Unclassified 525
562 Ga0070705_100074408
563 ARcpr5oldR_c011158
564 ARcpr5yngRDRAFT_c020591
565 ARSoilOldRDRAFT_c012914
566 Ga0065712_10150476
567 Ga0065715_10372889
568 Ga0065715_10412601
569 Ga0070658_10162442
570 Ga0070676_10066953
571 Ga0070676_10120078
572 Ga0070683_100622257
573 Ga0070690_100172090
574 Ga0070690_100545284
575 Ga0070670_100352274
576 Ga0068869_100015168
577 Ga0070666_10421091
578 Ga0070680_100075568
579 Ga0070682_100716450
580 Ga0068868_100316433
581 Ga0068868_100612262
582 Ga0070660_100059696
583 Ga0070660_100225079
584 Ga0070689_100012739
585 Ga0070689_100042167
586 Ga0070689_100268865
587 Ga0070691_10037807
588 Ga0070687_100054795
589 Ga0070661_100045493
590 Ga0070661_100896430
591 Ga0070692_10490194
592 Ga0070668_100061349
593 Ga0070669_100138690
594 Ga0070669_100664179
595 Ga0070675_100015731
596 Ga0070675_100225202
597 Ga0070675_100364996
598 Ga0070675_101126246
599 Ga0070671_100527006
600 Ga0070671_100684777
601 Ga0070671_101149140
602 Ga0070674_100063386
603 Ga0070674_100123064
604 Ga0070674_101609037
605 Ga0070673_100266749
606 Ga0070673_100487359
607 Ga0070688_100002321
608 Ga0070688_100016808
609 Ga0070688_100050615
610 Ga0070688_100854021
611 Ga0070688_101119935
612 Ga0070667_100436813
613 Ga0070703_10031450
614 Ga0070713_100085804
615 Ga0070701_10006292
616 Ga0070701_10130939
617 Ga0070701_10245079
618 Ga0070711_100453978
619 Ga0070705_100141089
620 Ga0070705_100745014
621 Ga0070700_100014707
622 Ga0070694_100093327
623 Ga0070694_100141535
624 Ga0070694_100144756
625 Ga0070694_100599219
626 Ga0070694_101072572
627 Ga0070708_100094310
628 Ga0070708_100149578
629 Ga0070708_101459318
630 Ga0070663_100006737
631 Ga0070663_100468854
632 Ga0070663_100904347
633 Ga0070678_100421437
634 Ga0070678_101536180
635 Ga0070681_10022837
636 Ga0070681_11120454
637 Ga0070681_11285822
638 Ga0068867_100036949
639 Ga0070685_10896538
640 Ga0070706_100174057
641 Ga0070706_100185404
642 Ga0070706_100230234
643 Ga0070706_100356911
644 Ga0070706_100771535
645 Ga0070706_101340546
646 Ga0070706_101804841
647 Ga0070707_100002753
648 Ga0070707_100003939
649 Ga0070707_100004176
650 Ga0070707_100119844
651 Ga0070707_100161343
652 Ga0070707_100260094
653 Ga0070707_101748941
654 Ga0070698_100005330
655 Ga0070698_100064762
656 Ga0070698_100068519
657 Ga0070698_100228569
658 Ga0070698_100449264
659 Ga0070698_102228091
660 Ga0070699_100000131
661 Ga0070699_100004611
662 Ga0070699_100006961
663 Ga0070699_100029246
664 Ga0070699_100162411
665 Ga0070699_100498472
666 Ga0070699_101289054
667 Ga0070699_101805132
668 Ga0070697_100001302
669 Ga0070697_100019286
670 Ga0070697_100264239
671 Ga0070672_100309531
672 Ga0070686_100014309
673 Ga0070686_100088962
674 Ga0070686_100109902
675 Ga0070686_100274812
676 Ga0070695_100009559
677 Ga0070695_100204588
678 Ga0070696_100071960
679 Ga0070696_100099064
680 Ga0070696_100144466
681 Ga0070696_100324304
682 Ga0070696_101147668
683 Ga0070665_100291357
684 Ga0070665_101611909
685 Ga0070704_100025894
686 Ga0070704_100217307
687 Ga0070704_100259096
688 Ga0070704_101001376
689 Ga0068855_100162231
690 Ga0070664_100739389
691 Ga0068857_100517378
692 Ga0068854_100015220
693 Ga0068854_100130989
694 Ga0070702_100042812
695 Ga0068852_100047648
696 Ga0068859_100044655
697 Ga0068859_100126341
698 Ga0068859_100340411
699 Ga0068859_100579429
700 Ga0068859_101369719
701 Ga0068864_100374748
702 Ga0068866_10119025
703 Ga0068861_100025655
704 Ga0068861_100036391
705 Ga0068861_100231734
706 Ga0068861_100497873
707 Ga0068861_102248421
708 Ga0068870_10012426
709 Ga0068870_11364655
710 Ga0068870_11418676
711 Ga0068863_100093615
712 Ga0068863_102528274
713 Ga0068858_100019582
714 Ga0068860_100048147
715 Ga0068860_100090378
716 Ga0068860_100246339
717 Ga0068860_100604379
718 Ga0068862_100017112
719 Ga0068862_100066164
720 Ga0068862_100270715
721 Ga0068862_100413242
722 Ga0081455_10308298
723 Ga0070717_10081060
724 Ga0075365_10067025
725 Ga0075363_100025427
726 Ga0075364_10117258
727 Ga0075362_10143185
728 Ga0075367_10002010
729 Ga0075366_10000407
730 Ga0097621_100376988
731 Ga0075428_100981717
732 Ga0075430_100062349
733 Ga0075431_100006910
734 Ga0075433_10072851
735 Ga0075433_10269583
736 Ga0075433_10280994
737 Ga0075434_100045467
738 Ga0075434_100084365
739 Ga0075434_100209143
740 Ga0075434_101285119
741 Ga0075429_100006106
742 Ga0075429_100070734
743 Ga0068865_100019076
744 Ga0075436_100009243
745 Ga0075436_100309666
746 Ga0075436_100666138
747 Ga0075436_100713824
748 Ga0075436_100799918
749 Ga0097620_100044656
750 Ga0097620_100126334
751 Ga0097620_100340423
752 Ga0097620_100579365
753 Ga0097620_101369821
754 Ga0075435_100010233
755 Ga0075435_100823865
756 Ga0075435_101013884
757 Ga0105240_10056782
758 Ga0105240_10300297
759 Ga0105240_10669611
760 Ga0105240_11540660
761 Ga0111539_10000117
762 Ga0111539_10002983
763 Ga0111539_10008457
764 Ga0111539_10194175
765 Ga0111539_12188982
766 Ga0105245_10050546
767 Ga0105245_10708066
768 Ga0105245_12665230
769 Ga0105247_10118441
770 Ga0105247_10708375
771 Ga0114129_10015411
772 Ga0114129_10027608
773 Ga0114129_10096391
774 Ga0114129_10134224
775 Ga0114129_10266929
776 Ga0114129_10321362
777 Ga0114129_10634988
778 Ga0105243_10006709
779 Ga0105243_10749653
780 Ga0105243_10947546
781 Ga0105242_10035399
782 Ga0105248_10422062
783 Ga0105248_10578836
784 Ga0105237_10026760
785 Ga0105238_10067536
786 Ga0105238_11079777
787 Ga0105238_11351075
788 Ga0105249_10065424
789 Ga0105249_10068708
790 Ga0105249_12188602
791 Ga0105246_10210700
792 Ga0105246_10653686
793 Ga0105246_10984137
794 Ga0157340_1006025
795 Ga0157324_1047761
796 Ga0157327_1010739
797 Ga0157326_1020107
798 Ga0157373_11169435
799 Ga0157371_10024148
800 Ga0157371_11257936
801 Ga0157370_10175730
802 Ga0157370_11880277
803 Ga0157369_10004652
804 Ga0157369_10079794
805 Ga0157369_10223412
806 Ga0157369_11147720
807 Ga0157369_11549652
808 Ga0157374_10261820
809 Ga0157374_12904246
810 Ga0157378_10350122
811 Ga0157378_10404956
812 Ga0163162_10219627
813 Ga0157372_10007892
814 Ga0157372_10026051
815 Ga0157372_10090243
816 Ga0157372_12042431
817 Ga0157375_10153401
818 Ga0157375_10285818
819 Ga0157375_13762834
820 Ga0163163_11200487
821 Ga0157380_10027350
822 Ga0157380_10406741
823 Ga0182008_10009210
824 Ga0157377_10413669
825 Ga0157377_10841321
826 Ga0157379_10192552
827 Ga0157376_10679187
828 Ga0163161_11233737
829 Ga0207697_10161063
830 Ga0207653_10234158
831 Ga0207642_10365971
832 Ga0207710_10253440
833 Ga0207688_10311821
834 Ga0207680_10486882
835 Ga0207647_10123731
836 Ga0207645_10149661
837 Ga0207643_10045503
838 Ga0207643_10276603
839 Ga0207705_10018216
840 Ga0207705_10117373
841 Ga0207705_10835808
842 Ga0207684_10000013
843 Ga0207684_10001354
844 Ga0207684_10075818
845 Ga0207684_10418947
846 Ga0207684_10682758
847 Ga0207707_10037677
848 Ga0207707_10907691
849 Ga0207695_10004255
850 Ga0207695_10318378
851 Ga0207671_10176488
852 Ga0207662_10002497
853 Ga0207662_10258051
854 Ga0207657_10002949
855 Ga0207657_10482112
856 Ga0207649_10097035
857 Ga0207646_10001318
858 Ga0207646_10009206
859 Ga0207646_10022036
860 Ga0207646_10319850
861 Ga0207646_10324200
862 Ga0207681_10478323
863 Ga0207694_10291839
864 Ga0207694_10895066
865 Ga0207650_10552408
866 Ga0207659_10183822
867 Ga0207659_10313442
868 Ga0207687_10067559
869 Ga0207687_11269297
870 Ga0207700_10254349
871 Ga0207664_10005221
872 Ga0207644_10401464
873 Ga0207706_10265144
874 Ga0207706_10878281
875 Ga0207686_10097975
876 Ga0207686_10477599
877 Ga0207709_10372759
878 Ga0207709_10689642
879 Ga0207670_10816736
880 Ga0207669_10011528
881 Ga0207704_10799912
882 Ga0207691_10051978
883 Ga0207711_10071427
884 Ga0207689_10018588
885 Ga0207689_10282904
886 Ga0207689_10375988
887 Ga0207689_11749475
888 Ga0207661_10077728
889 Ga0207661_10120247
890 Ga0207679_10650886
891 Ga0207667_10002805
892 Ga0207667_10084758
893 Ga0207667_10189066
894 Ga0207667_10224326
895 Ga0207667_11180468
896 Ga0207651_10553786
897 Ga0207712_10075541
898 Ga0207712_11791379
899 Ga0207668_10234021
900 Ga0207668_11995944
901 Ga0207658_11098462
902 Ga0207677_10049827
903 Ga0207677_10439599
904 Ga0207703_10287134
905 Ga0207639_11932168
906 Ga0207678_10000490
907 Ga0207678_10309482
908 Ga0207708_10070881
909 Ga0207708_12042290
910 Ga0207702_10055468
911 Ga0207702_11971779
912 Ga0207641_11326826
913 Ga0207641_11777505
914 Ga0207648_10004013
915 Ga0207674_10302251
916 Ga0207674_11179092
917 Ga0207675_100011412
918 Ga0207675_100147520
919 Ga0207675_102379366
920 Ga0207683_10030385
921 Ga0207683_10301055
922 Ga0207683_10897212
923 Ga0207698_10513589
924 Ga0209813_10039502
925 Ga0207428_10000122
926 Ga0207428_10024422
927 Ga0268266_10755529
928 Ga0268266_11400622
929 Ga0268265_10107784
930 Ga0268265_11409108
931 Ga0268264_10097963
932 Ga0268264_10454490
933 Ga0268264_10597458
934 Ga0307517_10052193
935 Ga0316182_1059196
936 Ga0307509_10239191
937 Ga0307408_100510112
938 Ga0316576_10357518
939 Ga0307405_10229647
940 Ga0307405_10617487
941 Ga0307413_10125969
942 Ga0307413_11258589
943 Ga0307410_10026520
944 Ga0307406_11018990
945 Ga0307407_10016192
946 Ga0307407_10329542
947 Ga0307412_10021688
948 Ga0307412_10083022
949 Ga0307409_100061928
950 Ga0307409_100193458
951 Ga0307409_100267359
952 Ga0307409_100889352
953 Ga0307416_100070864
954 Ga0307416_101481137
955 Ga0307414_10286236
956 Ga0307411_10167747
957 Ga0307411_11663675
958 Ga0307415_100048861
959 Ga0307415_100065390
960 Ga0373958_0094450
961 Ga0373936_0000043
962 Ga0373943_0784557
963 Ga0316574_0429108
964 Ga0316574_0759472
965 Ga0373931_0015839
966 Ga0373931_0357357
967 Ga0373947_0104703
968 Ga0373937_1224479
969 Ga0316584_0285905
970 Ga0395899_0428473
971 Ga0395900_1274615
972 Ga0395905_0009602
973 Ga0436364_0169726
974 Ga0395901_0491244
975 Ga0395901_0596901
976 Ga0436365_0299300
977 Ga0436365_1023238
978 Ga0439439_0016227
979 Ga0451800_1555646
980 Ga0439446_0341931
981 Ga0466963_0498864
982 Ga0466963_0550629
983 Ga0453684_0218339
984 Ga0466967_1711028
985 Ga0495629_0059806
986 Ga0495580_0318154
987 Ga0495583_0263129
988 Ga0495630_0540465
989 Ga0495652_0359055
990 Ga0495652_0710234
991 Ga0495598_0466300
992 Ga0495645_0000061
993 Ga0495633_0524039
994 Ga0495656_0384465
995 Ga0495625_0198226
996 Ga0495588_0013090
997 Ga0495599_0747589
998 Ga0495658_0097194
999 Ga0495600_0004987
1000 Ga0495600_0292493
1001 Ga0495675_0794845
1002 Ga0496100_0754015
1003 Ga0496101_0575244
1004 Ga0496101_0767353
1005 Ga0496102_0607746
1006 Ga0496104_0199717
1007 Ga0496104_0870023
1008 Ga0496105_0142340
1009 Ga0496106_0352627
1010 Ga0496108_0123261
1011 Ga0496108_0486908
1012 Ga0496109_0146401
1013 Ga0496110_0104227
1014 Ga0496110_0774932
1015 Ga0496111_0224343
1016 Ga0496111_0872283
1017 Ga0496112_0000517
1018 Ga0496113_0070489
1019 Ga0496113_0289458
1020 Ga0501292_030719
1021 Ga0501032_0011883
1022 Ga0501033_0180449
1023 Ga0501033_0994094
1024 Ga0501034_0007715
1025 Ga0501034_0091417
1026 Ga0501036_0069769
1027 Ga0501038_0553496
1028 Ga0501038_0833666
1029 Ga0501038_1178438
1030 Ga0501041_0009853
1031 Ga0501043_0009045
1032 Ga0501046_0017581
1033 Ga0501047_0306943
1034 Ga0501047_0890111
1035 Ga0501047_0910821
1036 Ga0501048_0032405
1037 Ga0501067_0014155
1038 Ga0501067_0161728
1039 Ga0501068_0069292
1040 Ga0501069_0029957
1041 Ga0501069_0762390
1042 Ga0501070_0022780
1043 Ga0501070_0023584
1044 Ga0501070_0151482
1045 Ga0501070_0645656
1046 Ga0501071_0421923
1047 Ga0501072_0010373
1048 Ga0501072_0023633
1049 Ga0501072_0128081
1050 Ga0501072_0380950
1051 Ga0501073_0020119
1052 Ga0501073_0022513
1053 Ga0501073_0028115
1054 Ga0501074_0010448
1055 Ga0501074_0057924
1056 Ga0501075_0446561
1057 Ga0501076_0272163
1058 Ga0501076_0304276
1059 Ga0501217_044677
1060 Ga0501221_039615
1061 Ga0501079_0010628
1062 Ga0501079_0881013
1063 Ga0501080_0002078
1064 Ga0501080_0065754
1065 Ga0501080_1363985
1066 Ga0501081_0096073
1067 Ga0501081_0111491
1068 Ga0501081_0377539
1069 Ga0501083_0007689
1070 Ga0501083_0019905
1071 Ga0501035_0180193
1072 Ga0501044_0615355
1073 Ga0501045_0040451
1074 Ga0501045_0068300
1075 nmdc:mga03683_12474_c1
1076 nmdc:mga03n38_5847_c1
1077 nmdc:mga00v17_20716_c1
1078 nmdc:mga0yw44_545008_c1
1079 nmdc:mga0k408_1762_c1
1080 nmdc:mga06z11_79398_c1
1081 nmdc:mga05p37_109242_c1
1082 nmdc:mga05p37_275390_c1
1083 nmdc:mga05p37_353284_c1
1084 nmdc:mga05p37_61249_c1
1085 nmdc:mga05p37_741033_c1
1086 nmdc:mga05p37_85233_c1
1087 nmdc:mga09592_392228_c1
1088 nmdc:mga09592_87564_c1
1089 nmdc:mga06r32_337684_c1
1090 nmdc:mga06r32_360626_c1
1091 nmdc:mga06r32_611711_c1
1092 nmdc:mga06r32_9724_c1
1093 nmdc:mga08y16_1200392_c1
1094 nmdc:mga08y16_23627_c1
1095 nmdc:mga08y16_49380_c1
1096 nmdc:mga08y16_9948_c1
1097 nmdc:mga0n895_223968_c1
1098 nmdc:mga0n895_247497_c1
1099 nmdc:mga0n895_798614_c1
1100 nmdc:mga0n895_985067_c1
1101 nmdc:mga0rr50_1205561_c1
1102 nmdc:mga0rr50_28515_c1
1103 nmdc:mga0rr50_686060_c1
1104 nmdc:mga08x19_153563_c1
1105 nmdc:mga08x19_45672_c1
1106 nmdc:mga0a205_112339_c1
1107 nmdc:mga0a205_25300_c1
1108 nmdc:mga0a205_335324_c1
1109 nmdc:mga0a205_891610_c1
1110 nmdc:mga0a205_95957_c1
1111 nmdc:mga0sz30_182089_c1
1112 Ga0500646_0004469
1113 Ga0500583_0187018
1114 Ga0500654_119764
1115 Ga0500562_045159
1116 Ga0500636_0056292
1117 Ga0501084_0018159
1118 Ga0501084_0511293
1119 Ga0501082_0195071
1120 Ga0501082_0273692
1121 Ga0501082_0449457
1122 Ga0501082_1862026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

59

126

0.9

PF00190

Cupin_1

Cupin

40

126

0.87

PF07883

Cupin_2

Cupin domain

53

124

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e2g-assembly3.cif.gz_E crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.7622 5 82
6x1t-assembly6.cif.gz_K structure of phis fab (sc50-3) in complex with phis mimetic peptide 0.683 22 44
6x1w-assembly1.cif.gz_L structure of phis fab (sc56-2) in complex with phis mimetic peptide 0.6829 22 44
8ffe-assembly1.cif.gz_L crystal structure of lrp6 e1e2 domains bound to yw210.09 fab and engineered xwnt8 peptide 0.6808 22 44
5m63-assembly1.cif.gz_L crystal structure of group b streptococcus type iii dp2 oligosaccharide bound to fab nvs-1-19-5 0.6732 22 44
ID Description Score Start End Superfamily
af_Q8MVR1_2351_2454_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.676 15 42 2.30.29.30
af_A0A1D8PP94_226_334_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6574 14 38 2.30.29.30
af_Q3EBC8_1322_1388_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6357 14 42 3.30.160.20
af_Q54RW2_8_111_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.634 16 84 2.60.120.10
af_X1WBD6_151_272_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6246 22 43 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3D2B0R7-F1-model_v4 Cupin domain-containing protein 0.8459 8 79
AF-A0A3D2B0R7-F1-model_v4 Cupin domain-containing protein 0.8356 8 79
AF-A0A2V7A8D6-F1-model_v4 Cupin domain-containing protein 0.8348 6 64
AF-A0A3D1AZI7-F1-model_v4 Cupin domain-containing protein 0.8345 6 70
AF-A0A2V9UGT9-F1-model_v4 Cupin 0.8207 1 60

Map