F463539

General Info

Members Datasets Scaffolds Average Seq Length
559 281 1118 144

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100097332|Ga0070705_1000973322
Length 180
Sequence VRPLSTKLHDDGVGLYPSPPGRQQEIMSLYGTYDDDNVFARILRGELPCHRIYEDEDVLAFLDAFPQAQGHTLIVPKRLRARNLLELPEAAVAPLFLCAKRLMAVLVAELEPVGVQMLQFNGGDGGQSVFHVHVHLVPRWAGQPLGLHGQVAGDPQQLAEVATRLRDRVTVMAPAWGPGQ

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
167 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
180 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
183 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
184 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
185 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
186 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
187 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
188 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
189 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
194 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
268 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
276 2509276019 Ensifer aridi TW10 Isolate Nodule
277 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
278 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
279 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
280 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
281 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0.72
Rhizoplane 2.86
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100097332 3300005440 Bacteria 1849
2 SwRhRL3b_contig_121946 2162886006 Bacteria 976
3 SwRhRL3b_contig_2280204 2162886006 Unclassified 1694
4 SwRhRL2b_contig_2960894 2162886007 Bacteria 18966
5 SwRhRL2b_contig_3176492 2162886007 Bacteria 88382
6 SwRhRL2b_contig_3548226 2162886007 Bacteria 4069
7 JGI24750J21931_1003811 3300002070 Bacteria 1815
8 JGI24748J21848_1004694 3300002074 Bacteria 1572
9 JGI24748J21848_1024294 3300002074 Bacteria 737
10 JGI24034J26672_10011990 3300002239 Bacteria 1303
11 JGI24034J26672_10012730 3300002239 Bacteria 1271
12 JGI24751J29686_10000021 3300002459 Bacteria 104690
13 JGI24751J29686_10030580 3300002459 Unclassified 1117
14 JGI24751J29686_10039656 3300002459 Bacteria 975
15 JGI24751J29686_10087433 3300002459 Unclassified 647
16 JGI25165J46597_1000286 3300003214 Bacteria 64278
17 Ga0065704_10001735 3300005289 Bacteria 6719
18 Ga0065704_10070182 3300005289 Bacteria 120495
19 Ga0065704_10070243 3300005289 Bacteria 50129
20 Ga0065704_10074055 3300005289 Bacteria 6574
21 Ga0065704_10237392 3300005289 Bacteria 1025
22 Ga0065707_10000429 3300005295 Bacteria 96496
23 Ga0065707_10081908 3300005295 Bacteria 29959
24 Ga0065707_10087286 3300005295 Bacteria 5091
25 Ga0065707_10110335 3300005295 Bacteria 2434
26 Ga0065707_10125778 3300005295 Bacteria 2017
27 Ga0065707_10185887 3300005295 Unclassified 1389
28 Ga0065707_10556567 3300005295 Unclassified 717
29 Ga0070658_10065452 3300005327 Bacteria 2966
30 Ga0070676_10516750 3300005328 Bacteria 850
31 Ga0070676_10945459 3300005328 Bacteria 644
32 Ga0070670_100000006 3300005331 Bacteria 319420
33 Ga0070670_100008603 3300005331 Bacteria 8708
34 Ga0070670_100136196 3300005331 Bacteria 2122
35 Ga0070670_100708780 3300005331 Bacteria 905
36 Ga0070670_101130219 3300005331 Bacteria 715
37 Ga0070677_10073662 3300005333 Bacteria 1443
38 Ga0070666_10020904 3300005335 Bacteria 4236
39 Ga0070666_10023715 3300005335 Bacteria 3995
40 Ga0070666_10211113 3300005335 Bacteria 1367
41 Ga0070680_100073276 3300005336 Bacteria 2816
42 Ga0070682_101256036 3300005337 Unclassified 627
43 Ga0068868_102244655 3300005338 Unclassified 520
44 Ga0070660_100416980 3300005339 Bacteria 1111
45 Ga0070660_100586184 3300005339 Bacteria 932
46 Ga0070691_10253996 3300005341 Bacteria 944
47 Ga0070668_100003865 3300005347 Bacteria 11058
48 Ga0070668_100049185 3300005347 Unclassified 3244
49 Ga0070668_100067734 3300005347 Bacteria 2774
50 Ga0070669_100000142 3300005353 Bacteria 64092
51 Ga0070669_100000305 3300005353 Bacteria 38624
52 Ga0070669_100073662 3300005353 Bacteria 2530
53 Ga0070669_100832252 3300005353 Unclassified 786
54 Ga0070671_100001357 3300005355 Bacteria 18338
55 Ga0070671_100086764 3300005355 Bacteria 2619
56 Ga0070674_100007315 3300005356 Bacteria 6506
57 Ga0070659_100612906 3300005366 Bacteria 936
58 Ga0070667_100001490 3300005367 Bacteria 20980
59 Ga0070667_100002768 3300005367 Bacteria 15163
60 Ga0070667_100038261 3300005367 Bacteria 4022
61 Ga0070667_100135983 3300005367 Bacteria 2149
62 Ga0070667_101041785 3300005367 Bacteria 764
63 Ga0070711_100612066 3300005439 Bacteria 910
64 Ga0070705_100161492 3300005440 Bacteria 1498
65 Ga0070708_100006274 3300005445 Bacteria 9457
66 Ga0070678_100506480 3300005456 Bacteria 1066
67 Ga0070662_100057582 3300005457 Bacteria 2824
68 Ga0070681_10221368 3300005458 Bacteria 1808
69 Ga0070681_10351306 3300005458 Unclassified 1385
70 Ga0068867_100037532 3300005459 Bacteria 3522
71 Ga0070685_10610417 3300005466 Bacteria 786
72 Ga0070706_100250021 3300005467 Bacteria 1655
73 Ga0070672_100026177 3300005543 Bacteria 4336
74 Ga0070672_100203977 3300005543 Unclassified 1654
75 Ga0070686_100186333 3300005544 Bacteria 1478
76 Ga0070696_101748099 3300005546 Bacteria 537
77 Ga0070665_100010084 3300005548 Bacteria 9561
78 Ga0070665_100025987 3300005548 Bacteria 5898
79 Ga0070665_100124380 3300005548 Bacteria 2581
80 Ga0070665_100907455 3300005548 Bacteria 894
81 Ga0068855_100017268 3300005563 Bacteria 8685
82 Ga0068855_100104291 3300005563 Bacteria 3262
83 Ga0068855_100447605 3300005563 Bacteria 1410
84 Ga0068855_101074167 3300005563 Bacteria 843
85 Ga0068857_100406822 3300005577 Bacteria 1267
86 Ga0068857_100956301 3300005577 Unclassified 823
87 Ga0068854_100475530 3300005578 Bacteria 1048
88 Ga0068856_101245086 3300005614 Bacteria 760
89 Ga0070702_100088831 3300005615 Bacteria 1869
90 Ga0070702_101264498 3300005615 Bacteria 598
91 Ga0068852_100371037 3300005616 Bacteria 1402
92 Ga0068859_100008174 3300005617 Bacteria 10614
93 Ga0068859_100140506 3300005617 Bacteria 2488
94 Ga0068859_100180300 3300005617 Unclassified 2195
95 Ga0068864_100000014 3300005618 Bacteria 308927
96 Ga0068864_100011628 3300005618 Bacteria 7269
97 Ga0068861_100005563 3300005719 Bacteria 8537
98 Ga0068861_100079594 3300005719 Bacteria 2562
99 Ga0068851_10680403 3300005834 Unclassified 632
100 Ga0068870_10020516 3300005840 Bacteria 3219
101 Ga0068870_10179404 3300005840 Bacteria 1270
102 Ga0068863_100009781 3300005841 Bacteria 9346
103 Ga0068863_100225220 3300005841 Bacteria 1808
104 Ga0068863_102419686 3300005841 Bacteria 535
105 Ga0068858_100000037 3300005842 Bacteria 137966
106 Ga0068858_100121751 3300005842 Bacteria 2440
107 Ga0068860_100001149 3300005843 Bacteria 29035
108 Ga0068860_100025233 3300005843 Bacteria 5736
109 Ga0068860_100025549 3300005843 Bacteria 5698
110 Ga0068862_100000007 3300005844 Bacteria 313933
111 Ga0068862_100000728 3300005844 Bacteria 33304
112 Ga0068862_100002993 3300005844 Bacteria 14736
113 Ga0068862_100016222 3300005844 Bacteria 6198
114 Ga0075364_10101210 3300006051 Bacteria 1918
115 Ga0068871_100428554 3300006358 Bacteria 1182
116 Ga0075428_101236697 3300006844 Bacteria 786
117 Ga0075431_100100053 3300006847 Bacteria 2991
118 Ga0068865_100026691 3300006881 Bacteria 3810
119 Ga0068865_100120811 3300006881 Bacteria 1948
120 Ga0097620_100008174 3300006931 Bacteria 10614
121 Ga0097620_100140518 3300006931 Bacteria 2488
122 Ga0097620_100180300 3300006931 Unclassified 2195
123 Ga0105251_10002008 3300009011 Bacteria 16531
124 Ga0105251_10190938 3300009011 Bacteria 923
125 Ga0105250_10001628 3300009092 Bacteria 12004
126 Ga0105240_10011909 3300009093 Bacteria 12064
127 Ga0105240_10035277 3300009093 Bacteria 6447
128 Ga0105240_11177298 3300009093 Bacteria 813
129 Ga0105247_10000444 3300009101 Bacteria 35009
130 Ga0105247_10036659 3300009101 Bacteria 2989
131 Ga0105247_10085674 3300009101 Bacteria 1993
132 Ga0105243_10114846 3300009148 Bacteria 2260
133 Ga0105241_10080469 3300009174 Bacteria 2550
134 Ga0105241_10274394 3300009174 Bacteria 1438
135 Ga0105248_10000139 3300009177 Bacteria 84082
136 Ga0105248_10003016 3300009177 Bacteria 18673
137 Ga0105248_10015427 3300009177 Bacteria 8422
138 Ga0105248_10064494 3300009177 Bacteria 4113
139 Ga0105248_12268007 3300009177 Unclassified 618
140 Ga0105237_10188250 3300009545 Bacteria 2064
141 Ga0105237_10494977 3300009545 Bacteria 1229
142 Ga0105238_10095459 3300009551 Bacteria 2960
143 Ga0105238_10434803 3300009551 Bacteria 1308
144 Ga0105238_10782795 3300009551 Bacteria 969
145 Ga0105249_10025631 3300009553 Bacteria 5311
146 Ga0105249_10027933 3300009553 Bacteria 5092
147 Ga0105249_10141464 3300009553 Bacteria 2308
148 Ga0105249_10986042 3300009553 Bacteria 911
149 Ga0105148_100004 3300009978 Bacteria 47832
150 Ga0105239_10076331 3300010375 Bacteria 3685
151 Ga0105239_10104928 3300010375 Bacteria 3129
152 Ga0105239_10146980 3300010375 Bacteria 2630
153 Ga0105239_11528378 3300010375 Unclassified 771
154 Ga0157370_10386976 3300013104 Bacteria 1288
155 Ga0157369_10054636 3300013105 Bacteria 4312
156 Ga0163162_10000562 3300013306 Bacteria 34275
157 Ga0163162_10038161 3300013306 Bacteria 4794
158 Ga0163162_10097143 3300013306 Bacteria 3034
159 Ga0163162_10631382 3300013306 Bacteria 1196
160 Ga0163162_12398994 3300013306 Unclassified 606
161 Ga0157375_10343247 3300013308 Bacteria 1658
162 Ga0163163_10025754 3300014325 Bacteria 5611
163 Ga0163163_10046224 3300014325 Bacteria 4276
164 Ga0163163_10106852 3300014325 Bacteria 2825
165 Ga0157380_10000014 3300014326 Bacteria 130737
166 Ga0157380_10000090 3300014326 Bacteria 49394
167 Ga0157380_10021050 3300014326 Bacteria 4886
168 Ga0157380_10054565 3300014326 Bacteria 3171
169 Ga0157379_10023914 3300014968 Bacteria 5423
170 Ga0157379_10174165 3300014968 Bacteria 1942
171 Ga0163161_10129868 3300017792 Bacteria 1900
172 Ga0213876_10018486 3300021384 Bacteria 3681
173 Ga0209233_1000013 3300025261 Bacteria 1013785
174 Ga0209455_1009164 3300025272 Bacteria 2620
175 Ga0207673_1006199 3300025290 Bacteria 1474
176 Ga0207697_10009182 3300025315 Bacteria 4279
177 Ga0207696_1000958 3300025711 Bacteria 17589
178 Ga0207713_1000985 3300025735 Bacteria 25046
179 Ga0207713_1017238 3300025735 Bacteria 3631
180 Ga0207710_10000902 3300025900 Bacteria 15883
181 Ga0207680_10022797 3300025903 Unclassified 3410
182 Ga0207680_10032994 3300025903 Bacteria 2949
183 Ga0207680_10319484 3300025903 Bacteria 1085
184 Ga0207680_10864667 3300025903 Bacteria 648
185 Ga0207645_10018207 3300025907 Bacteria 4627
186 Ga0207643_10027319 3300025908 Bacteria 3163
187 Ga0207643_10157749 3300025908 Bacteria 1364
188 Ga0207654_10800603 3300025911 Bacteria 681
189 Ga0207707_10669662 3300025912 Bacteria 873
190 Ga0207695_10007174 3300025913 Bacteria 14258
191 Ga0207695_10011239 3300025913 Bacteria 10855
192 Ga0207695_10058556 3300025913 Bacteria 3998
193 Ga0207695_11001890 3300025913 Bacteria 715
194 Ga0207671_10109266 3300025914 Bacteria 2102
195 Ga0207671_10814820 3300025914 Bacteria 740
196 Ga0207663_10246248 3300025916 Bacteria 1313
197 Ga0207660_10593287 3300025917 Bacteria 902
198 Ga0207657_10030665 3300025919 Bacteria 4878
199 Ga0207657_10789880 3300025919 Bacteria 734
200 Ga0207681_10000001 3300025923 Bacteria 1105841
201 Ga0207681_10000229 3300025923 Bacteria 44082
202 Ga0207681_10031286 3300025923 Unclassified 3475
203 Ga0207681_10786824 3300025923 Unclassified 794
204 Ga0207694_10041115 3300025924 Bacteria 3562
205 Ga0207694_10056647 3300025924 Bacteria 3045
206 Ga0207650_10000023 3300025925 Bacteria 308148
207 Ga0207650_10000353 3300025925 Bacteria 44269
208 Ga0207644_10005087 3300025931 Bacteria 8587
209 Ga0207644_10020343 3300025931 Bacteria 4513
210 Ga0207690_10303487 3300025932 Bacteria 1250
211 Ga0207690_10979383 3300025932 Bacteria 703
212 Ga0207706_10034576 3300025933 Bacteria 4496
213 Ga0207669_10322115 3300025937 Bacteria 1183
214 Ga0207704_10266551 3300025938 Bacteria 1294
215 Ga0207691_10000307 3300025940 Bacteria 48698
216 Ga0207691_10214526 3300025940 Unclassified 1671
217 Ga0207711_10000646 3300025941 Bacteria 34791
218 Ga0207711_10040703 3300025941 Bacteria 3954
219 Ga0207711_10067497 3300025941 Bacteria 3096
220 Ga0207711_10074336 3300025941 Bacteria 2955
221 Ga0207711_10230613 3300025941 Bacteria 1696
222 Ga0207667_10032939 3300025949 Bacteria 5578
223 Ga0207667_10033289 3300025949 Bacteria 5543
224 Ga0207667_10308661 3300025949 Bacteria 1616
225 Ga0207712_10000186 3300025961 Bacteria 64235
226 Ga0207712_10025601 3300025961 Bacteria 3922
227 Ga0207712_10116506 3300025961 Bacteria 2013
228 Ga0207668_10001050 3300025972 Bacteria 16465
229 Ga0207668_10012445 3300025972 Bacteria 5208
230 Ga0207668_10499395 3300025972 Unclassified 1046
231 Ga0207640_10440301 3300025981 Bacteria 1071
232 Ga0207658_10001241 3300025986 Bacteria 20160
233 Ga0207658_10004125 3300025986 Bacteria 10134
234 Ga0207658_10027018 3300025986 Bacteria 4029
235 Ga0207658_10762902 3300025986 Bacteria 876
236 Ga0207658_10935084 3300025986 Bacteria 790
237 Ga0207703_10000228 3300026035 Bacteria 64483
238 Ga0207703_10008486 3300026035 Bacteria 8118
239 Ga0207703_10332099 3300026035 Bacteria 1395
240 Ga0207708_10172443 3300026075 Bacteria 1714
241 Ga0207702_10699417 3300026078 Bacteria 999
242 Ga0207641_10155791 3300026088 Bacteria 2072
243 Ga0207641_10855781 3300026088 Bacteria 901
244 Ga0207648_10002642 3300026089 Bacteria 19142
245 Ga0207648_10479577 3300026089 Bacteria 1136
246 Ga0207676_10000017 3300026095 Bacteria 308709
247 Ga0207676_10002454 3300026095 Bacteria 13224
248 Ga0207674_10412908 3300026116 Bacteria 1304
249 Ga0207675_100000707 3300026118 Bacteria 33068
250 Ga0207675_100001848 3300026118 Bacteria 21253
251 Ga0207683_10255017 3300026121 Bacteria 1601
252 Ga0209973_1006204 3300027252 Bacteria 1297
253 Ga0209967_1013322 3300027364 Bacteria 1166
254 Ga0209996_1007982 3300027395 Bacteria 1383
255 Ga0210000_1005717 3300027462 Bacteria 1807
256 Ga0210000_1033077 3300027462 Bacteria 812
257 Ga0209968_1007913 3300027526 Bacteria 1615
258 Ga0209982_1003042 3300027552 Bacteria 2373
259 Ga0209970_1025088 3300027614 Bacteria 1021
260 Ga0210002_1001941 3300027617 Bacteria 2967
261 Ga0209983_1005582 3300027665 Bacteria 2596
262 Ga0209983_1086709 3300027665 Bacteria 704
263 Ga0209971_1000728 3300027682 Bacteria 8501
264 Ga0209966_1005276 3300027695 Bacteria 2217
265 Ga0209966_1022486 3300027695 Bacteria 1233
266 Ga0209998_10000548 3300027717 Bacteria 10147
267 Ga0209998_10093563 3300027717 Bacteria 739
268 Ga0209974_10001992 3300027876 Bacteria 7445
269 Ga0209974_10014835 3300027876 Bacteria 2587
270 Ga0207428_10141042 3300027907 Bacteria 1839
271 Ga0268266_10007786 3300028379 Bacteria 9606
272 Ga0268266_10020596 3300028379 Bacteria 5619
273 Ga0268266_10204358 3300028379 Bacteria 1809
274 Ga0268266_10432689 3300028379 Unclassified 1248
275 Ga0268265_10000002 3300028380 Bacteria 1035381
276 Ga0268265_10000370 3300028380 Bacteria 48735
277 Ga0268265_10008501 3300028380 Bacteria 6938
278 Ga0268265_10024661 3300028380 Unclassified 4258
279 Ga0268265_10032838 3300028380 Bacteria 3766
280 Ga0268265_10114279 3300028380 Bacteria 2210
281 Ga0268264_10000397 3300028381 Bacteria 62284
282 Ga0268264_10015326 3300028381 Bacteria 6285
283 Ga0268264_10018198 3300028381 Bacteria 5746
284 Ga0265318_10008251 3300028577 Bacteria 4648
285 Ga0265338_10029309 3300028800 Bacteria 5457
286 Ga0265338_10166985 3300028800 Bacteria 1693
287 Ga0265330_10032148 3300031235 Bacteria 2351
288 Ga0265330_10089961 3300031235 Bacteria 1318
289 Ga0265332_10102032 3300031238 Bacteria 1210
290 Ga0265332_10260926 3300031238 Bacteria 716
291 Ga0265328_10044204 3300031239 Bacteria 1638
292 Ga0265328_10082554 3300031239 Bacteria 1185
293 Ga0265320_10459682 3300031240 Bacteria 562
294 Ga0265325_10044717 3300031241 Bacteria 2305
295 Ga0265325_10048132 3300031241 Bacteria 2205
296 Ga0265325_10092655 3300031241 Bacteria 1488
297 Ga0265325_10129035 3300031241 Bacteria 1212
298 Ga0265340_10000059 3300031247 Bacteria 50238
299 Ga0265340_10013560 3300031247 Bacteria 4278
300 Ga0265339_10030198 3300031249 Bacteria 3070
301 Ga0265339_10053659 3300031249 Bacteria 2192
302 Ga0265339_10252247 3300031249 Bacteria 853
303 Ga0265339_10391063 3300031249 Bacteria 651
304 Ga0265339_10466892 3300031249 Bacteria 585
305 Ga0265331_10016153 3300031250 Bacteria 3925
306 Ga0265331_10058785 3300031250 Bacteria 1819
307 Ga0265331_10294933 3300031250 Bacteria 726
308 Ga0265316_10011082 3300031344 Bacteria 8166
309 Ga0265316_10081375 3300031344 Bacteria 2482
310 Ga0265316_10452001 3300031344 Bacteria 921
311 Ga0265316_10574252 3300031344 Bacteria 801
312 Ga0265313_10002218 3300031595 Bacteria 17114
313 Ga0265313_10008536 3300031595 Bacteria 6791
314 Ga0265313_10037011 3300031595 Bacteria 2445
315 Ga0265313_10072744 3300031595 Bacteria 1579
316 Ga0265314_10074946 3300031711 Bacteria 2252
317 Ga0265314_10092672 3300031711 Bacteria 1963
318 Ga0265314_10244543 3300031711 Bacteria 1033
319 Ga0265314_10277301 3300031711 Bacteria 950
320 Ga0265314_10314989 3300031711 Bacteria 872
321 Ga0265342_10022373 3300031712 Bacteria 4019
322 Ga0316576_10029457 3300031727 Unclassified 3881
323 Ga0316578_10838414 3300031728 Unclassified 532
324 Ga0307405_10059175 3300031731 Bacteria 2414
325 Ga0316577_10023802 3300031733 Bacteria 3400
326 Ga0307413_10069845 3300031824 Bacteria 2206
327 Ga0307413_10131798 3300031824 Bacteria 1712
328 Ga0307413_10197393 3300031824 Bacteria 1450
329 Ga0307410_10177040 3300031852 Bacteria 1612
330 Ga0307406_10325174 3300031901 Bacteria 1191
331 Ga0307407_10943985 3300031903 Bacteria 664
332 Ga0307412_10734869 3300031911 Bacteria 850
333 Ga0307409_100046599 3300031995 Bacteria 3283
334 Ga0307409_100111461 3300031995 Bacteria 2295
335 Ga0307416_100080503 3300032002 Bacteria 2750
336 Ga0307416_100750949 3300032002 Bacteria 1068
337 Ga0307411_10038720 3300032005 Bacteria 3010
338 Ga0307411_10055343 3300032005 Bacteria 2609
339 Ga0307411_10194081 3300032005 Bacteria 1553
340 Ga0307411_11410094 3300032005 Bacteria 638
341 Ga0307415_100020213 3300032126 Bacteria 4061
342 Ga0307415_100190607 3300032126 Bacteria 1617
343 Ga0373950_0046372 3300034818 Bacteria 844
344 Ga0316582_0861036 3300036647 Unclassified 620
345 Ga0316584_0067576 3300036712 Bacteria 2679
346 Ga0400483_131903 3300039062 Bacteria 2363
347 Ga0436365_1557676 3300039437 Bacteria 11789
348 Ga0436363_1221608 3300039450 Bacteria 725
349 Ga0439447_071968 3300041407 Bacteria 803
350 Ga0439461_0062037 3300041410 Bacteria 851
351 Ga0439461_0152597 3300041410 Bacteria 597
352 Ga0439431_0276314 3300041997 Bacteria 502
353 Ga0439441_026735 3300042001 Bacteria 1097
354 Ga0439443_009914 3300042003 Bacteria 1375
355 Ga0439445_0135503 3300042004 Bacteria 712
356 Ga0439432_151907 3300042006 Bacteria 679
357 Ga0439451_017613 3300042009 Bacteria 1441
358 Ga0439456_020647 3300042013 Bacteria 1390
359 Ga0439462_0025633 3300042015 Bacteria 1553
360 Ga0439462_0066199 3300042015 Bacteria 979
361 Ga0450920_024073 3300042122 Bacteria 1182
362 Ga0450922_001526 3300042124 Bacteria 2269
363 Ga0450923_002616 3300042125 Bacteria 2609
364 Ga0450923_003995 3300042125 Bacteria 2280
365 Ga0450894_020513 3300042131 Bacteria 891
366 Ga0450896_003110 3300042133 Bacteria 2184
367 Ga0450896_009899 3300042133 Bacteria 1333
368 Ga0450898_018133 3300042134 Bacteria 1216
369 Ga0450906_050961 3300042145 Bacteria 731
370 Ga0450910_053558 3300042147 Bacteria 670
371 Ga0439446_0001353 3300042156 Bacteria 5532
372 Ga0439446_0026149 3300042156 Bacteria 1671
373 Ga0450908_007475 3300042184 Bacteria 2060
374 Ga0439434_0018104 3300042435 Bacteria 2107
375 Ga0439434_0206608 3300042435 Bacteria 663
376 Ga0439435_0001811 3300042436 Bacteria 4076
377 Ga0439435_0006151 3300042436 Bacteria 2685
378 Ga0439444_0003905 3300042437 Bacteria 2132
379 Ga0439444_0005461 3300042437 Bacteria 1885
380 Ga0439460_0066327 3300042461 Bacteria 1110
381 Ga0450893_0017070 3300042532 Bacteria 1232
382 Ga0450893_0022221 3300042532 Bacteria 1099
383 Ga0451577_0006530 3300042876 Bacteria 11602
384 Ga0451577_0047389 3300042876 Bacteria 3843
385 Ga0451577_1743117 3300042876 Bacteria 547
386 Ga0453683_0055721 3300044673 Bacteria 2474
387 Ga0466963_0024510 3300044694 Bacteria 3841
388 Ga0466963_0851775 3300044694 Bacteria 643
389 Ga0453684_0044982 3300044712 Bacteria 5895
390 Ga0453684_0142370 3300044712 Bacteria 2861
391 Ga0453684_0650865 3300044712 Bacteria 1150
392 Ga0466959_0134745 3300045049 Bacteria 1749
393 Ga0451576_0006005 3300045051 Bacteria 15016
394 Ga0451576_0183206 3300045051 Bacteria 2186
395 Ga0466958_0027374 3300045836 Bacteria 3375
396 Ga0466958_0031270 3300045836 Bacteria 3163
397 Ga0466967_0016669 3300045976 Bacteria 5802
398 Ga0495616_0179665 3300046513 Bacteria 941
399 Ga0495642_0243306 3300046528 Bacteria 786
400 Ga0495625_0830795 3300046660 Bacteria 535
401 Ga0496100_0005098 3300048903 Bacteria 7035
402 Ga0496102_0000790 3300048905 Bacteria 30777
403 Ga0496102_1742609 3300048905 Unclassified 540
404 Ga0496103_0001463 3300048906 Bacteria 15819
405 Ga0496104_0001292 3300048907 Bacteria 21588
406 Ga0496105_0000099 3300048908 Bacteria 59095
407 Ga0496106_0178083 3300048909 Bacteria 1687
408 Ga0496107_0278957 3300048910 Bacteria 1244
409 Ga0496108_0967695 3300048911 Bacteria 728
410 Ga0496110_0025641 3300048913 Bacteria 5041
411 Ga0496110_0343833 3300048913 Bacteria 1359
412 Ga0496111_0118557 3300048914 Bacteria 1954
413 Ga0496112_0102432 3300048915 Bacteria 2833
414 Ga0496113_0012342 3300048916 Bacteria 5740
415 Ga0496114_1765955 3300048917 Bacteria 507
416 Ga0496115_0360190 3300048918 Bacteria 1185
417 Ga0496116_0022270 3300048919 Bacteria 4753
418 Ga0496116_0113050 3300048919 Bacteria 1590
419 Ga0496117_0000739 3300048920 Bacteria 51387
420 Ga0496117_0013651 3300048920 Bacteria 7068
421 Ga0496118_0000778 3300048921 Bacteria 51108
422 Ga0496118_0000862 3300048921 Bacteria 48139
423 Ga0496118_0153775 3300048921 Unclassified 1435
424 Ga0496119_0002550 3300048922 Bacteria 19834
425 Ga0496119_0005771 3300048922 Bacteria 11725
426 Ga0496120_0002075 3300048923 Bacteria 21531
427 Ga0496121_0000058 3300048924 Bacteria 281335
428 Ga0496121_0010844 3300048924 Bacteria 10193
429 Ga0496121_0059944 3300048924 Bacteria 3135
430 Ga0496121_0775749 3300048924 Bacteria 567
431 Ga0496122_0002786 3300048925 Bacteria 24036
432 Ga0496122_0033512 3300048925 Bacteria 4222
433 Ga0496122_0041881 3300048925 Bacteria 3612
434 Ga0496122_0304798 3300048925 Bacteria 857
435 Ga0496123_0000332 3300048926 Bacteria 89657
436 Ga0496123_0021192 3300048926 Bacteria 5058
437 Ga0496124_0000007 3300048927 Bacteria 883534
438 Ga0496124_0011178 3300048927 Bacteria 9001
439 Ga0496124_0021629 3300048927 Bacteria 5925
440 Ga0496126_0000934 3300048929 Bacteria 50431
441 Ga0501031_0020308 3300049568 Bacteria 4331
442 Ga0501031_0049493 3300049568 Bacteria 2739
443 Ga0501032_0007111 3300049569 Bacteria 8195
444 Ga0501032_0026094 3300049569 Bacteria 4024
445 Ga0501032_1011637 3300049569 Bacteria 522
446 Ga0501033_0064066 3300049570 Bacteria 2705
447 Ga0501033_0064293 3300049570 Bacteria 2700
448 Ga0501033_0066586 3300049570 Bacteria 2649
449 Ga0501033_0298082 3300049570 Bacteria 1135
450 Ga0501033_0404197 3300049570 Bacteria 952
451 Ga0501034_0024429 3300049571 Bacteria 6148
452 Ga0501034_0036972 3300049571 Bacteria 4944
453 Ga0501034_0661421 3300049571 Bacteria 946
454 Ga0501036_0008585 3300049572 Bacteria 8381
455 Ga0501036_0066925 3300049572 Bacteria 3039
456 Ga0501036_0281150 3300049572 Bacteria 1393
457 Ga0501036_0829462 3300049572 Bacteria 761
458 Ga0501037_0441392 3300049573 Bacteria 889
459 Ga0501037_0689751 3300049573 Bacteria 680
460 Ga0501038_0042445 3300049574 Bacteria 3961
461 Ga0501038_0176540 3300049574 Bacteria 1726
462 Ga0501038_0496808 3300049574 Bacteria 933
463 Ga0501038_0510674 3300049574 Bacteria 918
464 Ga0501039_0001358 3300049575 Bacteria 17934
465 Ga0501039_0038626 3300049575 Bacteria 3686
466 Ga0501039_0381175 3300049575 Bacteria 1108
467 Ga0501040_0017408 3300049576 Bacteria 4770
468 Ga0501040_0230358 3300049576 Bacteria 1319
469 Ga0501040_0672070 3300049576 Bacteria 749
470 Ga0501041_0018599 3300049577 Bacteria 4138
471 Ga0501042_0004839 3300049578 Bacteria 8607
472 Ga0501042_0027392 3300049578 Bacteria 4007
473 Ga0501042_0244353 3300049578 Bacteria 1295
474 Ga0501043_0625805 3300049579 Bacteria 793
475 Ga0501046_0138472 3300049580 Bacteria 1843
476 Ga0501046_0332430 3300049580 Bacteria 1105
477 Ga0501047_0024527 3300049581 Bacteria 5788
478 Ga0501047_0105436 3300049581 Bacteria 2699
479 Ga0501047_0485225 3300049581 Bacteria 1063
480 Ga0501047_0988148 3300049581 Bacteria 655
481 Ga0501048_0002580 3300049582 Bacteria 13862
482 Ga0501048_0044131 3300049582 Bacteria 3189
483 Ga0501048_0608213 3300049582 Bacteria 785
484 Ga0501067_0001589 3300049583 Bacteria 12437
485 Ga0501068_0011937 3300049584 Bacteria 4913
486 Ga0501068_0175070 3300049584 Bacteria 1355
487 Ga0501069_0033378 3300049585 Bacteria 2835
488 Ga0501069_0060165 3300049585 Bacteria 2120
489 Ga0501069_0465682 3300049585 Bacteria 752
490 Ga0501070_0037876 3300049586 Bacteria 4024
491 Ga0501070_0205659 3300049586 Bacteria 1616
492 Ga0501071_0000921 3300049587 Bacteria 15921
493 Ga0501071_0107213 3300049587 Bacteria 2063
494 Ga0501071_0267540 3300049587 Bacteria 1292
495 Ga0501071_0348074 3300049587 Bacteria 1127
496 Ga0501072_0057107 3300049588 Bacteria 3076
497 Ga0501072_0109369 3300049588 Bacteria 2200
498 Ga0501072_0135353 3300049588 Bacteria 1964
499 Ga0501073_0458758 3300049589 Bacteria 881
500 Ga0501073_0772950 3300049589 Bacteria 662
501 Ga0501074_0011061 3300049590 Bacteria 6551
502 Ga0501074_0034726 3300049590 Bacteria 3655
503 Ga0501074_0384238 3300049590 Bacteria 996
504 Ga0501075_0049788 3300049591 Bacteria 3149
505 Ga0501075_0169150 3300049591 Bacteria 1667
506 Ga0501075_0255105 3300049591 Bacteria 1337
507 Ga0501076_0004872 3300049592 Bacteria 9594
508 Ga0501076_0090848 3300049592 Bacteria 2456
509 Ga0501077_0341655 3300049593 Bacteria 955
510 Ga0501079_0140004 3300049741 Bacteria 1885
511 Ga0501080_0035208 3300049742 Bacteria 4673
512 Ga0501080_0313319 3300049742 Bacteria 1422
513 Ga0501080_0534616 3300049742 Bacteria 1045
514 Ga0501081_0014892 3300049743 Bacteria 5130
515 Ga0501081_0047536 3300049743 Bacteria 2952
516 Ga0501081_0102993 3300049743 Bacteria 2019
517 Ga0501083_0122220 3300049744 Bacteria 1708
518 Ga0501083_0123618 3300049744 Bacteria 1697
519 Ga0501035_0003558 3300049822 Bacteria 14881
520 Ga0501035_0021128 3300049822 Bacteria 5983
521 Ga0501035_0029460 3300049822 Bacteria 5006
522 Ga0501035_0062838 3300049822 Bacteria 3303
523 Ga0501035_0074932 3300049822 Bacteria 2993
524 Ga0501035_0110123 3300049822 Bacteria 2413
525 Ga0501035_0567151 3300049822 Bacteria 928
526 Ga0501044_0012537 3300049823 Bacteria 9182
527 Ga0501044_0016340 3300049823 Bacteria 7968
528 Ga0501044_0135187 3300049823 Bacteria 2457
529 Ga0501044_0189506 3300049823 Bacteria 2020
530 Ga0501044_1097480 3300049823 Bacteria 665
531 Ga0501045_0102718 3300049824 Bacteria 2116
532 Ga0501045_0103879 3300049824 Bacteria 2104
533 Ga0501045_0135176 3300049824 Bacteria 1833
534 nmdc:mga00v17_71268_c1 3300050491 Bacteria 1261
535 nmdc:mga08y16_1186369_c1 3300050511 Bacteria 735
536 Ga0500562_060075 3300053108 Bacteria 1021
537 Ga0500607_018781 3300053121 Bacteria 3923
538 Ga0500636_0000716 3300053177 Bacteria 17826
539 Ga0500637_0098954 3300053178 Bacteria 1691
540 Ga0500625_025128 3300053729 Bacteria 2816
541 Ga0501084_0012232 3300054114 Bacteria 7104
542 Ga0501084_0036099 3300054114 Bacteria 4130
543 Ga0501084_1052648 3300054114 Bacteria 683
544 Ga0501082_0009438 3300060353 Bacteria 8398
545 Ga0501082_0102395 3300060353 Bacteria 2477
546 Ga0501082_0207447 3300060353 Bacteria 1705
547 Ga0501082_0294358 3300060353 Bacteria 1413
548 Ga0501082_0310757 3300060353 Bacteria 1373
549 Ga0501082_0770351 3300060353 Bacteria 842
550 Ga0530510_0036229 3300061734 Bacteria 3556
551 Ga0530510_0081010 3300061734 Bacteria 2363
552 Ga0530510_0161024 3300061734 Bacteria 1660
553 2509107835 2508501122 Bacteria 6292184
554 2509376232 2509276019 Bacteria 6802256
555 2558863100 2558860100 Bacteria 8458965
556 2792642629 2791355094 Bacteria 7011481
557 2850080828 2850079185 Bacteria 6848280
558 2857544343 2857542790 Bacteria 5326616
559 2919712595 2919709256 Bacteria 4318106
560 Ga0070705_100097332
561 SwRhRL3b_contig_121946
562 SwRhRL3b_contig_2280204
563 SwRhRL2b_contig_2960894
564 SwRhRL2b_contig_3176492
565 SwRhRL2b_contig_3548226
566 JGI24750J21931_1003811
567 JGI24748J21848_1004694
568 JGI24748J21848_1024294
569 JGI24034J26672_10011990
570 JGI24034J26672_10012730
571 JGI24751J29686_10000021
572 JGI24751J29686_10030580
573 JGI24751J29686_10039656
574 JGI24751J29686_10087433
575 JGI25165J46597_1000286
576 Ga0065704_10001735
577 Ga0065704_10070182
578 Ga0065704_10070243
579 Ga0065704_10074055
580 Ga0065704_10237392
581 Ga0065707_10000429
582 Ga0065707_10081908
583 Ga0065707_10087286
584 Ga0065707_10110335
585 Ga0065707_10125778
586 Ga0065707_10185887
587 Ga0065707_10556567
588 Ga0070658_10065452
589 Ga0070676_10516750
590 Ga0070676_10945459
591 Ga0070670_100000006
592 Ga0070670_100008603
593 Ga0070670_100136196
594 Ga0070670_100708780
595 Ga0070670_101130219
596 Ga0070677_10073662
597 Ga0070666_10020904
598 Ga0070666_10023715
599 Ga0070666_10211113
600 Ga0070680_100073276
601 Ga0070682_101256036
602 Ga0068868_102244655
603 Ga0070660_100416980
604 Ga0070660_100586184
605 Ga0070691_10253996
606 Ga0070668_100003865
607 Ga0070668_100049185
608 Ga0070668_100067734
609 Ga0070669_100000142
610 Ga0070669_100000305
611 Ga0070669_100073662
612 Ga0070669_100832252
613 Ga0070671_100001357
614 Ga0070671_100086764
615 Ga0070674_100007315
616 Ga0070659_100612906
617 Ga0070667_100001490
618 Ga0070667_100002768
619 Ga0070667_100038261
620 Ga0070667_100135983
621 Ga0070667_101041785
622 Ga0070711_100612066
623 Ga0070705_100161492
624 Ga0070708_100006274
625 Ga0070678_100506480
626 Ga0070662_100057582
627 Ga0070681_10221368
628 Ga0070681_10351306
629 Ga0068867_100037532
630 Ga0070685_10610417
631 Ga0070706_100250021
632 Ga0070672_100026177
633 Ga0070672_100203977
634 Ga0070686_100186333
635 Ga0070696_101748099
636 Ga0070665_100010084
637 Ga0070665_100025987
638 Ga0070665_100124380
639 Ga0070665_100907455
640 Ga0068855_100017268
641 Ga0068855_100104291
642 Ga0068855_100447605
643 Ga0068855_101074167
644 Ga0068857_100406822
645 Ga0068857_100956301
646 Ga0068854_100475530
647 Ga0068856_101245086
648 Ga0070702_100088831
649 Ga0070702_101264498
650 Ga0068852_100371037
651 Ga0068859_100008174
652 Ga0068859_100140506
653 Ga0068859_100180300
654 Ga0068864_100000014
655 Ga0068864_100011628
656 Ga0068861_100005563
657 Ga0068861_100079594
658 Ga0068851_10680403
659 Ga0068870_10020516
660 Ga0068870_10179404
661 Ga0068863_100009781
662 Ga0068863_100225220
663 Ga0068863_102419686
664 Ga0068858_100000037
665 Ga0068858_100121751
666 Ga0068860_100001149
667 Ga0068860_100025233
668 Ga0068860_100025549
669 Ga0068862_100000007
670 Ga0068862_100000728
671 Ga0068862_100002993
672 Ga0068862_100016222
673 Ga0075364_10101210
674 Ga0068871_100428554
675 Ga0075428_101236697
676 Ga0075431_100100053
677 Ga0068865_100026691
678 Ga0068865_100120811
679 Ga0097620_100008174
680 Ga0097620_100140518
681 Ga0097620_100180300
682 Ga0105251_10002008
683 Ga0105251_10190938
684 Ga0105250_10001628
685 Ga0105240_10011909
686 Ga0105240_10035277
687 Ga0105240_11177298
688 Ga0105247_10000444
689 Ga0105247_10036659
690 Ga0105247_10085674
691 Ga0105243_10114846
692 Ga0105241_10080469
693 Ga0105241_10274394
694 Ga0105248_10000139
695 Ga0105248_10003016
696 Ga0105248_10015427
697 Ga0105248_10064494
698 Ga0105248_12268007
699 Ga0105237_10188250
700 Ga0105237_10494977
701 Ga0105238_10095459
702 Ga0105238_10434803
703 Ga0105238_10782795
704 Ga0105249_10025631
705 Ga0105249_10027933
706 Ga0105249_10141464
707 Ga0105249_10986042
708 Ga0105148_100004
709 Ga0105239_10076331
710 Ga0105239_10104928
711 Ga0105239_10146980
712 Ga0105239_11528378
713 Ga0157370_10386976
714 Ga0157369_10054636
715 Ga0163162_10000562
716 Ga0163162_10038161
717 Ga0163162_10097143
718 Ga0163162_10631382
719 Ga0163162_12398994
720 Ga0157375_10343247
721 Ga0163163_10025754
722 Ga0163163_10046224
723 Ga0163163_10106852
724 Ga0157380_10000014
725 Ga0157380_10000090
726 Ga0157380_10021050
727 Ga0157380_10054565
728 Ga0157379_10023914
729 Ga0157379_10174165
730 Ga0163161_10129868
731 Ga0213876_10018486
732 Ga0209233_1000013
733 Ga0209455_1009164
734 Ga0207673_1006199
735 Ga0207697_10009182
736 Ga0207696_1000958
737 Ga0207713_1000985
738 Ga0207713_1017238
739 Ga0207710_10000902
740 Ga0207680_10022797
741 Ga0207680_10032994
742 Ga0207680_10319484
743 Ga0207680_10864667
744 Ga0207645_10018207
745 Ga0207643_10027319
746 Ga0207643_10157749
747 Ga0207654_10800603
748 Ga0207707_10669662
749 Ga0207695_10007174
750 Ga0207695_10011239
751 Ga0207695_10058556
752 Ga0207695_11001890
753 Ga0207671_10109266
754 Ga0207671_10814820
755 Ga0207663_10246248
756 Ga0207660_10593287
757 Ga0207657_10030665
758 Ga0207657_10789880
759 Ga0207681_10000001
760 Ga0207681_10000229
761 Ga0207681_10031286
762 Ga0207681_10786824
763 Ga0207694_10041115
764 Ga0207694_10056647
765 Ga0207650_10000023
766 Ga0207650_10000353
767 Ga0207644_10005087
768 Ga0207644_10020343
769 Ga0207690_10303487
770 Ga0207690_10979383
771 Ga0207706_10034576
772 Ga0207669_10322115
773 Ga0207704_10266551
774 Ga0207691_10000307
775 Ga0207691_10214526
776 Ga0207711_10000646
777 Ga0207711_10040703
778 Ga0207711_10067497
779 Ga0207711_10074336
780 Ga0207711_10230613
781 Ga0207667_10032939
782 Ga0207667_10033289
783 Ga0207667_10308661
784 Ga0207712_10000186
785 Ga0207712_10025601
786 Ga0207712_10116506
787 Ga0207668_10001050
788 Ga0207668_10012445
789 Ga0207668_10499395
790 Ga0207640_10440301
791 Ga0207658_10001241
792 Ga0207658_10004125
793 Ga0207658_10027018
794 Ga0207658_10762902
795 Ga0207658_10935084
796 Ga0207703_10000228
797 Ga0207703_10008486
798 Ga0207703_10332099
799 Ga0207708_10172443
800 Ga0207702_10699417
801 Ga0207641_10155791
802 Ga0207641_10855781
803 Ga0207648_10002642
804 Ga0207648_10479577
805 Ga0207676_10000017
806 Ga0207676_10002454
807 Ga0207674_10412908
808 Ga0207675_100000707
809 Ga0207675_100001848
810 Ga0207683_10255017
811 Ga0209973_1006204
812 Ga0209967_1013322
813 Ga0209996_1007982
814 Ga0210000_1005717
815 Ga0210000_1033077
816 Ga0209968_1007913
817 Ga0209982_1003042
818 Ga0209970_1025088
819 Ga0210002_1001941
820 Ga0209983_1005582
821 Ga0209983_1086709
822 Ga0209971_1000728
823 Ga0209966_1005276
824 Ga0209966_1022486
825 Ga0209998_10000548
826 Ga0209998_10093563
827 Ga0209974_10001992
828 Ga0209974_10014835
829 Ga0207428_10141042
830 Ga0268266_10007786
831 Ga0268266_10020596
832 Ga0268266_10204358
833 Ga0268266_10432689
834 Ga0268265_10000002
835 Ga0268265_10000370
836 Ga0268265_10008501
837 Ga0268265_10024661
838 Ga0268265_10032838
839 Ga0268265_10114279
840 Ga0268264_10000397
841 Ga0268264_10015326
842 Ga0268264_10018198
843 Ga0265318_10008251
844 Ga0265338_10029309
845 Ga0265338_10166985
846 Ga0265330_10032148
847 Ga0265330_10089961
848 Ga0265332_10102032
849 Ga0265332_10260926
850 Ga0265328_10044204
851 Ga0265328_10082554
852 Ga0265320_10459682
853 Ga0265325_10044717
854 Ga0265325_10048132
855 Ga0265325_10092655
856 Ga0265325_10129035
857 Ga0265340_10000059
858 Ga0265340_10013560
859 Ga0265339_10030198
860 Ga0265339_10053659
861 Ga0265339_10252247
862 Ga0265339_10391063
863 Ga0265339_10466892
864 Ga0265331_10016153
865 Ga0265331_10058785
866 Ga0265331_10294933
867 Ga0265316_10011082
868 Ga0265316_10081375
869 Ga0265316_10452001
870 Ga0265316_10574252
871 Ga0265313_10002218
872 Ga0265313_10008536
873 Ga0265313_10037011
874 Ga0265313_10072744
875 Ga0265314_10074946
876 Ga0265314_10092672
877 Ga0265314_10244543
878 Ga0265314_10277301
879 Ga0265314_10314989
880 Ga0265342_10022373
881 Ga0316576_10029457
882 Ga0316578_10838414
883 Ga0307405_10059175
884 Ga0316577_10023802
885 Ga0307413_10069845
886 Ga0307413_10131798
887 Ga0307413_10197393
888 Ga0307410_10177040
889 Ga0307406_10325174
890 Ga0307407_10943985
891 Ga0307412_10734869
892 Ga0307409_100046599
893 Ga0307409_100111461
894 Ga0307416_100080503
895 Ga0307416_100750949
896 Ga0307411_10038720
897 Ga0307411_10055343
898 Ga0307411_10194081
899 Ga0307411_11410094
900 Ga0307415_100020213
901 Ga0307415_100190607
902 Ga0373950_0046372
903 Ga0316582_0861036
904 Ga0316584_0067576
905 Ga0400483_131903
906 Ga0436365_1557676
907 Ga0436363_1221608
908 Ga0439447_071968
909 Ga0439461_0062037
910 Ga0439461_0152597
911 Ga0439431_0276314
912 Ga0439441_026735
913 Ga0439443_009914
914 Ga0439445_0135503
915 Ga0439432_151907
916 Ga0439451_017613
917 Ga0439456_020647
918 Ga0439462_0025633
919 Ga0439462_0066199
920 Ga0450920_024073
921 Ga0450922_001526
922 Ga0450923_002616
923 Ga0450923_003995
924 Ga0450894_020513
925 Ga0450896_003110
926 Ga0450896_009899
927 Ga0450898_018133
928 Ga0450906_050961
929 Ga0450910_053558
930 Ga0439446_0001353
931 Ga0439446_0026149
932 Ga0450908_007475
933 Ga0439434_0018104
934 Ga0439434_0206608
935 Ga0439435_0001811
936 Ga0439435_0006151
937 Ga0439444_0003905
938 Ga0439444_0005461
939 Ga0439460_0066327
940 Ga0450893_0017070
941 Ga0450893_0022221
942 Ga0451577_0006530
943 Ga0451577_0047389
944 Ga0451577_1743117
945 Ga0453683_0055721
946 Ga0466963_0024510
947 Ga0466963_0851775
948 Ga0453684_0044982
949 Ga0453684_0142370
950 Ga0453684_0650865
951 Ga0466959_0134745
952 Ga0451576_0006005
953 Ga0451576_0183206
954 Ga0466958_0027374
955 Ga0466958_0031270
956 Ga0466967_0016669
957 Ga0495616_0179665
958 Ga0495642_0243306
959 Ga0495625_0830795
960 Ga0496100_0005098
961 Ga0496102_0000790
962 Ga0496102_1742609
963 Ga0496103_0001463
964 Ga0496104_0001292
965 Ga0496105_0000099
966 Ga0496106_0178083
967 Ga0496107_0278957
968 Ga0496108_0967695
969 Ga0496110_0025641
970 Ga0496110_0343833
971 Ga0496111_0118557
972 Ga0496112_0102432
973 Ga0496113_0012342
974 Ga0496114_1765955
975 Ga0496115_0360190
976 Ga0496116_0022270
977 Ga0496116_0113050
978 Ga0496117_0000739
979 Ga0496117_0013651
980 Ga0496118_0000778
981 Ga0496118_0000862
982 Ga0496118_0153775
983 Ga0496119_0002550
984 Ga0496119_0005771
985 Ga0496120_0002075
986 Ga0496121_0000058
987 Ga0496121_0010844
988 Ga0496121_0059944
989 Ga0496121_0775749
990 Ga0496122_0002786
991 Ga0496122_0033512
992 Ga0496122_0041881
993 Ga0496122_0304798
994 Ga0496123_0000332
995 Ga0496123_0021192
996 Ga0496124_0000007
997 Ga0496124_0011178
998 Ga0496124_0021629
999 Ga0496126_0000934
1000 Ga0501031_0020308
1001 Ga0501031_0049493
1002 Ga0501032_0007111
1003 Ga0501032_0026094
1004 Ga0501032_1011637
1005 Ga0501033_0064066
1006 Ga0501033_0064293
1007 Ga0501033_0066586
1008 Ga0501033_0298082
1009 Ga0501033_0404197
1010 Ga0501034_0024429
1011 Ga0501034_0036972
1012 Ga0501034_0661421
1013 Ga0501036_0008585
1014 Ga0501036_0066925
1015 Ga0501036_0281150
1016 Ga0501036_0829462
1017 Ga0501037_0441392
1018 Ga0501037_0689751
1019 Ga0501038_0042445
1020 Ga0501038_0176540
1021 Ga0501038_0496808
1022 Ga0501038_0510674
1023 Ga0501039_0001358
1024 Ga0501039_0038626
1025 Ga0501039_0381175
1026 Ga0501040_0017408
1027 Ga0501040_0230358
1028 Ga0501040_0672070
1029 Ga0501041_0018599
1030 Ga0501042_0004839
1031 Ga0501042_0027392
1032 Ga0501042_0244353
1033 Ga0501043_0625805
1034 Ga0501046_0138472
1035 Ga0501046_0332430
1036 Ga0501047_0024527
1037 Ga0501047_0105436
1038 Ga0501047_0485225
1039 Ga0501047_0988148
1040 Ga0501048_0002580
1041 Ga0501048_0044131
1042 Ga0501048_0608213
1043 Ga0501067_0001589
1044 Ga0501068_0011937
1045 Ga0501068_0175070
1046 Ga0501069_0033378
1047 Ga0501069_0060165
1048 Ga0501069_0465682
1049 Ga0501070_0037876
1050 Ga0501070_0205659
1051 Ga0501071_0000921
1052 Ga0501071_0107213
1053 Ga0501071_0267540
1054 Ga0501071_0348074
1055 Ga0501072_0057107
1056 Ga0501072_0109369
1057 Ga0501072_0135353
1058 Ga0501073_0458758
1059 Ga0501073_0772950
1060 Ga0501074_0011061
1061 Ga0501074_0034726
1062 Ga0501074_0384238
1063 Ga0501075_0049788
1064 Ga0501075_0169150
1065 Ga0501075_0255105
1066 Ga0501076_0004872
1067 Ga0501076_0090848
1068 Ga0501077_0341655
1069 Ga0501079_0140004
1070 Ga0501080_0035208
1071 Ga0501080_0313319
1072 Ga0501080_0534616
1073 Ga0501081_0014892
1074 Ga0501081_0047536
1075 Ga0501081_0102993
1076 Ga0501083_0122220
1077 Ga0501083_0123618
1078 Ga0501035_0003558
1079 Ga0501035_0021128
1080 Ga0501035_0029460
1081 Ga0501035_0062838
1082 Ga0501035_0074932
1083 Ga0501035_0110123
1084 Ga0501035_0567151
1085 Ga0501044_0012537
1086 Ga0501044_0016340
1087 Ga0501044_0135187
1088 Ga0501044_0189506
1089 Ga0501044_1097480
1090 Ga0501045_0102718
1091 Ga0501045_0103879
1092 Ga0501045_0135176
1093 nmdc:mga00v17_71268_c1
1094 nmdc:mga08y16_1186369_c1
1095 Ga0500562_060075
1096 Ga0500607_018781
1097 Ga0500636_0000716
1098 Ga0500637_0098954
1099 Ga0500625_025128
1100 Ga0501084_0012232
1101 Ga0501084_0036099
1102 Ga0501084_1052648
1103 Ga0501082_0009438
1104 Ga0501082_0102395
1105 Ga0501082_0207447
1106 Ga0501082_0294358
1107 Ga0501082_0310757
1108 Ga0501082_0770351
1109 Ga0530510_0036229
1110 Ga0530510_0081010
1111 Ga0530510_0161024
1112 2509107835
1113 2509376232
1114 2558863100
1115 2792642629
1116 2850080828
1117 2857544343
1118 2919712595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

44

142

0.98

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

36

144

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9736 6 142
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9591 6 142
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9584 5 142
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9578 5 142
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9527 6 142
ID Description Score Start End Superfamily
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9736 6 142 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9637 10 116 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9591 6 142 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9492 24 113 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9375 45 117 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A1I0TNW8-F1-model_v4 HIT domain-containing protein (HIT family protein) 0.9898 1 142 GO:0003824
GO:0009117
AF-A0A2R3IU41-F1-model_v4 Scavenger mRNA decapping enzyme C-term binding family protein 0.9879 1 144 GO:0003824
GO:0009117
AF-A0A2E9D359-F1-model_v4 HIT family protein 0.9865 5 144 GO:0003824
GO:0009117
AF-A0A0B6S7H0-F1-model_v4 HIT domain-containing protein 0.9861 5 142 GO:0003824
GO:0009117
AF-A0A433B2Y2-F1-model_v4 HIT family protein 0.985 5 143 GO:0003824
GO:0009117

Map