F463544

General Info

Members Datasets Scaffolds Average Seq Length
559 261 539 338

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100006566|Ga0070686_1000065664
Length 360
Sequence MIKLGVIGYGYWGPNLVRNFMEAPGSTVVAVCDLRGERLLPLAARYPTVKTVSNCSELFADPSIDAIVIATPVSSHFELGMAALRADKHVLIEKPLAANSEQAIQLIEEAARRKRVLMVDHTFVYTSAVRKIRELITQNALGDIYYYDAVRVNLGLFQHDVNVIWDLAIHDLSIMDYVLPNKATAVSATGISHIPGQPENVAYITLFFANPQIAHVHVNWLTPVKVRHTLIGGSEKMILYDDLEPSEKVKIYDKGVTVSQSPEAVYEMLVSYRSGDMWAPRLDTTEALQTEAQHFIDCIENNKRPETDGQAGLRLVRIVEAAEKSLRARGQLVEIDTTNDVTNDAENLEAGEVVGQGTAN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
3 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
4 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
5 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
6 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
7 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
8 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
9 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
10 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
11 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
12 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
13 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
14 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
15 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
16 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
17 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
18 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
19 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
20 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
21 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
22 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
201 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
202 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
225 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
229 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
230 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
231 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
232 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
233 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
234 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
235 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
236 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
237 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
238 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
239 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
242 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
243 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
244 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
245 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
246 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
247 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
252 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
253 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
254 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.42
Metatranscriptomes 0
Isolates 3.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.68
Rhizoplane 1.25
Rhizosphere 95.17
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_718651 2162886007 Bacteria 4916
2 CNAas_1000209 3300000532 Bacteria 5477
3 JGI25406J46586_10001946 3300003203 Bacteria 9757
4 Ga0065714_10064435 3300005288 Bacteria 121919
5 Ga0065712_10000118 3300005290 Bacteria 121959
6 Ga0065712_10008558 3300005290 Bacteria 4127
7 Ga0065712_10032530 3300005290 Bacteria 1596
8 Ga0065712_10093328 3300005290 Bacteria 2297
9 Ga0065712_10158548 3300005290 Bacteria 1312
10 Ga0065715_10088964 3300005293 Bacteria 19499
11 Ga0065715_10101973 3300005293 Unclassified 3155
12 Ga0065715_10127862 3300005293 Bacteria 2059
13 Ga0065715_10165528 3300005293 Bacteria 1590
14 Ga0065715_10196918 3300005293 Unclassified 1382
15 Ga0065715_10220571 3300005293 Unclassified 1274
16 Ga0065715_10228886 3300005293 Bacteria 1241
17 Ga0065707_10001141 3300005295 Bacteria 15623
18 Ga0070676_10005932 3300005328 Bacteria 6519
19 Ga0070676_10175325 3300005328 Bacteria 1390
20 Ga0070690_100008623 3300005330 Bacteria 5879
21 Ga0070690_100025132 3300005330 Bacteria 3666
22 Ga0070690_100033026 3300005330 Bacteria 3236
23 Ga0070670_100000652 3300005331 Bacteria 26936
24 Ga0070670_100008998 3300005331 Bacteria 8531
25 Ga0070670_100036736 3300005331 Bacteria 4215
26 Ga0070670_100184273 3300005331 Bacteria 1812
27 Ga0068869_100041635 3300005334 Bacteria 3290
28 Ga0068869_100043513 3300005334 Bacteria 3226
29 Ga0068869_100081492 3300005334 Bacteria 2417
30 Ga0068869_100129648 3300005334 Unclassified 1937
31 Ga0068869_100132471 3300005334 Unclassified 1918
32 Ga0068869_100176418 3300005334 Bacteria 1673
33 Ga0070666_10026071 3300005335 Bacteria 3815
34 Ga0070666_10112222 3300005335 Bacteria 1886
35 Ga0070682_100000466 3300005337 Bacteria 25458
36 Ga0068868_100017601 3300005338 Bacteria 5329
37 Ga0070689_100013033 3300005340 Bacteria 6006
38 Ga0070689_100026282 3300005340 Bacteria 4382
39 Ga0070689_100113575 3300005340 Unclassified 2157
40 Ga0070689_100295782 3300005340 Bacteria 1346
41 Ga0070687_100002270 3300005343 Bacteria 7138
42 Ga0070692_10050208 3300005345 Bacteria 2166
43 Ga0070669_100000696 3300005353 Bacteria 24611
44 Ga0070669_100082533 3300005353 Bacteria 2396
45 Ga0070669_100096931 3300005353 Bacteria 2219
46 Ga0070669_100119330 3300005353 Bacteria 2010
47 Ga0070669_100298436 3300005353 Bacteria 1295
48 Ga0070669_100317316 3300005353 Bacteria 1258
49 Ga0070675_100105508 3300005354 Bacteria 2378
50 Ga0070671_100007476 3300005355 Bacteria 8733
51 Ga0070671_100082054 3300005355 Bacteria 2696
52 Ga0070671_100103083 3300005355 Bacteria 2394
53 Ga0070674_100092049 3300005356 Bacteria 2191
54 Ga0070673_100057540 3300005364 Bacteria 3071
55 Ga0070673_100092419 3300005364 Bacteria 2475
56 Ga0070688_100080977 3300005365 Unclassified 2101
57 Ga0070688_100084390 3300005365 Bacteria 2063
58 Ga0070659_100197924 3300005366 Bacteria 1653
59 Ga0070667_100022389 3300005367 Bacteria 5241
60 Ga0070703_10000151 3300005406 Bacteria 35770
61 Ga0070703_10063059 3300005406 Bacteria 1218
62 Ga0070701_10007587 3300005438 Bacteria 4645
63 Ga0070705_100056809 3300005440 Bacteria 2306
64 Ga0070700_100000288 3300005441 Bacteria 26468
65 Ga0070700_100026287 3300005441 Bacteria 3436
66 Ga0070700_100034411 3300005441 Bacteria 3060
67 Ga0070694_100012265 3300005444 Bacteria 5325
68 Ga0070694_100035775 3300005444 Unclassified 3285
69 Ga0070694_100100117 3300005444 Bacteria 2049
70 Ga0070694_100141829 3300005444 Bacteria 1746
71 Ga0070694_100180496 3300005444 Bacteria 1561
72 Ga0070708_100000103 3300005445 Bacteria 56127
73 Ga0070678_100101727 3300005456 Bacteria 2228
74 Ga0070678_100282994 3300005456 Bacteria 1403
75 Ga0070662_100020826 3300005457 Bacteria 4472
76 Ga0070681_10000748 3300005458 Bacteria 26981
77 Ga0070681_10003967 3300005458 Bacteria 13954
78 Ga0068867_100066239 3300005459 Unclassified 2690
79 Ga0070706_100000335 3300005467 Bacteria 57018
80 Ga0070706_100001771 3300005467 Bacteria 22361
81 Ga0070706_100006280 3300005467 Bacteria 11241
82 Ga0070706_100022335 3300005467 Bacteria 5826
83 Ga0070706_100038957 3300005467 Bacteria 4387
84 Ga0070707_100042380 3300005468 Unclassified 4358
85 Ga0070707_100246335 3300005468 Bacteria 1739
86 Ga0070698_100004774 3300005471 Bacteria 14873
87 Ga0070698_100009831 3300005471 Bacteria 10224
88 Ga0070698_100072834 3300005471 Bacteria 3442
89 Ga0070698_100294486 3300005471 Bacteria 1554
90 Ga0070699_100001144 3300005518 Bacteria 24667
91 Ga0070699_100022320 3300005518 Bacteria 5454
92 Ga0070699_100060031 3300005518 Unclassified 3294
93 Ga0070699_100079507 3300005518 Bacteria 2856
94 Ga0070699_100132192 3300005518 Bacteria 2200
95 Ga0070697_100000068 3300005536 Bacteria 83020
96 Ga0070697_100000131 3300005536 Bacteria 60013
97 Ga0070697_100009524 3300005536 Bacteria 7591
98 Ga0070697_100115871 3300005536 Bacteria 2238
99 Ga0070697_100297036 3300005536 Bacteria 1388
100 Ga0068853_100044934 3300005539 Bacteria 3782
101 Ga0070672_100113071 3300005543 Bacteria 2215
102 Ga0070686_100006566 3300005544 Bacteria 6475
103 Ga0070686_100019143 3300005544 Bacteria 4029
104 Ga0070686_100020936 3300005544 Bacteria 3879
105 Ga0070686_100062399 3300005544 Bacteria 2411
106 Ga0070695_100034242 3300005545 Bacteria 3182
107 Ga0070695_100147642 3300005545 Unclassified 1638
108 Ga0070695_100159713 3300005545 Bacteria 1581
109 Ga0070696_100013737 3300005546 Bacteria 5437
110 Ga0070696_100078923 3300005546 Bacteria 2328
111 Ga0070696_100138199 3300005546 Bacteria 1778
112 Ga0070693_100020441 3300005547 Bacteria 3491
113 Ga0070693_100024438 3300005547 Bacteria 3241
114 Ga0070704_100016051 3300005549 Bacteria 4722
115 Ga0070704_100020898 3300005549 Unclassified 4233
116 Ga0070704_100028229 3300005549 Bacteria 3731
117 Ga0070704_100038978 3300005549 Bacteria 3259
118 Ga0070704_100069830 3300005549 Bacteria 2547
119 Ga0070704_100071258 3300005549 Unclassified 2525
120 Ga0070704_100080357 3300005549 Bacteria 2398
121 Ga0068855_100540034 3300005563 Bacteria 1263
122 Ga0068857_100098268 3300005577 Bacteria 2625
123 Ga0068857_100121620 3300005577 Bacteria 2351
124 Ga0068857_100334230 3300005577 Bacteria 1401
125 Ga0068854_100092787 3300005578 Bacteria 2249
126 Ga0068854_100222529 3300005578 Bacteria 1494
127 Ga0068854_100332648 3300005578 Bacteria 1238
128 Ga0070702_100004349 3300005615 Bacteria 6461
129 Ga0070702_100015516 3300005615 Bacteria 3890
130 Ga0070702_100034473 3300005615 Bacteria 2790
131 Ga0070702_100035569 3300005615 Unclassified 2752
132 Ga0070702_100091384 3300005615 Bacteria 1847
133 Ga0070702_100168454 3300005615 Bacteria 1422
134 Ga0068852_100014227 3300005616 Bacteria 6114
135 Ga0068852_100035960 3300005616 Unclassified 4139
136 Ga0068852_100101511 3300005616 Bacteria 2598
137 Ga0068859_100006149 3300005617 Bacteria 12204
138 Ga0068859_100006397 3300005617 Bacteria 11951
139 Ga0068859_100012779 3300005617 Bacteria 8436
140 Ga0068859_100026312 3300005617 Bacteria 5832
141 Ga0068859_100047298 3300005617 Bacteria 4322
142 Ga0068859_100110138 3300005617 Bacteria 2815
143 Ga0068859_100141408 3300005617 Bacteria 2480
144 Ga0068859_100153145 3300005617 Unclassified 2381
145 Ga0068859_100597553 3300005617 Bacteria 1197
146 Ga0068864_100039321 3300005618 Unclassified 4043
147 Ga0068864_100052756 3300005618 Bacteria 3506
148 Ga0068864_100077573 3300005618 Unclassified 2906
149 Ga0068864_100086203 3300005618 Unclassified 2762
150 Ga0068864_100087717 3300005618 Bacteria 2740
151 Ga0068864_100127563 3300005618 Bacteria 2281
152 Ga0068864_100187204 3300005618 Bacteria 1896
153 Ga0068861_100006484 3300005719 Bacteria 7975
154 Ga0068861_100048931 3300005719 Bacteria 3198
155 Ga0068861_100066591 3300005719 Bacteria 2777
156 Ga0068851_10002980 3300005834 Bacteria 7479
157 Ga0068851_10029607 3300005834 Bacteria 2711
158 Ga0068870_10018668 3300005840 Bacteria 3352
159 Ga0068870_10085017 3300005840 Bacteria 1757
160 Ga0068863_100010661 3300005841 Bacteria 8921
161 Ga0068858_100085724 3300005842 Unclassified 2931
162 Ga0068858_100125879 3300005842 Unclassified 2399
163 Ga0068858_100281843 3300005842 Bacteria 1583
164 Ga0068858_100328112 3300005842 Bacteria 1463
165 Ga0068860_100016043 3300005843 Bacteria 7306
166 Ga0068860_100018121 3300005843 Bacteria 6855
167 Ga0068860_100043769 3300005843 Bacteria 4269
168 Ga0068860_100049091 3300005843 Unclassified 4022
169 Ga0068860_100127786 3300005843 Bacteria 2437
170 Ga0068860_100510174 3300005843 Bacteria 1201
171 Ga0068862_100037936 3300005844 Bacteria 4085
172 Ga0068862_100166858 3300005844 Bacteria 1968
173 Ga0068862_100297485 3300005844 Bacteria 1484
174 Ga0081539_10000067 3300005985 Bacteria 246361
175 Ga0097621_100003849 3300006237 Bacteria 10396
176 Ga0097621_100014258 3300006237 Bacteria 5944
177 Ga0097621_100047731 3300006237 Bacteria 3470
178 Ga0097621_100075354 3300006237 Bacteria 2796
179 Ga0097621_100184793 3300006237 Bacteria 1803
180 Ga0068871_100000984 3300006358 Bacteria 19083
181 Ga0068871_100001972 3300006358 Bacteria 13912
182 Ga0068871_100008641 3300006358 Bacteria 7326
183 Ga0068871_100020604 3300006358 Bacteria 5054
184 Ga0075430_100118734 3300006846 Bacteria 2204
185 Ga0075433_10079830 3300006852 Bacteria 2883
186 Ga0075433_10121813 3300006852 Bacteria 2316
187 Ga0075434_100180739 3300006871 Unclassified 2129
188 Ga0075434_100216304 3300006871 Bacteria 1936
189 Ga0075434_100424488 3300006871 Bacteria 1351
190 Ga0075429_100030198 3300006880 Unclassified 4708
191 Ga0075429_100099194 3300006880 Bacteria 2541
192 Ga0068865_100232346 3300006881 Bacteria 1447
193 Ga0068865_100377948 3300006881 Bacteria 1155
194 Ga0097620_100006149 3300006931 Bacteria 12204
195 Ga0097620_100006396 3300006931 Bacteria 11951
196 Ga0097620_100012779 3300006931 Bacteria 8436
197 Ga0097620_100026317 3300006931 Bacteria 5832
198 Ga0097620_100047295 3300006931 Bacteria 4322
199 Ga0097620_100110138 3300006931 Bacteria 2815
200 Ga0097620_100141408 3300006931 Bacteria 2480
201 Ga0097620_100153144 3300006931 Unclassified 2381
202 Ga0097620_100597584 3300006931 Bacteria 1197
203 Ga0075435_100001072 3300007076 Bacteria 17395
204 Ga0075435_100007063 3300007076 Bacteria 7972
205 Ga0075435_100011375 3300007076 Bacteria 6542
206 Ga0075435_100089577 3300007076 Bacteria 2537
207 Ga0105251_10079454 3300009011 Bacteria 1518
208 Ga0105240_10195922 3300009093 Bacteria 2372
209 Ga0111539_10009124 3300009094 Bacteria 12549
210 Ga0111539_10122852 3300009094 Bacteria 3043
211 Ga0111539_10131114 3300009094 Unclassified 2935
212 Ga0105245_10013998 3300009098 Bacteria 6987
213 Ga0105245_10037618 3300009098 Bacteria 4303
214 Ga0105247_10080913 3300009101 Bacteria 2047
215 Ga0114129_10017378 3300009147 Bacteria 10243
216 Ga0114129_10130744 3300009147 Bacteria 3448
217 Ga0114129_10329152 3300009147 Bacteria 2029
218 Ga0114129_10531371 3300009147 Bacteria 1532
219 Ga0105243_10003704 3300009148 Bacteria 12282
220 Ga0105243_10066766 3300009148 Bacteria 2894
221 Ga0105243_10398075 3300009148 Bacteria 1278
222 Ga0105241_10011900 3300009174 Bacteria 6393
223 Ga0105241_10089091 3300009174 Bacteria 2431
224 Ga0105241_10169131 3300009174 Bacteria 1804
225 Ga0105242_10046939 3300009176 Bacteria 3506
226 Ga0105242_10194930 3300009176 Bacteria 1796
227 Ga0105242_10257006 3300009176 Bacteria 1576
228 Ga0105248_10006695 3300009177 Bacteria 12641
229 Ga0105248_10023570 3300009177 Bacteria 6838
230 Ga0105248_10027387 3300009177 Bacteria 6344
231 Ga0105248_10032285 3300009177 Bacteria 5853
232 Ga0105248_10073396 3300009177 Bacteria 3845
233 Ga0105248_10473745 3300009177 Bacteria 1411
234 Ga0105248_10599504 3300009177 Bacteria 1243
235 Ga0105237_10000264 3300009545 Bacteria 73957
236 Ga0105237_10037530 3300009545 Bacteria 4896
237 Ga0105238_10003921 3300009551 Bacteria 14766
238 Ga0105238_10062732 3300009551 Bacteria 3717
239 Ga0105249_10003798 3300009553 Bacteria 13039
240 Ga0105239_10075690 3300010375 Bacteria 3702
241 Ga0105239_10196146 3300010375 Unclassified 2261
242 Ga0105246_10094144 3300011119 Bacteria 2166
243 Ga0105246_10109304 3300011119 Bacteria 2028
244 Ga0157373_10001007 3300013100 Bacteria 21766
245 Ga0157373_10008818 3300013100 Bacteria 7471
246 Ga0157373_10018728 3300013100 Bacteria 5039
247 Ga0157371_10000364 3300013102 Bacteria 57324
248 Ga0157369_10126548 3300013105 Bacteria 2708
249 Ga0157374_10025614 3300013296 Bacteria 5299
250 Ga0157374_10307211 3300013296 Bacteria 1570
251 Ga0157378_10012115 3300013297 Bacteria 7551
252 Ga0157378_10091682 3300013297 Bacteria 2763
253 Ga0157378_10096465 3300013297 Bacteria 2695
254 Ga0157378_10155490 3300013297 Bacteria 2134
255 Ga0157378_10372680 3300013297 Bacteria 1400
256 Ga0163162_10006021 3300013306 Bacteria 11738
257 Ga0163162_10033212 3300013306 Bacteria 5126
258 Ga0163162_10045961 3300013306 Bacteria 4376
259 Ga0163162_10155500 3300013306 Bacteria 2407
260 Ga0163162_10496637 3300013306 Unclassified 1351
261 Ga0157372_10015192 3300013307 Bacteria 8244
262 Ga0157372_10344598 3300013307 Bacteria 1736
263 Ga0157375_10035296 3300013308 Bacteria 4771
264 Ga0157375_10038665 3300013308 Unclassified 4582
265 Ga0163163_10000172 3300014325 Bacteria 67754
266 Ga0163163_10001985 3300014325 Bacteria 17299
267 Ga0163163_10007526 3300014325 Bacteria 9615
268 Ga0163163_10095084 3300014325 Unclassified 2999
269 Ga0163163_10290647 3300014325 Bacteria 1686
270 Ga0163163_10350478 3300014325 Bacteria 1532
271 Ga0163163_10432275 3300014325 Bacteria 1376
272 Ga0157380_10000129 3300014326 Bacteria 41853
273 Ga0157380_10260194 3300014326 Bacteria 1576
274 Ga0157380_10334235 3300014326 Unclassified 1410
275 Ga0157380_10336829 3300014326 Bacteria 1405
276 Ga0157379_10231362 3300014968 Bacteria 1675
277 Ga0157376_10004860 3300014969 Bacteria 9364
278 Ga0157376_10262903 3300014969 Bacteria 1618
279 Ga0182007_10079768 3300015262 Bacteria 1074
280 Ga0163161_10023393 3300017792 Bacteria 4358
281 Ga0207656_10002099 3300025321 Bacteria 6659
282 Ga0207653_10000012 3300025885 Bacteria 159557
283 Ga0207653_10003285 3300025885 Bacteria 5097
284 Ga0207642_10017790 3300025899 Bacteria 2712
285 Ga0207710_10001374 3300025900 Bacteria 12194
286 Ga0207688_10010792 3300025901 Bacteria 4972
287 Ga0207647_10023428 3300025904 Bacteria 4082
288 Ga0207647_10023892 3300025904 Bacteria 4037
289 Ga0207645_10010842 3300025907 Bacteria 6244
290 Ga0207643_10062282 3300025908 Bacteria 2132
291 Ga0207643_10135363 3300025908 Bacteria 1468
292 Ga0207684_10000023 3300025910 Bacteria 334838
293 Ga0207684_10000209 3300025910 Bacteria 90695
294 Ga0207684_10021320 3300025910 Bacteria 5532
295 Ga0207684_10062793 3300025910 Bacteria 3154
296 Ga0207654_10041954 3300025911 Bacteria 2587
297 Ga0207707_10012719 3300025912 Bacteria 7316
298 Ga0207707_10059592 3300025912 Unclassified 3321
299 Ga0207707_10085206 3300025912 Bacteria 2761
300 Ga0207695_10285042 3300025913 Bacteria 1545
301 Ga0207671_10080619 3300025914 Bacteria 2440
302 Ga0207662_10002228 3300025918 Bacteria 9672
303 Ga0207662_10009761 3300025918 Bacteria 5294
304 Ga0207662_10028914 3300025918 Bacteria 3208
305 Ga0207657_10070926 3300025919 Unclassified 2951
306 Ga0207657_10137303 3300025919 Bacteria 2000
307 Ga0207646_10106955 3300025922 Bacteria 2509
308 Ga0207646_10188442 3300025922 Bacteria 1863
309 Ga0207681_10000618 3300025923 Bacteria 23786
310 Ga0207681_10007295 3300025923 Bacteria 6775
311 Ga0207694_10047833 3300025924 Bacteria 3308
312 Ga0207650_10000001 3300025925 Bacteria 1545726
313 Ga0207650_10003417 3300025925 Bacteria 10926
314 Ga0207650_10285874 3300025925 Bacteria 1344
315 Ga0207659_10182808 3300025926 Bacteria 1662
316 Ga0207644_10007882 3300025931 Bacteria 6961
317 Ga0207690_10044714 3300025932 Bacteria 2921
318 Ga0207690_10261573 3300025932 Bacteria 1341
319 Ga0207706_10036353 3300025933 Bacteria 4374
320 Ga0207706_10039918 3300025933 Bacteria 4161
321 Ga0207706_10127036 3300025933 Bacteria 2242
322 Ga0207706_10242499 3300025933 Bacteria 1576
323 Ga0207709_10001346 3300025935 Bacteria 17288
324 Ga0207709_10064556 3300025935 Bacteria 2299
325 Ga0207709_10098520 3300025935 Bacteria 1928
326 Ga0207670_10001338 3300025936 Bacteria 13019
327 Ga0207670_10010248 3300025936 Bacteria 5391
328 Ga0207670_10115840 3300025936 Bacteria 1939
329 Ga0207704_10102490 3300025938 Bacteria 1912
330 Ga0207704_10233391 3300025938 Bacteria 1370
331 Ga0207665_10020219 3300025939 Bacteria 4374
332 Ga0207665_10225745 3300025939 Bacteria 1375
333 Ga0207691_10032309 3300025940 Bacteria 4880
334 Ga0207691_10048916 3300025940 Bacteria 3875
335 Ga0207691_10198813 3300025940 Bacteria 1745
336 Ga0207711_10010133 3300025941 Bacteria 7829
337 Ga0207711_10020346 3300025941 Bacteria 5532
338 Ga0207711_10140751 3300025941 Bacteria 2170
339 Ga0207711_10432969 3300025941 Bacteria 1224
340 Ga0207689_10006553 3300025942 Bacteria 10271
341 Ga0207689_10033466 3300025942 Bacteria 4271
342 Ga0207689_10047492 3300025942 Bacteria 3544
343 Ga0207689_10067641 3300025942 Bacteria 2936
344 Ga0207689_10131534 3300025942 Bacteria 2059
345 Ga0207689_10203920 3300025942 Unclassified 1633
346 Ga0207679_10032801 3300025945 Bacteria 3650
347 Ga0207679_10058475 3300025945 Bacteria 2857
348 Ga0207679_10236958 3300025945 Bacteria 1544
349 Ga0207667_10282805 3300025949 Bacteria 1695
350 Ga0207651_10010854 3300025960 Bacteria 5068
351 Ga0207651_10084427 3300025960 Bacteria 2300
352 Ga0207651_10173206 3300025960 Bacteria 1704
353 Ga0207712_10001351 3300025961 Bacteria 16796
354 Ga0207640_10010549 3300025981 Bacteria 5209
355 Ga0207640_10033986 3300025981 Bacteria 3178
356 Ga0207640_10154395 3300025981 Bacteria 1690
357 Ga0207640_10175908 3300025981 Bacteria 1600
358 Ga0207658_10211570 3300025986 Bacteria 1625
359 Ga0207677_10014697 3300026023 Unclassified 4581
360 Ga0207677_10198996 3300026023 Bacteria 1591
361 Ga0207677_10338520 3300026023 Bacteria 1256
362 Ga0207703_10005949 3300026035 Bacteria 9771
363 Ga0207703_10157989 3300026035 Bacteria 1983
364 Ga0207703_10192775 3300026035 Bacteria 1806
365 Ga0207703_10198008 3300026035 Bacteria 1784
366 Ga0207703_10295122 3300026035 Bacteria 1476
367 Ga0207678_10170215 3300026067 Bacteria 1860
368 Ga0207708_10000657 3300026075 Bacteria 26466
369 Ga0207708_10000925 3300026075 Bacteria 21982
370 Ga0207708_10005878 3300026075 Bacteria 9073
371 Ga0207708_10027391 3300026075 Bacteria 4315
372 Ga0207708_10033479 3300026075 Bacteria 3905
373 Ga0207708_10108933 3300026075 Bacteria 2149
374 Ga0207708_10137869 3300026075 Bacteria 1912
375 Ga0207702_10100237 3300026078 Bacteria 2555
376 Ga0207641_10019457 3300026088 Bacteria 5574
377 Ga0207641_10274094 3300026088 Bacteria 1584
378 Ga0207641_10351939 3300026088 Unclassified 1404
379 Ga0207648_10084193 3300026089 Unclassified 2773
380 Ga0207676_10007448 3300026095 Bacteria 7763
381 Ga0207676_10022645 3300026095 Unclassified 4621
382 Ga0207676_10072495 3300026095 Bacteria 2769
383 Ga0207676_10185323 3300026095 Bacteria 1826
384 Ga0207676_10204645 3300026095 Unclassified 1746
385 Ga0207674_10001442 3300026116 Bacteria 30693
386 Ga0207674_10022070 3300026116 Bacteria 6844
387 Ga0207674_10187888 3300026116 Bacteria 2016
388 Ga0207675_100012308 3300026118 Bacteria 7993
389 Ga0207675_100018559 3300026118 Bacteria 6489
390 Ga0207675_100052974 3300026118 Unclassified 3786
391 Ga0207675_100065683 3300026118 Bacteria 3391
392 Ga0207675_100077877 3300026118 Bacteria 3106
393 Ga0207675_100160227 3300026118 Bacteria 2146
394 Ga0207683_10151428 3300026121 Bacteria 2093
395 Ga0207698_10108026 3300026142 Bacteria 2324
396 Ga0207698_10333850 3300026142 Bacteria 1425
397 Ga0268265_10043185 3300028380 Bacteria 3349
398 Ga0268265_10509362 3300028380 Bacteria 1135
399 Ga0268264_10017493 3300028381 Bacteria 5870
400 Ga0268264_10025411 3300028381 Bacteria 4839
401 Ga0268264_10289314 3300028381 Unclassified 1538
402 Ga0268264_10291604 3300028381 Bacteria 1532
403 Ga0268264_10467032 3300028381 Bacteria 1225
404 Ga0307408_100054328 3300031548 Bacteria 2896
405 Ga0307405_10004688 3300031731 Bacteria 6503
406 Ga0307405_10046166 3300031731 Bacteria 2675
407 Ga0307405_10157566 3300031731 Bacteria 1604
408 Ga0307413_10038442 3300031824 Bacteria 2774
409 Ga0307410_10000945 3300031852 Bacteria 12472
410 Ga0307406_10012120 3300031901 Unclassified 4907
411 Ga0307406_10084368 3300031901 Bacteria 2121
412 Ga0307407_10037044 3300031903 Bacteria 2692
413 Ga0307407_10100275 3300031903 Bacteria 1796
414 Ga0307412_10013452 3300031911 Bacteria 4801
415 Ga0307409_100190687 3300031995 Bacteria 1824
416 Ga0307409_100233274 3300031995 Bacteria 1670
417 Ga0307416_100038093 3300032002 Bacteria 3706
418 Ga0307416_100053786 3300032002 Bacteria 3232
419 Ga0307416_100082778 3300032002 Bacteria 2720
420 Ga0307414_10008715 3300032004 Bacteria 5778
421 Ga0307414_10209706 3300032004 Bacteria 1591
422 Ga0307414_10268257 3300032004 Bacteria 1428
423 Ga0307414_10406343 3300032004 Bacteria 1184
424 Ga0307411_10023811 3300032005 Bacteria 3636
425 Ga0307415_100010761 3300032126 Bacteria 5198
426 Ga0373959_0000868 3300034820 Bacteria 5116
427 Ga0373938_0000563 3300034957 Bacteria 5994
428 Ga0373929_0000170 3300035085 Bacteria 11480
429 Ga0373949_0001689 3300035090 Bacteria 6140
430 Ga0373949_0020060 3300035090 Bacteria 1528
431 Ga0373951_0000392 3300035091 Bacteria 13019
432 Ga0373951_0000847 3300035091 Bacteria 8305
433 Ga0373952_0000471 3300035092 Bacteria 7014
434 Ga0373923_0024138 3300035111 Bacteria 2398
435 Ga0373932_0000146 3300035112 Bacteria 20150
436 Ga0373932_0016899 3300035112 Bacteria 1867
437 Ga0373941_0011474 3300035115 Bacteria 2290
438 Ga0373942_0000554 3300035207 Bacteria 10517
439 Ga0373942_0008763 3300035207 Unclassified 2363
440 Ga0373962_0002509 3300035242 Bacteria 4358
441 Ga0373931_0107119 3300035691 Bacteria 1580
442 Ga0373937_0017102 3300036401 Bacteria 6450
443 Ga0395900_0221646 3300037418 Bacteria 1906
444 Ga0395900_0340312 3300037418 Bacteria 1476
445 Ga0395898_0357169 3300037466 Bacteria 1393
446 Ga0395905_0145943 3300037471 Bacteria 2226
447 Ga0395901_0021025 3300038443 Bacteria 6685
448 Ga0395901_0497836 3300038443 Bacteria 1241
449 Ga0395901_0502777 3300038443 Unclassified 1234
450 Ga0242419_000245 3300038698 Bacteria 2897
451 Ga0242422_00279 3300038699 Unclassified 3071
452 Ga0242420_004064 3300038996 Bacteria 2193
453 Ga0439455_0018280 3300042012 Bacteria 1643
454 Ga0439458_0017243 3300042157 Bacteria 1647
455 Ga0439434_0014987 3300042435 Bacteria 2308
456 Ga0453684_0011015 3300044712 Bacteria 15276
457 Ga0451576_0121994 3300045051 Bacteria 2714
458 Ga0466967_0076978 3300045976 Unclassified 3002
459 Ga0495610_0057825 3300046512 Bacteria 1858
460 Ga0495663_0000129 3300046525 Bacteria 31242
461 Ga0495598_0000030 3300046537 Bacteria 22060
462 Ga0495621_0002345 3300046539 Bacteria 5087
463 Ga0495633_0049832 3300046558 Bacteria 1976
464 Ga0495656_0073348 3300046615 Unclassified 1526
465 Ga0495670_0057804 3300046691 Bacteria 1947
466 Ga0495672_0025600 3300047320 Bacteria 3772
467 Ga0496102_0108002 3300048905 Bacteria 2592
468 Ga0496106_0142136 3300048909 Bacteria 1888
469 Ga0496108_0164003 3300048911 Unclassified 1921
470 Ga0496110_0269613 3300048913 Unclassified 1550
471 Ga0496112_0340926 3300048915 Unclassified 1442
472 Ga0496113_0041407 3300048916 Bacteria 3400
473 Ga0496114_0127879 3300048917 Bacteria 2192
474 Ga0501292_005513 3300049515 Bacteria 1766
475 Ga0501296_001938 3300049519 Bacteria 2116
476 Ga0501296_004314 3300049519 Bacteria 1548
477 Ga0501296_005652 3300049519 Bacteria 1400
478 Ga0501298_001573 3300049521 Bacteria 3377
479 Ga0501298_004374 3300049521 Bacteria 2224
480 Ga0501298_014414 3300049521 Bacteria 1412
481 Ga0501038_0002741 3300049574 Bacteria 16415
482 Ga0501198_004443 3300049649 Bacteria 1945
483 Ga0501202_038173 3300049652 Bacteria 1028
484 Ga0501206_009918 3300049653 Bacteria 1270
485 Ga0501207_000437 3300049654 Bacteria 4654
486 Ga0501207_003677 3300049654 Unclassified 2055
487 Ga0501209_002306 3300049656 Bacteria 2903
488 Ga0501216_012718 3300049660 Bacteria 1385
489 Ga0501217_004071 3300049661 Bacteria 2991
490 Ga0501217_023696 3300049661 Bacteria 1464
491 Ga0501223_002346 3300049663 Bacteria 4224
492 Ga0501223_002532 3300049663 Bacteria 4046
493 Ga0501223_020319 3300049663 Bacteria 1302
494 Ga0501224_000496 3300049664 Bacteria 4759
495 Ga0501224_004648 3300049664 Unclassified 1952
496 Ga0501224_014354 3300049664 Bacteria 1171
497 Ga0501227_001828 3300049665 Unclassified 4716
498 Ga0501230_005209 3300049667 Bacteria 1827
499 Ga0501233_002638 3300049668 Bacteria 3174
500 Ga0501233_008953 3300049668 Unclassified 1943
501 Ga0501235_001876 3300049669 Bacteria 4495
502 Ga0501235_006252 3300049669 Bacteria 2595
503 Ga0501235_013659 3300049669 Bacteria 1788
504 Ga0501240_000343 3300049673 Bacteria 3687
505 Ga0501240_002371 3300049673 Unclassified 1992
506 Ga0501246_002267 3300049676 Bacteria 1519
507 Ga0501250_006956 3300049680 Bacteria 1210
508 Ga0501252_005054 3300049682 Bacteria 1424
509 Ga0501260_001308 3300049689 Bacteria 2044
510 Ga0501261_008523 3300049690 Bacteria 1325
511 Ga0501221_006645 3300049704 Bacteria 1961
512 Ga0501225_0002593 3300049705 Bacteria 5555
513 Ga0501225_0008980 3300049705 Bacteria 2859
514 Ga0501225_0016228 3300049705 Bacteria 2071
515 Ga0501234_001388 3300049707 Bacteria 3801
516 Ga0501234_003415 3300049707 Bacteria 2496
517 Ga0501234_010268 3300049707 Bacteria 1458
518 Ga0501234_014434 3300049707 Unclassified 1241
519 Ga0501081_0094464 3300049743 Bacteria 2107
520 Ga0501273_001706 3300049770 Unclassified 2143
521 Ga0501279_001121 3300049775 Bacteria 3524
522 Ga0501212_002274 3300049851 Unclassified 2299
523 Ga0501226_000816 3300049853 Bacteria 4173
524 nmdc:mga05p37_129820_c1 3300050507 Bacteria 3092
525 nmdc:mga05p37_492171_c1 3300050507 Bacteria 1409
526 nmdc:mga05p37_58128_c1 3300050507 Bacteria 4762
527 nmdc:mga09592_143184_c1 3300050508 Bacteria 2061
528 nmdc:mga06r32_166691_c1 3300050510 Bacteria 2186
529 nmdc:mga08y16_9977_c1 3300050511 Bacteria 9966
530 nmdc:mga0n895_215741_c1 3300050512 Bacteria 1948
531 nmdc:mga0n895_297912_c1 3300050512 Bacteria 1635
532 nmdc:mga0n895_385826_c1 3300050512 Bacteria 1417
533 nmdc:mga0n895_409537_c1 3300050512 Bacteria 1371
534 nmdc:mga0n895_97249_c1 3300050512 Bacteria 2949
535 nmdc:mga0rr50_129990_c1 3300050513 Bacteria 2015
536 nmdc:mga0rr50_40506_c1 3300050513 Bacteria 3388
537 nmdc:mga0rr50_624_c1 3300050513 Bacteria 18986
538 nmdc:mga0a205_269776_c1 3300050515 Bacteria 1579
539 nmdc:mga0a205_67425_c1 3300050515 Bacteria 3457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10203920 Ga0207689_102039202 289
2 3300038996 Ga0242420_004064 Ga0242420_004064_1310_2179 289
3 3300048917 Ga0496114_0127879 Ga0496114_0127879_14_883 289
4 3300044712 Ga0453684_0011015 Ga0453684_0011015_4911_5816 301
5 3300014969 Ga0157376_10262903 Ga0157376_102629032 306
6 3300046691 Ga0495670_0057804 Ga0495670_0057804_61_981 306
7 3300005290 Ga0065712_10158548 Ga0065712_101585482 309
8 3300005293 Ga0065715_10228886 Ga0065715_102288861 309
9 3300005617 Ga0068859_100110138 Ga0068859_1001101383 309
10 3300006931 Ga0097620_100110138 Ga0097620_1001101383 309
11 3300050512 nmdc:mga0n895_409537_c1 nmdc:mga0n895_409537_c1_55_1002 315
12 3300038443 Ga0395901_0502777 Ga0395901_0502777_105_1055 316
13 3300042435 Ga0439434_0014987 Ga0439434_0014987_538_1488 316
14 3300005353 Ga0070669_100298436 Ga0070669_1002984361 317
15 3300009011 Ga0105251_10079454 Ga0105251_100794542 317
16 3300009177 Ga0105248_10023570 Ga0105248_100235703 317
17 3300013100 Ga0157373_10001007 Ga0157373_1000100716 317
18 3300013306 Ga0163162_10033212 Ga0163162_100332124 317
19 3300013306 Ga0163162_10045961 Ga0163162_100459613 317
20 3300013307 Ga0157372_10344598 Ga0157372_103445982 317
21 3300025941 Ga0207711_10140751 Ga0207711_101407512 317
22 3300026118 Ga0207675_100160227 Ga0207675_1001602272 317
23 3300049519 Ga0501296_001938 Ga0501296_001938_22_978 317
24 3300049652 Ga0501202_038173 Ga0501202_038173_39_992 317
25 3300049653 Ga0501206_009918 Ga0501206_009918_60_1016 317
26 3300049676 Ga0501246_002267 Ga0501246_002267_32_985 317
27 3300015262 Ga0182007_10079768 Ga0182007_100797681 319
28 3300014326 Ga0157380_10000129 Ga0157380_1000012931 323
29 3300037471 Ga0395905_0145943 Ga0395905_0145943_912_1922 328
30 iso_pu_bacteria 2513237086 2513585776 331
31 iso_pu_bacteria 2513237140 2513886399 331
32 iso_pu_bacteria 2513237143 2513906917 331
33 iso_pu_bacteria 2515154107 2515613245 331
34 iso_pu_bacteria 2643221689 2644497663 331
35 iso_pu_bacteria 2838074704 2838078536 331
36 iso_pu_bacteria 2896384573 2896389364 331
37 iso_pu_bacteria 2921208531 2921214457 331
38 iso_pu_bacteria 2924207177 2924213731 331
39 iso_pu_bacteria 2957408893 2957413849 331
40 iso_pu_bacteria 2957443900 2957447942 331
41 iso_pu_bacteria 2957450854 2957457432 331
42 iso_pu_bacteria 2960645483 2960649007 331
43 iso_pu_bacteria 2960660292 2960664946 331
44 iso_pu_bacteria 2960674078 2960679292 331
45 iso_pu_bacteria 2964636051 2964641925 331
46 iso_pu_bacteria 2964663802 2964669963 331
47 iso_pu_bacteria 2970164137 2970168696 331
48 iso_pu_bacteria 3003930520 3003935825 331
49 3300049743 Ga0501081_0094464 Ga0501081_0094464_516_1514 332
50 iso_pu_bacteria 2913912277 2913916828 332
51 3300005355 Ga0070671_100103083 Ga0070671_1001030832 334
52 3300005471 Ga0070698_100294486 Ga0070698_1002944862 334
53 3300005544 Ga0070686_100062399 Ga0070686_1000623992 334
54 3300005578 Ga0068854_100092787 Ga0068854_1000927873 334
55 3300007076 Ga0075435_100001072 Ga0075435_1000010727 334
56 3300013105 Ga0157369_10126548 Ga0157369_101265482 334
57 3300025918 Ga0207662_10009761 Ga0207662_100097612 334
58 3300025932 Ga0207690_10044714 Ga0207690_100447141 334
59 3300025933 Ga0207706_10242499 Ga0207706_102424992 334
60 3300025981 Ga0207640_10033986 Ga0207640_100339862 334
61 3300026023 Ga0207677_10198996 Ga0207677_101989962 334
62 3300026035 Ga0207703_10157989 Ga0207703_101579892 334
63 3300034820 Ga0373959_0000868 Ga0373959_0000868_2394_3455 334
64 3300034957 Ga0373938_0000563 Ga0373938_0000563_4512_5567 334
65 3300035085 Ga0373929_0000170 Ga0373929_0000170_1108_2169 334
66 3300035090 Ga0373949_0001689 Ga0373949_0001689_925_1980 334
67 3300035091 Ga0373951_0000392 Ga0373951_0000392_10051_11112 334
68 3300035092 Ga0373952_0000471 Ga0373952_0000471_280_1335 334
69 3300035112 Ga0373932_0000146 Ga0373932_0000146_10215_11276 334
70 3300035115 Ga0373941_0011474 Ga0373941_0011474_1043_2098 334
71 3300035207 Ga0373942_0000554 Ga0373942_0000554_4060_5115 334
72 3300035242 Ga0373962_0002509 Ga0373962_0002509_166_1221 334
73 3300048905 Ga0496102_0108002 Ga0496102_0108002_1479_2534 334
74 3300050512 nmdc:mga0n895_297912_c1 nmdc:mga0n895_297912_c1_284_1339 334
75 3300050513 nmdc:mga0rr50_624_c1 nmdc:mga0rr50_624_c1_15222_16277 334
76 3300005456 Ga0070678_100101727 Ga0070678_1001017273 335
77 3300005536 Ga0070697_100297036 Ga0070697_1002970362 335
78 3300006358 Ga0068871_100001972 Ga0068871_1000019724 335
79 3300006871 Ga0075434_100216304 Ga0075434_1002163042 335
80 3300007076 Ga0075435_100089577 Ga0075435_1000895773 335
81 3300009147 Ga0114129_10017378 Ga0114129_100173786 335
82 3300013102 Ga0157371_10000364 Ga0157371_1000036421 335
83 3300046558 Ga0495633_0049832 Ga0495633_0049832_44_1075 335
84 3300050507 nmdc:mga05p37_58128_c1 nmdc:mga05p37_58128_c1_765_1772 335
85 3300005328 Ga0070676_10005932 Ga0070676_100059324 336
86 3300005328 Ga0070676_10175325 Ga0070676_101753252 336
87 3300005330 Ga0070690_100025132 Ga0070690_1000251323 336
88 3300005330 Ga0070690_100033026 Ga0070690_1000330263 336
89 3300005331 Ga0070670_100008998 Ga0070670_1000089986 336
90 3300005334 Ga0068869_100041635 Ga0068869_1000416352 336
91 3300005334 Ga0068869_100043513 Ga0068869_1000435133 336
92 3300005335 Ga0070666_10026071 Ga0070666_100260711 336
93 3300005337 Ga0070682_100000466 Ga0070682_10000046613 336
94 3300005340 Ga0070689_100013033 Ga0070689_1000130334 336
95 3300005340 Ga0070689_100026282 Ga0070689_1000262822 336
96 3300005343 Ga0070687_100002270 Ga0070687_1000022705 336
97 3300005353 Ga0070669_100000696 Ga0070669_10000069621 336
98 3300005353 Ga0070669_100082533 Ga0070669_1000825332 336
99 3300005353 Ga0070669_100096931 Ga0070669_1000969312 336
100 3300005353 Ga0070669_100119330 Ga0070669_1001193302 336
101 3300005353 Ga0070669_100317316 Ga0070669_1003173161 336
102 3300005354 Ga0070675_100105508 Ga0070675_1001055083 336
103 3300005355 Ga0070671_100007476 Ga0070671_1000074768 336
104 3300005364 Ga0070673_100092419 Ga0070673_1000924192 336
105 3300005365 Ga0070688_100084390 Ga0070688_1000843902 336
106 3300005367 Ga0070667_100022389 Ga0070667_1000223893 336
107 3300005406 Ga0070703_10000151 Ga0070703_100001515 336
108 3300005438 Ga0070701_10007587 Ga0070701_100075872 336
109 3300005440 Ga0070705_100056809 Ga0070705_1000568092 336
110 3300005444 Ga0070694_100100117 Ga0070694_1001001172 336
111 3300005444 Ga0070694_100180496 Ga0070694_1001804961 336
112 3300005457 Ga0070662_100020826 Ga0070662_1000208263 336
113 3300005467 Ga0070706_100000335 Ga0070706_10000033517 336
114 3300005467 Ga0070706_100022335 Ga0070706_1000223353 336
115 3300005467 Ga0070706_100038957 Ga0070706_1000389573 336
116 3300005468 Ga0070707_100042380 Ga0070707_1000423803 336
117 3300005471 Ga0070698_100004774 Ga0070698_1000047749 336
118 3300005518 Ga0070699_100022320 Ga0070699_1000223202 336
119 3300005518 Ga0070699_100060031 Ga0070699_1000600313 336
120 3300005518 Ga0070699_100132192 Ga0070699_1001321922 336
121 3300005536 Ga0070697_100000068 Ga0070697_10000006838 336
122 3300005536 Ga0070697_100000131 Ga0070697_10000013117 336
123 3300005544 Ga0070686_100019143 Ga0070686_1000191433 336
124 3300005545 Ga0070695_100034242 Ga0070695_1000342423 336
125 3300005546 Ga0070696_100013737 Ga0070696_1000137373 336
126 3300005546 Ga0070696_100078923 Ga0070696_1000789233 336
127 3300005546 Ga0070696_100138199 Ga0070696_1001381992 336
128 3300005549 Ga0070704_100016051 Ga0070704_1000160513 336
129 3300005549 Ga0070704_100020898 Ga0070704_1000208982 336
130 3300005549 Ga0070704_100038978 Ga0070704_1000389782 336
131 3300005549 Ga0070704_100069830 Ga0070704_1000698303 336
132 3300005615 Ga0070702_100034473 Ga0070702_1000344732 336
133 3300005616 Ga0068852_100014227 Ga0068852_1000142273 336
134 3300005719 Ga0068861_100048931 Ga0068861_1000489312 336
135 3300005719 Ga0068861_100066591 Ga0068861_1000665912 336
136 3300005834 Ga0068851_10029607 Ga0068851_100296072 336
137 3300005843 Ga0068860_100016043 Ga0068860_1000160434 336
138 3300005844 Ga0068862_100037936 Ga0068862_1000379364 336
139 3300005844 Ga0068862_100166858 Ga0068862_1001668582 336
140 3300007076 Ga0075435_100011375 Ga0075435_1000113753 336
141 3300009098 Ga0105245_10037618 Ga0105245_100376183 336
142 3300009147 Ga0114129_10130744 Ga0114129_101307441 336
143 3300009147 Ga0114129_10531371 Ga0114129_105313712 336
144 3300009148 Ga0105243_10066766 Ga0105243_100667663 336
145 3300009174 Ga0105241_10011900 Ga0105241_100119004 336
146 3300009176 Ga0105242_10257006 Ga0105242_102570062 336
147 3300009177 Ga0105248_10032285 Ga0105248_100322856 336
148 3300010375 Ga0105239_10075690 Ga0105239_100756902 336
149 3300013297 Ga0157378_10096465 Ga0157378_100964652 336
150 3300013297 Ga0157378_10155490 Ga0157378_101554902 336
151 3300013306 Ga0163162_10155500 Ga0163162_101555002 336
152 3300014325 Ga0163163_10095084 Ga0163163_100950843 336
153 3300014326 Ga0157380_10260194 Ga0157380_102601942 336
154 3300014968 Ga0157379_10231362 Ga0157379_102313622 336
155 3300025885 Ga0207653_10000012 Ga0207653_1000001233 336
156 3300025901 Ga0207688_10010792 Ga0207688_100107922 336
157 3300025907 Ga0207645_10010842 Ga0207645_100108425 336
158 3300025910 Ga0207684_10000209 Ga0207684_1000020947 336
159 3300025910 Ga0207684_10021320 Ga0207684_100213204 336
160 3300025910 Ga0207684_10062793 Ga0207684_100627933 336
161 3300025918 Ga0207662_10002228 Ga0207662_100022285 336
162 3300025919 Ga0207657_10137303 Ga0207657_101373032 336
163 3300025922 Ga0207646_10106955 Ga0207646_101069552 336
164 3300025923 Ga0207681_10000618 Ga0207681_100006185 336
165 3300025923 Ga0207681_10007295 Ga0207681_100072952 336
166 3300025925 Ga0207650_10003417 Ga0207650_100034172 336
167 3300025931 Ga0207644_10007882 Ga0207644_100078826 336
168 3300025933 Ga0207706_10036353 Ga0207706_100363532 336
169 3300025933 Ga0207706_10039918 Ga0207706_100399183 336
170 3300025935 Ga0207709_10064556 Ga0207709_100645562 336
171 3300025936 Ga0207670_10115840 Ga0207670_101158402 336
172 3300025938 Ga0207704_10233391 Ga0207704_102333912 336
173 3300025940 Ga0207691_10032309 Ga0207691_100323095 336
174 3300025941 Ga0207711_10010133 Ga0207711_100101333 336
175 3300025942 Ga0207689_10033466 Ga0207689_100334663 336
176 3300025942 Ga0207689_10047492 Ga0207689_100474922 336
177 3300025960 Ga0207651_10010854 Ga0207651_100108545 336
178 3300025960 Ga0207651_10084427 Ga0207651_100844273 336
179 3300025981 Ga0207640_10154395 Ga0207640_101543952 336
180 3300025986 Ga0207658_10211570 Ga0207658_102115702 336
181 3300026035 Ga0207703_10192775 Ga0207703_101927752 336
182 3300026075 Ga0207708_10000925 Ga0207708_1000092520 336
183 3300026075 Ga0207708_10108933 Ga0207708_101089332 336
184 3300026116 Ga0207674_10187888 Ga0207674_101878882 336
185 3300026118 Ga0207675_100052974 Ga0207675_1000529744 336
186 3300026118 Ga0207675_100065683 Ga0207675_1000656832 336
187 3300026118 Ga0207675_100077877 Ga0207675_1000778772 336
188 3300028380 Ga0268265_10043185 Ga0268265_100431853 336
189 3300028381 Ga0268264_10291604 Ga0268264_102916042 336
190 3300031995 Ga0307409_100233274 Ga0307409_1002332742 336
191 3300032002 Ga0307416_100082778 Ga0307416_1000827783 336
192 3300035090 Ga0373949_0020060 Ga0373949_0020060_439_1491 336
193 3300035111 Ga0373923_0024138 Ga0373923_0024138_1060_2097 336
194 3300035112 Ga0373932_0016899 Ga0373932_0016899_222_1274 336
195 3300035691 Ga0373931_0107119 Ga0373931_0107119_441_1493 336
196 3300036401 Ga0373937_0017102 Ga0373937_0017102_2201_3238 336
197 3300037418 Ga0395900_0340312 Ga0395900_0340312_424_1434 336
198 3300045976 Ga0466967_0076978 Ga0466967_0076978_1608_2636 336
199 3300046512 Ga0495610_0057825 Ga0495610_0057825_781_1791 336
200 3300046525 Ga0495663_0000129 Ga0495663_0000129_11743_12753 336
201 3300046537 Ga0495598_0000030 Ga0495598_0000030_13616_14626 336
202 3300046539 Ga0495621_0002345 Ga0495621_0002345_3313_4323 336
203 3300046615 Ga0495656_0073348 Ga0495656_0073348_296_1306 336
204 3300047320 Ga0495672_0025600 Ga0495672_0025600_1197_2207 336
205 3300048909 Ga0496106_0142136 Ga0496106_0142136_754_1806 336
206 3300050513 nmdc:mga0rr50_40506_c1 nmdc:mga0rr50_40506_c1_1755_2807 336
207 2162886007 SwRhRL2b_contig_718651 SwRhRL2b_0970.00004400 337
208 3300000532 CNAas_1000209 CNAas_10002092 337
209 3300003203 JGI25406J46586_10001946 JGI25406J46586_100019462 337
210 3300005288 Ga0065714_10064435 Ga0065714_1006443578 337
211 3300005290 Ga0065712_10000118 Ga0065712_1000011879 337
212 3300005290 Ga0065712_10008558 Ga0065712_100085582 337
213 3300005290 Ga0065712_10032530 Ga0065712_100325302 337
214 3300005290 Ga0065712_10093328 Ga0065712_100933282 337
215 3300005293 Ga0065715_10088964 Ga0065715_100889643 337
216 3300005293 Ga0065715_10101973 Ga0065715_101019732 337
217 3300005293 Ga0065715_10127862 Ga0065715_101278622 337
218 3300005293 Ga0065715_10165528 Ga0065715_101655282 337
219 3300005293 Ga0065715_10196918 Ga0065715_101969181 337
220 3300005293 Ga0065715_10220571 Ga0065715_102205712 337
221 3300005295 Ga0065707_10001141 Ga0065707_100011412 337
222 3300005330 Ga0070690_100008623 Ga0070690_1000086234 337
223 3300005331 Ga0070670_100000652 Ga0070670_10000065213 337
224 3300005331 Ga0070670_100036736 Ga0070670_1000367363 337
225 3300005331 Ga0070670_100184273 Ga0070670_1001842733 337
226 3300005334 Ga0068869_100081492 Ga0068869_1000814922 337
227 3300005334 Ga0068869_100129648 Ga0068869_1001296481 337
228 3300005334 Ga0068869_100132471 Ga0068869_1001324712 337
229 3300005334 Ga0068869_100176418 Ga0068869_1001764182 337
230 3300005335 Ga0070666_10112222 Ga0070666_101122222 337
231 3300005338 Ga0068868_100017601 Ga0068868_1000176013 337
232 3300005340 Ga0070689_100113575 Ga0070689_1001135752 337
233 3300005340 Ga0070689_100295782 Ga0070689_1002957821 337
234 3300005345 Ga0070692_10050208 Ga0070692_100502082 337
235 3300005355 Ga0070671_100082054 Ga0070671_1000820542 337
236 3300005356 Ga0070674_100092049 Ga0070674_1000920492 337
237 3300005364 Ga0070673_100057540 Ga0070673_1000575404 337
238 3300005365 Ga0070688_100080977 Ga0070688_1000809773 337
239 3300005366 Ga0070659_100197924 Ga0070659_1001979242 337
240 3300005406 Ga0070703_10063059 Ga0070703_100630591 337
241 3300005441 Ga0070700_100000288 Ga0070700_1000002887 337
242 3300005441 Ga0070700_100026287 Ga0070700_1000262872 337
243 3300005441 Ga0070700_100034411 Ga0070700_1000344112 337
244 3300005444 Ga0070694_100012265 Ga0070694_1000122654 337
245 3300005444 Ga0070694_100035775 Ga0070694_1000357753 337
246 3300005444 Ga0070694_100141829 Ga0070694_1001418291 337
247 3300005445 Ga0070708_100000103 Ga0070708_10000010337 337
248 3300005456 Ga0070678_100282994 Ga0070678_1002829941 337
249 3300005458 Ga0070681_10000748 Ga0070681_100007489 337
250 3300005458 Ga0070681_10003967 Ga0070681_100039678 337
251 3300005459 Ga0068867_100066239 Ga0068867_1000662392 337
252 3300005467 Ga0070706_100001771 Ga0070706_1000017715 337
253 3300005467 Ga0070706_100006280 Ga0070706_1000062808 337
254 3300005468 Ga0070707_100246335 Ga0070707_1002463351 337
255 3300005471 Ga0070698_100009831 Ga0070698_1000098315 337
256 3300005471 Ga0070698_100072834 Ga0070698_1000728343 337
257 3300005518 Ga0070699_100001144 Ga0070699_1000011449 337
258 3300005518 Ga0070699_100079507 Ga0070699_1000795073 337
259 3300005536 Ga0070697_100009524 Ga0070697_1000095243 337
260 3300005536 Ga0070697_100115871 Ga0070697_1001158712 337
261 3300005539 Ga0068853_100044934 Ga0068853_1000449342 337
262 3300005543 Ga0070672_100113071 Ga0070672_1001130712 337
263 3300005544 Ga0070686_100006566 Ga0070686_1000065664 337
264 3300005544 Ga0070686_100020936 Ga0070686_1000209365 337
265 3300005545 Ga0070695_100147642 Ga0070695_1001476421 337
266 3300005545 Ga0070695_100159713 Ga0070695_1001597132 337
267 3300005547 Ga0070693_100020441 Ga0070693_1000204414 337
268 3300005547 Ga0070693_100024438 Ga0070693_1000244382 337
269 3300005549 Ga0070704_100028229 Ga0070704_1000282293 337
270 3300005549 Ga0070704_100071258 Ga0070704_1000712582 337
271 3300005549 Ga0070704_100080357 Ga0070704_1000803572 337
272 3300005563 Ga0068855_100540034 Ga0068855_1005400341 337
273 3300005577 Ga0068857_100098268 Ga0068857_1000982683 337
274 3300005577 Ga0068857_100121620 Ga0068857_1001216202 337
275 3300005577 Ga0068857_100334230 Ga0068857_1003342302 337
276 3300005578 Ga0068854_100222529 Ga0068854_1002225292 337
277 3300005578 Ga0068854_100332648 Ga0068854_1003326481 337
278 3300005615 Ga0070702_100004349 Ga0070702_1000043493 337
279 3300005615 Ga0070702_100015516 Ga0070702_1000155163 337
280 3300005615 Ga0070702_100035569 Ga0070702_1000355692 337
281 3300005615 Ga0070702_100091384 Ga0070702_1000913842 337
282 3300005615 Ga0070702_100168454 Ga0070702_1001684542 337
283 3300005616 Ga0068852_100035960 Ga0068852_1000359603 337
284 3300005616 Ga0068852_100101511 Ga0068852_1001015112 337
285 3300005617 Ga0068859_100006149 Ga0068859_1000061494 337
286 3300005617 Ga0068859_100006397 Ga0068859_1000063978 337
287 3300005617 Ga0068859_100012779 Ga0068859_1000127794 337
288 3300005617 Ga0068859_100026312 Ga0068859_1000263125 337
289 3300005617 Ga0068859_100047298 Ga0068859_1000472984 337
290 3300005617 Ga0068859_100141408 Ga0068859_1001414082 337
291 3300005617 Ga0068859_100153145 Ga0068859_1001531452 337
292 3300005617 Ga0068859_100597553 Ga0068859_1005975532 337
293 3300005618 Ga0068864_100039321 Ga0068864_1000393213 337
294 3300005618 Ga0068864_100052756 Ga0068864_1000527563 337
295 3300005618 Ga0068864_100077573 Ga0068864_1000775732 337
296 3300005618 Ga0068864_100086203 Ga0068864_1000862032 337
297 3300005618 Ga0068864_100087717 Ga0068864_1000877172 337
298 3300005618 Ga0068864_100127563 Ga0068864_1001275632 337
299 3300005618 Ga0068864_100187204 Ga0068864_1001872041 337
300 3300005719 Ga0068861_100006484 Ga0068861_1000064847 337
301 3300005834 Ga0068851_10002980 Ga0068851_100029803 337
302 3300005840 Ga0068870_10018668 Ga0068870_100186682 337
303 3300005840 Ga0068870_10085017 Ga0068870_100850172 337
304 3300005841 Ga0068863_100010661 Ga0068863_1000106616 337
305 3300005842 Ga0068858_100085724 Ga0068858_1000857243 337
306 3300005842 Ga0068858_100125879 Ga0068858_1001258792 337
307 3300005842 Ga0068858_100281843 Ga0068858_1002818432 337
308 3300005842 Ga0068858_100328112 Ga0068858_1003281122 337
309 3300005843 Ga0068860_100018121 Ga0068860_1000181214 337
310 3300005843 Ga0068860_100043769 Ga0068860_1000437693 337
311 3300005843 Ga0068860_100049091 Ga0068860_1000490913 337
312 3300005843 Ga0068860_100127786 Ga0068860_1001277862 337
313 3300005843 Ga0068860_100510174 Ga0068860_1005101742 337
314 3300005844 Ga0068862_100297485 Ga0068862_1002974851 337
315 3300005985 Ga0081539_10000067 Ga0081539_10000067208 337
316 3300006237 Ga0097621_100003849 Ga0097621_1000038495 337
317 3300006237 Ga0097621_100014258 Ga0097621_1000142583 337
318 3300006237 Ga0097621_100047731 Ga0097621_1000477313 337
319 3300006237 Ga0097621_100075354 Ga0097621_1000753542 337
320 3300006237 Ga0097621_100184793 Ga0097621_1001847932 337
321 3300006358 Ga0068871_100000984 Ga0068871_10000098414 337
322 3300006358 Ga0068871_100008641 Ga0068871_1000086415 337
323 3300006358 Ga0068871_100020604 Ga0068871_1000206044 337
324 3300006846 Ga0075430_100118734 Ga0075430_1001187343 337
325 3300006852 Ga0075433_10079830 Ga0075433_100798302 337
326 3300006852 Ga0075433_10121813 Ga0075433_101218133 337
327 3300006871 Ga0075434_100180739 Ga0075434_1001807392 337
328 3300006871 Ga0075434_100424488 Ga0075434_1004244882 337
329 3300006880 Ga0075429_100030198 Ga0075429_1000301982 337
330 3300006880 Ga0075429_100099194 Ga0075429_1000991942 337
331 3300006881 Ga0068865_100232346 Ga0068865_1002323462 337
332 3300006881 Ga0068865_100377948 Ga0068865_1003779481 337
333 3300006931 Ga0097620_100006149 Ga0097620_1000061498 337
334 3300006931 Ga0097620_100006396 Ga0097620_1000063968 337
335 3300006931 Ga0097620_100012779 Ga0097620_1000127794 337
336 3300006931 Ga0097620_100026317 Ga0097620_1000263175 337
337 3300006931 Ga0097620_100047295 Ga0097620_1000472954 337
338 3300006931 Ga0097620_100141408 Ga0097620_1001414082 337
339 3300006931 Ga0097620_100153144 Ga0097620_1001531442 337
340 3300006931 Ga0097620_100597584 Ga0097620_1005975842 337
341 3300007076 Ga0075435_100007063 Ga0075435_1000070635 337
342 3300009093 Ga0105240_10195922 Ga0105240_101959222 337
343 3300009094 Ga0111539_10009124 Ga0111539_100091243 337
344 3300009094 Ga0111539_10122852 Ga0111539_101228523 337
345 3300009094 Ga0111539_10131114 Ga0111539_101311143 337
346 3300009098 Ga0105245_10013998 Ga0105245_100139982 337
347 3300009101 Ga0105247_10080913 Ga0105247_100809132 337
348 3300009147 Ga0114129_10329152 Ga0114129_103291522 337
349 3300009148 Ga0105243_10003704 Ga0105243_100037047 337
350 3300009148 Ga0105243_10398075 Ga0105243_103980752 337
351 3300009174 Ga0105241_10089091 Ga0105241_100890913 337
352 3300009174 Ga0105241_10169131 Ga0105241_101691312 337
353 3300009176 Ga0105242_10046939 Ga0105242_100469394 337
354 3300009176 Ga0105242_10194930 Ga0105242_101949302 337
355 3300009177 Ga0105248_10006695 Ga0105248_100066953 337
356 3300009177 Ga0105248_10027387 Ga0105248_100273872 337
357 3300009177 Ga0105248_10073396 Ga0105248_100733964 337
358 3300009177 Ga0105248_10473745 Ga0105248_104737452 337
359 3300009177 Ga0105248_10599504 Ga0105248_105995042 337
360 3300009545 Ga0105237_10000264 Ga0105237_1000026438 337
361 3300009545 Ga0105237_10037530 Ga0105237_100375303 337
362 3300009551 Ga0105238_10003921 Ga0105238_100039218 337
363 3300009551 Ga0105238_10062732 Ga0105238_100627322 337
364 3300009553 Ga0105249_10003798 Ga0105249_100037985 337
365 3300010375 Ga0105239_10196146 Ga0105239_101961462 337
366 3300011119 Ga0105246_10094144 Ga0105246_100941443 337
367 3300011119 Ga0105246_10109304 Ga0105246_101093042 337
368 3300013100 Ga0157373_10008818 Ga0157373_100088183 337
369 3300013100 Ga0157373_10018728 Ga0157373_100187284 337
370 3300013296 Ga0157374_10025614 Ga0157374_100256143 337
371 3300013296 Ga0157374_10307211 Ga0157374_103072112 337
372 3300013297 Ga0157378_10012115 Ga0157378_100121153 337
373 3300013297 Ga0157378_10091682 Ga0157378_100916822 337
374 3300013297 Ga0157378_10372680 Ga0157378_103726802 337
375 3300013306 Ga0163162_10006021 Ga0163162_100060214 337
376 3300013306 Ga0163162_10496637 Ga0163162_104966371 337
377 3300013307 Ga0157372_10015192 Ga0157372_100151926 337
378 3300013308 Ga0157375_10035296 Ga0157375_100352961 337
379 3300013308 Ga0157375_10038665 Ga0157375_100386654 337
380 3300014325 Ga0163163_10000172 Ga0163163_1000017244 337
381 3300014325 Ga0163163_10001985 Ga0163163_100019858 337
382 3300014325 Ga0163163_10007526 Ga0163163_100075265 337
383 3300014325 Ga0163163_10290647 Ga0163163_102906471 337
384 3300014325 Ga0163163_10350478 Ga0163163_103504782 337
385 3300014325 Ga0163163_10432275 Ga0163163_104322752 337
386 3300014326 Ga0157380_10334235 Ga0157380_103342351 337
387 3300014326 Ga0157380_10336829 Ga0157380_103368292 337
388 3300014969 Ga0157376_10004860 Ga0157376_100048606 337
389 3300017792 Ga0163161_10023393 Ga0163161_100233934 337
390 3300025321 Ga0207656_10002099 Ga0207656_100020994 337
391 3300025885 Ga0207653_10003285 Ga0207653_100032854 337
392 3300025899 Ga0207642_10017790 Ga0207642_100177902 337
393 3300025900 Ga0207710_10001374 Ga0207710_1000137416 337
394 3300025904 Ga0207647_10023428 Ga0207647_100234283 337
395 3300025904 Ga0207647_10023892 Ga0207647_100238924 337
396 3300025908 Ga0207643_10062282 Ga0207643_100622822 337
397 3300025908 Ga0207643_10135363 Ga0207643_101353632 337
398 3300025910 Ga0207684_10000023 Ga0207684_1000002384 337
399 3300025911 Ga0207654_10041954 Ga0207654_100419542 337
400 3300025912 Ga0207707_10012719 Ga0207707_100127197 337
401 3300025912 Ga0207707_10059592 Ga0207707_100595923 337
402 3300025912 Ga0207707_10085206 Ga0207707_100852063 337
403 3300025913 Ga0207695_10285042 Ga0207695_102850422 337
404 3300025914 Ga0207671_10080619 Ga0207671_100806192 337
405 3300025918 Ga0207662_10028914 Ga0207662_100289142 337
406 3300025919 Ga0207657_10070926 Ga0207657_100709263 337
407 3300025922 Ga0207646_10188442 Ga0207646_101884422 337
408 3300025924 Ga0207694_10047833 Ga0207694_100478332 337
409 3300025925 Ga0207650_10000001 Ga0207650_10000001449 337
410 3300025925 Ga0207650_10285874 Ga0207650_102858741 337
411 3300025926 Ga0207659_10182808 Ga0207659_101828081 337
412 3300025932 Ga0207690_10261573 Ga0207690_102615732 337
413 3300025933 Ga0207706_10127036 Ga0207706_101270362 337
414 3300025935 Ga0207709_10001346 Ga0207709_1000134612 337
415 3300025935 Ga0207709_10098520 Ga0207709_100985202 337
416 3300025936 Ga0207670_10001338 Ga0207670_100013382 337
417 3300025936 Ga0207670_10010248 Ga0207670_100102483 337
418 3300025938 Ga0207704_10102490 Ga0207704_101024901 337
419 3300025939 Ga0207665_10020219 Ga0207665_100202192 337
420 3300025939 Ga0207665_10225745 Ga0207665_102257452 337
421 3300025940 Ga0207691_10048916 Ga0207691_100489164 337
422 3300025940 Ga0207691_10198813 Ga0207691_101988132 337
423 3300025941 Ga0207711_10020346 Ga0207711_100203464 337
424 3300025941 Ga0207711_10432969 Ga0207711_104329692 337
425 3300025942 Ga0207689_10006553 Ga0207689_100065536 337
426 3300025942 Ga0207689_10067641 Ga0207689_100676413 337
427 3300025942 Ga0207689_10131534 Ga0207689_101315342 337
428 3300025945 Ga0207679_10032801 Ga0207679_100328013 337
429 3300025945 Ga0207679_10058475 Ga0207679_100584752 337
430 3300025945 Ga0207679_10236958 Ga0207679_102369581 337
431 3300025949 Ga0207667_10282805 Ga0207667_102828052 337
432 3300025960 Ga0207651_10173206 Ga0207651_101732061 337
433 3300025961 Ga0207712_10001351 Ga0207712_1000135110 337
434 3300025981 Ga0207640_10010549 Ga0207640_100105493 337
435 3300025981 Ga0207640_10175908 Ga0207640_101759082 337
436 3300026023 Ga0207677_10014697 Ga0207677_100146973 337
437 3300026023 Ga0207677_10338520 Ga0207677_103385202 337
438 3300026035 Ga0207703_10005949 Ga0207703_100059494 337
439 3300026035 Ga0207703_10198008 Ga0207703_101980082 337
440 3300026035 Ga0207703_10295122 Ga0207703_102951222 337
441 3300026067 Ga0207678_10170215 Ga0207678_101702152 337
442 3300026075 Ga0207708_10000657 Ga0207708_1000065721 337
443 3300026075 Ga0207708_10005878 Ga0207708_100058786 337
444 3300026075 Ga0207708_10027391 Ga0207708_100273912 337
445 3300026075 Ga0207708_10033479 Ga0207708_100334793 337
446 3300026075 Ga0207708_10137869 Ga0207708_101378692 337
447 3300026078 Ga0207702_10100237 Ga0207702_101002373 337
448 3300026088 Ga0207641_10019457 Ga0207641_100194572 337
449 3300026088 Ga0207641_10274094 Ga0207641_102740942 337
450 3300026088 Ga0207641_10351939 Ga0207641_103519392 337
451 3300026089 Ga0207648_10084193 Ga0207648_100841932 337
452 3300026095 Ga0207676_10007448 Ga0207676_100074482 337
453 3300026095 Ga0207676_10022645 Ga0207676_100226453 337
454 3300026095 Ga0207676_10072495 Ga0207676_100724952 337
455 3300026095 Ga0207676_10185323 Ga0207676_101853232 337
456 3300026095 Ga0207676_10204645 Ga0207676_102046452 337
457 3300026116 Ga0207674_10001442 Ga0207674_1000144225 337
458 3300026116 Ga0207674_10022070 Ga0207674_100220704 337
459 3300026118 Ga0207675_100012308 Ga0207675_1000123082 337
460 3300026118 Ga0207675_100018559 Ga0207675_1000185595 337
461 3300026121 Ga0207683_10151428 Ga0207683_101514283 337
462 3300026142 Ga0207698_10108026 Ga0207698_101080262 337
463 3300026142 Ga0207698_10333850 Ga0207698_103338501 337
464 3300028380 Ga0268265_10509362 Ga0268265_105093621 337
465 3300028381 Ga0268264_10017493 Ga0268264_100174932 337
466 3300028381 Ga0268264_10025411 Ga0268264_100254112 337
467 3300028381 Ga0268264_10289314 Ga0268264_102893141 337
468 3300028381 Ga0268264_10467032 Ga0268264_104670322 337
469 3300031548 Ga0307408_100054328 Ga0307408_1000543282 337
470 3300031731 Ga0307405_10004688 Ga0307405_100046884 337
471 3300031731 Ga0307405_10046166 Ga0307405_100461662 337
472 3300031731 Ga0307405_10157566 Ga0307405_101575662 337
473 3300031824 Ga0307413_10038442 Ga0307413_100384422 337
474 3300031852 Ga0307410_10000945 Ga0307410_100009454 337
475 3300031901 Ga0307406_10012120 Ga0307406_100121204 337
476 3300031901 Ga0307406_10084368 Ga0307406_100843682 337
477 3300031903 Ga0307407_10037044 Ga0307407_100370442 337
478 3300031903 Ga0307407_10100275 Ga0307407_101002753 337
479 3300031911 Ga0307412_10013452 Ga0307412_100134523 337
480 3300031995 Ga0307409_100190687 Ga0307409_1001906872 337
481 3300032002 Ga0307416_100038093 Ga0307416_1000380933 337
482 3300032002 Ga0307416_100053786 Ga0307416_1000537863 337
483 3300032004 Ga0307414_10008715 Ga0307414_100087153 337
484 3300032004 Ga0307414_10209706 Ga0307414_102097062 337
485 3300032004 Ga0307414_10268257 Ga0307414_102682572 337
486 3300032004 Ga0307414_10406343 Ga0307414_104063431 337
487 3300032005 Ga0307411_10023811 Ga0307411_100238112 337
488 3300032126 Ga0307415_100010761 Ga0307415_1000107613 337
489 3300035091 Ga0373951_0000847 Ga0373951_0000847_499_1512 337
490 3300035207 Ga0373942_0008763 Ga0373942_0008763_643_1656 337
491 3300037418 Ga0395900_0221646 Ga0395900_0221646_613_1629 337
492 3300037466 Ga0395898_0357169 Ga0395898_0357169_275_1291 337
493 3300038443 Ga0395901_0021025 Ga0395901_0021025_3019_4035 337
494 3300038443 Ga0395901_0497836 Ga0395901_0497836_108_1121 337
495 3300038698 Ga0242419_000245 Ga0242419_000245_745_1758 337
496 3300038699 Ga0242422_00279 Ga0242422_00279_1036_2049 337
497 3300042012 Ga0439455_0018280 Ga0439455_0018280_111_1127 337
498 3300042157 Ga0439458_0017243 Ga0439458_0017243_535_1551 337
499 3300045051 Ga0451576_0121994 Ga0451576_0121994_564_1577 337
500 3300048911 Ga0496108_0164003 Ga0496108_0164003_576_1589 337
501 3300048913 Ga0496110_0269613 Ga0496110_0269613_334_1347 337
502 3300048915 Ga0496112_0340926 Ga0496112_0340926_372_1385 337
503 3300048916 Ga0496113_0041407 Ga0496113_0041407_941_1954 337
504 3300049515 Ga0501292_005513 Ga0501292_005513_183_1199 337
505 3300049519 Ga0501296_004314 Ga0501296_004314_37_1050 337
506 3300049519 Ga0501296_005652 Ga0501296_005652_74_1087 337
507 3300049521 Ga0501298_001573 Ga0501298_001573_51_1067 337
508 3300049521 Ga0501298_004374 Ga0501298_004374_1059_2072 337
509 3300049521 Ga0501298_014414 Ga0501298_014414_105_1118 337
510 3300049574 Ga0501038_0002741 Ga0501038_0002741_7380_8393 337
511 3300049649 Ga0501198_004443 Ga0501198_004443_813_1826 337
512 3300049654 Ga0501207_000437 Ga0501207_000437_2635_3651 337
513 3300049654 Ga0501207_003677 Ga0501207_003677_142_1155 337
514 3300049656 Ga0501209_002306 Ga0501209_002306_1657_2673 337
515 3300049660 Ga0501216_012718 Ga0501216_012718_127_1140 337
516 3300049661 Ga0501217_004071 Ga0501217_004071_1807_2823 337
517 3300049661 Ga0501217_023696 Ga0501217_023696_431_1444 337
518 3300049663 Ga0501223_002346 Ga0501223_002346_733_1746 337
519 3300049663 Ga0501223_002532 Ga0501223_002532_1535_2551 337
520 3300049663 Ga0501223_020319 Ga0501223_020319_206_1219 337
521 3300049664 Ga0501224_000496 Ga0501224_000496_2522_3538 337
522 3300049664 Ga0501224_004648 Ga0501224_004648_779_1792 337
523 3300049664 Ga0501224_014354 Ga0501224_014354_104_1117 337
524 3300049665 Ga0501227_001828 Ga0501227_001828_3541_4557 337
525 3300049667 Ga0501230_005209 Ga0501230_005209_611_1627 337
526 3300049668 Ga0501233_002638 Ga0501233_002638_151_1167 337
527 3300049668 Ga0501233_008953 Ga0501233_008953_880_1893 337
528 3300049669 Ga0501235_001876 Ga0501235_001876_902_1918 337
529 3300049669 Ga0501235_006252 Ga0501235_006252_321_1334 337
530 3300049669 Ga0501235_013659 Ga0501235_013659_116_1132 337
531 3300049673 Ga0501240_000343 Ga0501240_000343_51_1067 337
532 3300049673 Ga0501240_002371 Ga0501240_002371_79_1092 337
533 3300049680 Ga0501250_006956 Ga0501250_006956_163_1176 337
534 3300049682 Ga0501252_005054 Ga0501252_005054_23_1039 337
535 3300049689 Ga0501260_001308 Ga0501260_001308_82_1095 337
536 3300049690 Ga0501261_008523 Ga0501261_008523_289_1302 337
537 3300049704 Ga0501221_006645 Ga0501221_006645_71_1084 337
538 3300049705 Ga0501225_0002593 Ga0501225_0002593_1701_2717 337
539 3300049705 Ga0501225_0008980 Ga0501225_0008980_1034_2050 337
540 3300049705 Ga0501225_0016228 Ga0501225_0016228_348_1361 337
541 3300049707 Ga0501234_001388 Ga0501234_001388_158_1174 337
542 3300049707 Ga0501234_003415 Ga0501234_003415_1140_2156 337
543 3300049707 Ga0501234_010268 Ga0501234_010268_112_1125 337
544 3300049707 Ga0501234_014434 Ga0501234_014434_188_1201 337
545 3300049770 Ga0501273_001706 Ga0501273_001706_10_1023 337
546 3300049775 Ga0501279_001121 Ga0501279_001121_227_1240 337
547 3300049851 Ga0501212_002274 Ga0501212_002274_1258_2271 337
548 3300049853 Ga0501226_000816 Ga0501226_000816_1418_2434 337
549 3300050507 nmdc:mga05p37_129820_c1 nmdc:mga05p37_129820_c1_636_1652 337
550 3300050507 nmdc:mga05p37_492171_c1 nmdc:mga05p37_492171_c1_283_1296 337
551 3300050508 nmdc:mga09592_143184_c1 nmdc:mga09592_143184_c1_448_1461 337
552 3300050510 nmdc:mga06r32_166691_c1 nmdc:mga06r32_166691_c1_928_1941 337
553 3300050511 nmdc:mga08y16_9977_c1 nmdc:mga08y16_9977_c1_7848_8861 337
554 3300050512 nmdc:mga0n895_215741_c1 nmdc:mga0n895_215741_c1_906_1919 337
555 3300050512 nmdc:mga0n895_385826_c1 nmdc:mga0n895_385826_c1_293_1306 337
556 3300050512 nmdc:mga0n895_97249_c1 nmdc:mga0n895_97249_c1_757_1770 337
557 3300050513 nmdc:mga0rr50_129990_c1 nmdc:mga0rr50_129990_c1_113_1126 337
558 3300050515 nmdc:mga0a205_269776_c1 nmdc:mga0a205_269776_c1_451_1467 337
559 3300050515 nmdc:mga0a205_67425_c1 nmdc:mga0a205_67425_c1_1520_2536 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

2

121

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

129

239

0.9

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

133

335

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9425 2 328
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9391 3 328
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9348 3 328
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9214 2 328
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9153 3 328
ID Description Score Start End Superfamily
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9435 1 115 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 3 119 3.40.50.720
af_I1MZG8_3_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9323 1 120 3.40.50.720
af_P77503_5_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.932 2 136 3.40.50.720
3e18A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9313 3 120 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M1P1U7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9747 2 215 GO:0000166
GO:0016491
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9699 1 145 GO:0000166
GO:0003824
AF-A0A2U1FC81-F1-model_v4 Oxidoreductase family protein 0.9614 1 144 GO:0000166
GO:0016798
AF-A0A7C2Z2A1-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9516 2 145 GO:0000166
AF-A0A7J0B2P6-F1-model_v4 deleted 0.9509 52 146

Feature Viewer

pLDDT pTM Quality
90.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map