F463522

General Info

Members Datasets Scaffolds Average Seq Length
559 368 525 211

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10020623|JGI25153J46596_100206233
Length 227
Sequence MKLDVIKLDGGKAGSVDLDDAIFGIADIRGDILQRVVTWQLAKRRSGNHKIQVRNEVSRTGKKMYKQKGTGSARHGSRRAAQFVGGAKAXGPVVRSHAFXLPKKIRAMALRHALSSKAKAGSIVVLDSAVLTDPKTAALRANFDKIGLKNALVIAGPEVDGNFKLAARNIPNIDVLPNAGLNVYDVLRRQTLVLTKDAXEAISARFAEKEAAXWPQPPATTTRSCRR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
18 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
19 2818991435 Caulobacter henricii 536 Isolate Unclassified
20 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
21 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
22 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
23 2849560528 Caulobacter zeae 410 Isolate Unclassified
24 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
25 2851153111 Caulobacter radicis 736 Isolate Unclassified
26 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
27 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
28 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
31 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
32 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
33 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
34 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
178 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
202 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
203 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
204 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
205 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
206 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
207 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
210 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
211 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
212 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
213 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
226 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
302 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
316 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
320 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
321 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
322 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
326 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
327 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
330 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
331 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
332 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
333 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
336 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
337 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
338 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
339 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
340 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
341 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
342 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
343 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
344 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
347 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
350 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
351 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
354 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
355 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
356 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
357 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
358 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
359 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
360 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
361 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
362 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.27
Metatranscriptomes 4.65
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.93
Nodule 0
Rhizoplane 3.04
Rhizosphere 66.55
Stem 0
Stem Tuber 0
Unclassified 9.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10020623 3300003215 Bacteria 2486
2 Ga0032354_1009883 3300003693 Bacteria 2257
3 Ga0032354_1036765 3300003693 Bacteria 2457
4 Ga0055537_1004503 3300003773 Bacteria 3972
5 Ga0055524_1019052 3300003775 Bacteria 2359
6 Ga0055528_1007701 3300003790 Bacteria 4722
7 Ga0055530_10004523 3300003791 Bacteria 7112
8 Ga0055530_10022053 3300003791 Bacteria 1861
9 Ga0055531_10023544 3300003794 Bacteria 2303
10 Ga0055531_10029209 3300003794 Bacteria 1882
11 Ga0065165_1002762 3300005262 Bacteria 13954
12 Ga0065165_1007044 3300005262 Bacteria 5660
13 Ga0070676_10327453 3300005328 Bacteria 1047
14 Ga0070683_100461961 3300005329 Bacteria 1212
15 Ga0070670_100000958 3300005331 Bacteria 22640
16 Ga0070670_100063759 3300005331 Bacteria 3162
17 Ga0070670_100528860 3300005331 Bacteria 1050
18 Ga0068869_100511504 3300005334 Bacteria 1004
19 Ga0070666_10288826 3300005335 Bacteria 1167
20 Ga0070666_10304828 3300005335 Bacteria 1135
21 Ga0070666_10323942 3300005335 Bacteria 1099
22 Ga0070660_100140471 3300005339 Bacteria 1937
23 Ga0070691_10004797 3300005341 Bacteria 6156
24 Ga0070668_100002473 3300005347 Bacteria 13591
25 Ga0070668_100018845 3300005347 Bacteria 5184
26 Ga0070669_100019075 3300005353 Bacteria 4902
27 Ga0070671_100001396 3300005355 Bacteria 18034
28 Ga0070671_100308137 3300005355 Bacteria 1348
29 Ga0070673_100051075 3300005364 Bacteria 3236
30 Ga0070659_100074275 3300005366 Bacteria 2708
31 Ga0070659_100174117 3300005366 Bacteria 1764
32 Ga0070667_100026034 3300005367 Bacteria 4864
33 Ga0070713_101138790 3300005436 Bacteria 754
34 Ga0070678_100198955 3300005456 Bacteria 1653
35 Ga0070662_100432256 3300005457 Bacteria 1090
36 Ga0070681_10068278 3300005458 Bacteria 3522
37 Ga0070681_10099585 3300005458 Bacteria 2852
38 Ga0068853_100233197 3300005539 Bacteria 1684
39 Ga0068853_100399888 3300005539 Bacteria 1285
40 Ga0070665_100055537 3300005548 Bacteria 3971
41 Ga0070665_100063485 3300005548 Bacteria 3703
42 Ga0070665_100076823 3300005548 Bacteria 3346
43 Ga0070665_100182043 3300005548 Bacteria 2102
44 Ga0068855_100722076 3300005563 Bacteria 1065
45 Ga0068855_100853769 3300005563 Bacteria 964
46 Ga0070664_100036245 3300005564 Bacteria 4144
47 Ga0068854_100283607 3300005578 Bacteria 1334
48 Ga0068854_100496692 3300005578 Bacteria 1027
49 Ga0068856_100221172 3300005614 Bacteria 1909
50 Ga0068856_100667723 3300005614 Bacteria 1060
51 Ga0068856_101011214 3300005614 Bacteria 849
52 Ga0068859_100268032 3300005617 Bacteria 1799
53 Ga0068864_100043582 3300005618 Bacteria 3842
54 Ga0068866_10385722 3300005718 Bacteria 900
55 Ga0068861_100060108 3300005719 Bacteria 2911
56 Ga0068851_10283195 3300005834 Bacteria 948
57 Ga0068863_100045890 3300005841 Bacteria 4147
58 Ga0068863_100064635 3300005841 Bacteria 3460
59 Ga0068858_100050547 3300005842 Bacteria 3847
60 Ga0068858_100524477 3300005842 Bacteria 1146
61 Ga0068860_100001684 3300005843 Bacteria 23610
62 Ga0068860_100022119 3300005843 Bacteria 6155
63 Ga0068862_100028223 3300005844 Bacteria 4725
64 Ga0068862_100305543 3300005844 Bacteria 1464
65 Ga0075368_10008167 3300006042 Bacteria 3719
66 Ga0075363_100047678 3300006048 Bacteria 2276
67 Ga0075363_100103319 3300006048 Bacteria 1579
68 Ga0075363_100438543 3300006048 Bacteria 770
69 Ga0075364_10001038 3300006051 Bacteria 14772
70 Ga0075367_10001012 3300006178 Bacteria 11557
71 Ga0075369_10010071 3300006186 Bacteria 3692
72 Ga0075366_10059395 3300006195 Bacteria 2271
73 Ga0075366_10115902 3300006195 Bacteria 1613
74 Ga0075366_10127469 3300006195 Bacteria 1535
75 Ga0075366_10355356 3300006195 Bacteria 900
76 Ga0075366_10571149 3300006195 Bacteria 700
77 Ga0075370_10027150 3300006353 Bacteria 3175
78 Ga0075370_10202409 3300006353 Bacteria 1171
79 Ga0068865_100013511 3300006881 Bacteria 5161
80 Ga0097620_100268025 3300006931 Bacteria 1799
81 Ga0105240_10000798 3300009093 Bacteria 57073
82 Ga0105240_10230206 3300009093 Bacteria 2154
83 Ga0105240_10335083 3300009093 Bacteria 1720
84 Ga0105240_10386595 3300009093 Bacteria 1579
85 Ga0105240_10406436 3300009093 Bacteria 1532
86 Ga0105240_10524597 3300009093 Bacteria 1314
87 Ga0105245_10635073 3300009098 Bacteria 1097
88 Ga0105243_11099686 3300009148 Bacteria 803
89 Ga0105241_10051142 3300009174 Bacteria 3150
90 Ga0105242_10218000 3300009176 Bacteria 1704
91 Ga0105248_10008835 3300009177 Bacteria 11068
92 Ga0105248_10259890 3300009177 Bacteria 1955
93 Ga0105248_10382456 3300009177 Bacteria 1585
94 Ga0105248_11214471 3300009177 Bacteria 852
95 Ga0105238_10232374 3300009551 Bacteria 1820
96 Ga0105238_10593494 3300009551 Bacteria 1115
97 Ga0105249_10041843 3300009553 Bacteria 4166
98 Ga0105249_10257956 3300009553 Bacteria 1731
99 Ga0105239_10294484 3300010375 Bacteria 1827
100 Ga0105239_10652689 3300010375 Bacteria 1202
101 Ga0105246_10521316 3300011119 Bacteria 1013
102 Ga0157373_10136423 3300013100 Bacteria 1725
103 Ga0157370_10114023 3300013104 Bacteria 2525
104 Ga0157369_10018315 3300013105 Bacteria 7853
105 Ga0157369_10406132 3300013105 Bacteria 1413
106 Ga0157374_10493874 3300013296 Bacteria 1228
107 Ga0157374_10986379 3300013296 Bacteria 861
108 Ga0157378_10653213 3300013297 Bacteria 1067
109 Ga0163162_10080358 3300013306 Bacteria 3328
110 Ga0157372_10364270 3300013307 Bacteria 1684
111 Ga0157375_10429715 3300013308 Bacteria 1487
112 Ga0163163_10009581 3300014325 Bacteria 8656
113 Ga0163163_10439545 3300014325 Bacteria 1364
114 Ga0157380_10548407 3300014326 Bacteria 1134
115 Ga0182008_10084129 3300014497 Bacteria 1567
116 Ga0157379_10041021 3300014968 Bacteria 4131
117 Ga0157379_10898562 3300014968 Bacteria 840
118 Ga0182007_10037419 3300015262 Bacteria 1630
119 Ga0213872_10005913 3300021361 Bacteria 6209
120 Ga0213876_10000244 3300021384 Bacteria 51875
121 Ga0209673_1001876 3300025273 Bacteria 16959
122 Ga0209676_1022325 3300025292 Bacteria 2100
123 Ga0209564_1007568 3300025295 Bacteria 5584
124 Ga0209758_1002168 3300025297 Bacteria 20636
125 Ga0209758_1023594 3300025297 Bacteria 2776
126 Ga0209050_1000161 3300025298 Bacteria 155713
127 Ga0209050_1019693 3300025298 Bacteria 2548
128 Ga0209256_1003893 3300025299 Bacteria 9891
129 Ga0209051_1000877 3300025303 Bacteria 30359
130 Ga0209257_1000252 3300025304 Bacteria 123718
131 Ga0209257_1000976 3300025304 Bacteria 38920
132 Ga0209257_1008377 3300025304 Bacteria 5898
133 Ga0209257_1010622 3300025304 Bacteria 4615
134 Ga0207656_10099352 3300025321 Bacteria 1332
135 Ga0207680_10043744 3300025903 Bacteria 2629
136 Ga0207680_10057755 3300025903 Bacteria 2349
137 Ga0207645_10029047 3300025907 Bacteria 3565
138 Ga0207643_10064023 3300025908 Bacteria 2104
139 Ga0207705_10018153 3300025909 Bacteria 5029
140 Ga0207654_10077845 3300025911 Bacteria 1989
141 Ga0207707_10183495 3300025912 Bacteria 1826
142 Ga0207695_10000575 3300025913 Bacteria 74997
143 Ga0207695_10010884 3300025913 Bacteria 11075
144 Ga0207695_10273409 3300025913 Bacteria 1585
145 Ga0207695_10372193 3300025913 Bacteria 1315
146 Ga0207671_10217066 3300025914 Bacteria 1497
147 Ga0207660_10000537 3300025917 Bacteria 25426
148 Ga0207660_10193464 3300025917 Bacteria 1585
149 Ga0207649_10107742 3300025920 Bacteria 1856
150 Ga0207649_10355036 3300025920 Bacteria 1086
151 Ga0207652_10002134 3300025921 Bacteria 16964
152 Ga0207681_10164779 3300025923 Bacteria 1674
153 Ga0207694_10228390 3300025924 Bacteria 1519
154 Ga0207694_10244076 3300025924 Bacteria 1468
155 Ga0207650_10000883 3300025925 Bacteria 22684
156 Ga0207650_10051081 3300025925 Bacteria 3059
157 Ga0207700_10184548 3300025928 Bacteria 1749
158 Ga0207644_10019776 3300025931 Bacteria 4571
159 Ga0207644_10035600 3300025931 Bacteria 3489
160 Ga0207690_10018048 3300025932 Bacteria 4321
161 Ga0207690_10175415 3300025932 Bacteria 1609
162 Ga0207706_10019813 3300025933 Bacteria 6048
163 Ga0207706_10561516 3300025933 Bacteria 982
164 Ga0207711_10001469 3300025941 Bacteria 21980
165 Ga0207711_10112712 3300025941 Bacteria 2421
166 Ga0207711_10245260 3300025941 Bacteria 1643
167 Ga0207689_10604496 3300025942 Bacteria 922
168 Ga0207679_10207149 3300025945 Bacteria 1642
169 Ga0207667_10166618 3300025949 Bacteria 2265
170 Ga0207667_10259986 3300025949 Bacteria 1775
171 Ga0207667_10906985 3300025949 Bacteria 873
172 Ga0207651_10395513 3300025960 Bacteria 1174
173 Ga0207712_10002131 3300025961 Bacteria 12933
174 Ga0207668_10000363 3300025972 Bacteria 28976
175 Ga0207668_10000571 3300025972 Bacteria 23129
176 Ga0207668_10037129 3300025972 Bacteria 3258
177 Ga0207668_10037130 3300025972 Bacteria 3258
178 Ga0207640_10178996 3300025981 Bacteria 1588
179 Ga0207640_10410162 3300025981 Bacteria 1106
180 Ga0207658_10001253 3300025986 Bacteria 20099
181 Ga0207658_10012581 3300025986 Bacteria 5776
182 Ga0207677_10475628 3300026023 Bacteria 1075
183 Ga0207703_10013988 3300026035 Bacteria 6256
184 Ga0207703_10086143 3300026035 Bacteria 2631
185 Ga0207703_10464885 3300026035 Bacteria 1184
186 Ga0207639_10053240 3300026041 Bacteria 3087
187 Ga0207678_10183294 3300026067 Bacteria 1788
188 Ga0207702_10266138 3300026078 Bacteria 1616
189 Ga0207702_10348651 3300026078 Bacteria 1416
190 Ga0207648_10273356 3300026089 Bacteria 1510
191 Ga0207676_10010270 3300026095 Bacteria 6663
192 Ga0207674_10336853 3300026116 Bacteria 1458
193 Ga0207675_100039241 3300026118 Bacteria 4420
194 Ga0209981_1000276 3300027378 Bacteria 6562
195 Ga0210000_1022595 3300027462 Bacteria 966
196 Ga0209999_1001058 3300027543 Bacteria 4681
197 Ga0209983_1005860 3300027665 Bacteria 2538
198 Ga0209813_10061568 3300027866 Bacteria 1199
199 Ga0268266_10000311 3300028379 Bacteria 77262
200 Ga0268266_10023680 3300028379 Bacteria 5226
201 Ga0268266_10040775 3300028379 Bacteria 3959
202 Ga0268266_10053859 3300028379 Bacteria 3457
203 Ga0268266_10077149 3300028379 Bacteria 2896
204 Ga0268265_10004022 3300028380 Bacteria 10354
205 Ga0268265_10695882 3300028380 Bacteria 981
206 Ga0268264_10000383 3300028381 Bacteria 63883
207 Ga0268264_10002325 3300028381 Bacteria 16817
208 Ga0268264_10072664 3300028381 Bacteria 2917
209 Ga0265326_10027785 3300028558 Bacteria 1613
210 Ga0265334_10006043 3300028573 Bacteria 5256
211 Ga0307517_10130623 3300028786 Bacteria 1810
212 Ga0265338_10019380 3300028800 Bacteria 7219
213 Ga0265338_10048593 3300028800 Bacteria 3858
214 Ga0265338_10442167 3300028800 Bacteria 921
215 Ga0265324_10119872 3300029957 Bacteria 894
216 Ga0307511_10006537 3300030521 Bacteria 11736
217 Ga0307512_10169625 3300030522 Bacteria 1255
218 Ga0265327_10000381 3300031251 Bacteria 83617
219 Ga0265327_10007046 3300031251 Bacteria 8808
220 Ga0265327_10042304 3300031251 Bacteria 2447
221 Ga0265327_10055621 3300031251 Bacteria 2042
222 Ga0307513_10000162 3300031456 Bacteria 96000
223 Ga0307513_10010515 3300031456 Bacteria 11583
224 Ga0307513_10016219 3300031456 Bacteria 8997
225 Ga0307513_10198590 3300031456 Bacteria 1849
226 Ga0265314_10053314 3300031711 Bacteria 2806
227 Ga0265314_10083091 3300031711 Bacteria 2106
228 Ga0265314_10183534 3300031711 Bacteria 1251
229 Ga0307516_10001565 3300031730 Bacteria 31484
230 Ga0307413_10002271 3300031824 Bacteria 7767
231 Ga0307406_10115754 3300031901 Bacteria 1854
232 Ga0307416_100235587 3300032002 Bacteria 1769
233 Ga0307411_10055871 3300032005 Bacteria 2599
234 Ga0316583_10029332 3300032133 Bacteria 1962
235 Ga0316593_10019819 3300032168 Bacteria 2082
236 Ga0316593_10029449 3300032168 Bacteria 1776
237 Ga0307510_10078548 3300033180 Bacteria 3227
238 Ga0316596_1076669 3300033541 Bacteria 897
239 Ga0373926_0062463 3300035083 Bacteria 1360
240 Ga0373923_0172448 3300035111 Bacteria 991
241 Ga0373946_0016115 3300035171 Bacteria 2844
242 Ga0373931_0114957 3300035691 Bacteria 1531
243 Ga0373927_0000479 3300035695 Bacteria 30749
244 Ga0373927_0165324 3300035695 Bacteria 1450
245 Ga0373947_0084504 3300035725 Bacteria 1970
246 Ga0373937_0407622 3300036401 Bacteria 1290
247 Ga0373925_0000023 3300037068 Bacteria 158881
248 Ga0373925_0175832 3300037068 Bacteria 1692
249 Ga0395899_0001195 3300037312 Bacteria 22830
250 Ga0395899_0322286 3300037312 Bacteria 1040
251 Ga0395900_0006999 3300037418 Bacteria 11682
252 Ga0395900_0130918 3300037418 Bacteria 2571
253 Ga0395900_0250561 3300037418 Bacteria 1772
254 Ga0395898_0004322 3300037466 Bacteria 15569
255 Ga0395898_0071967 3300037466 Bacteria 3340
256 Ga0395898_0118241 3300037466 Bacteria 2539
257 Ga0395905_0006270 3300037471 Bacteria 12003
258 Ga0395905_0012867 3300037471 Bacteria 8042
259 Ga0395905_0055624 3300037471 Bacteria 3703
260 Ga0395905_0079876 3300037471 Bacteria 3065
261 Ga0395905_0096583 3300037471 Bacteria 2774
262 Ga0436364_0059029 3300037853 Bacteria 977
263 Ga0436364_0151535 3300037853 Bacteria 784
264 Ga0395901_0000342 3300038443 Bacteria 56754
265 Ga0395901_0140376 3300038443 Bacteria 2539
266 Ga0400483_014056 3300039062 Bacteria 3378
267 Ga0400483_052325 3300039062 Bacteria 1621
268 Ga0400483_169471 3300039062 Bacteria 1831
269 Ga0400483_187305 3300039062 Bacteria 5029
270 Ga0436365_0376847 3300039437 Bacteria 89580
271 Ga0436365_1891356 3300039437 Bacteria 3332
272 Ga0436365_1905157 3300039437 Bacteria 743
273 Ga0436360_0164499 3300039438 Bacteria 899
274 Ga0436360_0409977 3300039438 Bacteria 1230
275 Ga0436360_0551958 3300039438 Bacteria 2586
276 Ga0436360_0905641 3300039438 Bacteria 1954
277 Ga0436361_0100802 3300039447 Bacteria 1286
278 Ga0436361_0953537 3300039447 Bacteria 44604
279 Ga0436363_0347296 3300039450 Bacteria 1418
280 Ga0436363_0411020 3300039450 Bacteria 729
281 Ga0436363_0944849 3300039450 Bacteria 942
282 Ga0436363_1544180 3300039450 Bacteria 1156
283 Ga0436362_0858043 3300039453 Bacteria 1583
284 Ga0439461_0048469 3300041410 Bacteria 936
285 Ga0451793_0183211 3300041452 Bacteria 1055
286 Ga0451843_1158826 3300041509 Bacteria 1295
287 Ga0439437_004749 3300042000 Bacteria 1487
288 Ga0439442_014552 3300042002 Bacteria 1620
289 Ga0439445_0007571 3300042004 Bacteria 2523
290 Ga0439432_034018 3300042006 Bacteria 1638
291 Ga0439449_0064267 3300042007 Bacteria 1354
292 Ga0450890_010332 3300042127 Bacteria 1201
293 Ga0439446_0066307 3300042156 Bacteria 1098
294 Ga0439446_0110932 3300042156 Bacteria 875
295 Ga0439459_0000576 3300042438 Bacteria 4885
296 Ga0450916_000234 3300042530 Bacteria 4330
297 Ga0450893_0006119 3300042532 Bacteria 1943
298 Ga0466961_0106082 3300044693 Bacteria 1769
299 Ga0453684_0534082 3300044712 Bacteria 1294
300 Ga0466970_0057669 3300044765 Bacteria 2077
301 Ga0451576_0043660 3300045051 Bacteria 4729
302 Ga0451576_0628970 3300045051 Bacteria 1128
303 Ga0495627_000399 3300046453 Bacteria 38947
304 Ga0495592_0250504 3300046454 Bacteria 1171
305 Ga0495590_0000851 3300046457 Bacteria 13774
306 Ga0495629_0018598 3300046459 Bacteria 4968
307 Ga0495650_0001571 3300046471 Bacteria 21474
308 Ga0495584_0192109 3300046491 Bacteria 1038
309 Ga0495585_0057569 3300046492 Bacteria 2145
310 Ga0495585_0205759 3300046492 Bacteria 1000
311 Ga0495607_0207421 3300046501 Bacteria 966
312 Ga0495583_0000650 3300046506 Bacteria 45814
313 Ga0495606_0013477 3300046507 Bacteria 6451
314 Ga0495606_0067825 3300046507 Bacteria 2258
315 Ga0495606_0137467 3300046507 Bacteria 1445
316 Ga0495606_0151705 3300046507 Bacteria 1359
317 Ga0495610_0013510 3300046512 Bacteria 4850
318 Ga0495610_0026700 3300046512 Bacteria 3079
319 Ga0495616_0069112 3300046513 Bacteria 1713
320 Ga0495620_0013485 3300046515 Bacteria 4181
321 Ga0495631_0019391 3300046518 Bacteria 3189
322 Ga0495632_0004552 3300046519 Bacteria 9398
323 Ga0495637_0016956 3300046520 Bacteria 3401
324 Ga0495643_0002864 3300046522 Bacteria 13105
325 Ga0495643_0206625 3300046522 Bacteria 939
326 Ga0495644_0147466 3300046523 Bacteria 900
327 Ga0495648_0002288 3300046524 Bacteria 17871
328 Ga0495648_0137128 3300046524 Bacteria 1292
329 Ga0495663_0065355 3300046525 Bacteria 1149
330 Ga0495663_0071665 3300046525 Bacteria 1104
331 Ga0495642_0013507 3300046528 Bacteria 3159
332 Ga0495654_0006712 3300046530 Bacteria 6511
333 Ga0495609_0030354 3300046538 Bacteria 2460
334 Ga0495597_0013809 3300046542 Bacteria 3860
335 Ga0495597_0033708 3300046542 Bacteria 2317
336 Ga0495597_0043806 3300046542 Bacteria 1991
337 Ga0495622_0002985 3300046557 Bacteria 8042
338 Ga0495633_0080184 3300046558 Bacteria 1519
339 Ga0495668_0001818 3300046616 Bacteria 19364
340 Ga0495668_0019185 3300046616 Bacteria 3945
341 Ga0495668_0050196 3300046616 Bacteria 2312
342 Ga0495668_0098794 3300046616 Bacteria 1597
343 Ga0495668_0213466 3300046616 Bacteria 1056
344 Ga0495611_0077613 3300046648 Bacteria 1523
345 Ga0495625_0001925 3300046660 Bacteria 23466
346 Ga0495625_0058314 3300046660 Bacteria 2743
347 Ga0495625_0083154 3300046660 Bacteria 2225
348 Ga0495625_0210534 3300046660 Bacteria 1278
349 Ga0495661_0138934 3300046665 Bacteria 1324
350 Ga0495669_0000044 3300046684 Bacteria 85633
351 Ga0495669_0000371 3300046684 Bacteria 22866
352 Ga0495669_0021716 3300046684 Bacteria 2789
353 Ga0495669_0036871 3300046684 Bacteria 2162
354 Ga0495613_0000576 3300046689 Bacteria 29823
355 Ga0495670_0117572 3300046691 Bacteria 1380
356 Ga0495670_0168018 3300046691 Bacteria 1154
357 Ga0495649_0131040 3300046694 Bacteria 1323
358 Ga0495589_0034715 3300046794 Bacteria 2530
359 Ga0495636_0026912 3300047318 Bacteria 2341
360 Ga0495672_0000439 3300047320 Bacteria 49666
361 Ga0495672_0094949 3300047320 Bacteria 1629
362 Ga0495683_0011199 3300047323 Bacteria 4727
363 Ga0495687_080693 3300047443 Bacteria 1275
364 Ga0495677_0023144 3300047445 Bacteria 2255
365 Ga0495677_0041039 3300047445 Bacteria 1692
366 Ga0495679_006048 3300047446 Bacteria 5288
367 Ga0495673_0000189 3300047469 Bacteria 99018
368 Ga0495673_0155445 3300047469 Bacteria 881
369 Ga0495681_0064653 3300047470 Bacteria 1674
370 Ga0495686_0007469 3300047472 Bacteria 8189
371 Ga0495686_0026646 3300047472 Bacteria 3781
372 Ga0495686_0070592 3300047472 Bacteria 2152
373 Ga0495686_0184807 3300047472 Bacteria 1205
374 Ga0495593_0029058 3300047673 Bacteria 3034
375 Ga0496103_0131457 3300048906 Bacteria 1598
376 Ga0496103_0177218 3300048906 Bacteria 1370
377 Ga0496105_0090149 3300048908 Bacteria 2533
378 Ga0496106_0006912 3300048909 Bacteria 8394
379 Ga0496106_0180175 3300048909 Bacteria 1677
380 Ga0496107_0000073 3300048910 Bacteria 48489
381 Ga0496107_0146752 3300048910 Bacteria 1745
382 Ga0496109_0134272 3300048912 Bacteria 2311
383 Ga0496112_0020616 3300048915 Bacteria 6250
384 Ga0496112_0037337 3300048915 Bacteria 4742
385 Ga0496113_0515605 3300048916 Bacteria 960
386 Ga0496114_0245251 3300048917 Bacteria 1576
387 Ga0496115_0021048 3300048918 Bacteria 5033
388 Ga0496115_0049703 3300048918 Bacteria 3357
389 Ga0496115_0354921 3300048918 Bacteria 1195
390 Ga0496115_0614869 3300048918 Bacteria 862
391 Ga0496116_0134067 3300048919 Bacteria 1406
392 Ga0496117_0020336 3300048920 Bacteria 5413
393 Ga0496118_0014068 3300048921 Bacteria 7511
394 Ga0496118_0293978 3300048921 Bacteria 896
395 Ga0496119_0041993 3300048922 Bacteria 2905
396 Ga0496121_0000946 3300048924 Bacteria 52586
397 Ga0496121_0025980 3300048924 Bacteria 5537
398 Ga0496121_0242092 3300048924 Bacteria 1256
399 Ga0496125_0023733 3300048928 Bacteria 5655
400 Ga0496125_0059294 3300048928 Bacteria 3085
401 Ga0501341_02423 3300049131 Bacteria 1008
402 Ga0495678_001705 3300049459 Bacteria 16503
403 Ga0495682_0062724 3300049460 Bacteria 1341
404 Ga0501311_018176 3300049527 Bacteria 932
405 Ga0501312_008613 3300049528 Bacteria 1328
406 Ga0501313_015433 3300049529 Bacteria 911
407 Ga0501313_024125 3300049529 Bacteria 765
408 Ga0501316_018267 3300049532 Bacteria 865
409 Ga0501319_000756 3300049535 Bacteria 1660
410 Ga0501319_005224 3300049535 Bacteria 926
411 Ga0501320_011731 3300049536 Bacteria 912
412 Ga0501321_006939 3300049537 Bacteria 1165
413 Ga0501323_002237 3300049539 Bacteria 1852
414 Ga0501324_002768 3300049540 Bacteria 1297
415 Ga0501325_003636 3300049541 Bacteria 1136
416 Ga0501032_0097203 3300049569 Bacteria 1952
417 Ga0501032_0316542 3300049569 Bacteria 1008
418 Ga0501033_0109003 3300049570 Bacteria 2017
419 Ga0501033_0121202 3300049570 Bacteria 1898
420 Ga0501034_0000482 3300049571 Bacteria 65380
421 Ga0501034_0077264 3300049571 Bacteria 3335
422 Ga0501037_0132584 3300049573 Bacteria 1786
423 Ga0501039_0195868 3300049575 Bacteria 1589
424 Ga0501041_0093540 3300049577 Bacteria 1857
425 Ga0501043_0233205 3300049579 Bacteria 1421
426 Ga0501047_0021902 3300049581 Bacteria 6136
427 Ga0501047_0199368 3300049581 Bacteria 1863
428 Ga0501047_0569577 3300049581 Bacteria 956
429 Ga0501070_0063354 3300049586 Bacteria 3063
430 Ga0501071_0320492 3300049587 Bacteria 1177
431 Ga0501238_000524 3300049671 Bacteria 4389
432 Ga0501257_016026 3300049686 Bacteria 1735
433 Ga0501083_0314903 3300049744 Bacteria 1018
434 Ga0501280_046869 3300049776 Bacteria 716
435 Ga0501044_0032239 3300049823 Bacteria 5509
436 Ga0501045_0324855 3300049824 Bacteria 1145
437 nmdc:mga03n38_123713_c1 3300050490 Bacteria 1274
438 nmdc:mga00v17_4550_c1 3300050491 Bacteria 7225
439 nmdc:mga0k408_174832_c1 3300050493 Bacteria 1280
440 nmdc:mga0k408_62374_c1 3300050493 Bacteria 2168
441 nmdc:mga06z11_319018_c1 3300050494 Bacteria 926
442 nmdc:mga06z11_6498_c1 3300050494 Bacteria 4762
443 nmdc:mga04h51_7138_c1 3300050495 Bacteria 2935
444 nmdc:mga07m45_250452_c1 3300050496 Bacteria 1031
445 nmdc:mga07m45_45178_c1 3300050496 Bacteria 2473
446 nmdc:mga07m45_57184_c1 3300050496 Bacteria 2205
447 nmdc:mga07m45_60756_c1 3300050496 Bacteria 2140
448 Ga0495601_0153663 3300053077 Bacteria 1503
449 Ga0495612_0033758 3300053078 Bacteria 2071
450 Ga0500635_0000205 3300053080 Bacteria 29287
451 Ga0500578_0000459 3300053086 Bacteria 49572
452 Ga0500643_003760 3300053087 Bacteria 7124
453 Ga0500643_013812 3300053087 Bacteria 2832
454 Ga0500643_022575 3300053087 Bacteria 2023
455 Ga0500643_029867 3300053087 Bacteria 1673
456 Ga0500644_0000193 3300053088 Bacteria 37831
457 Ga0500646_0077311 3300053090 Bacteria 1009
458 Ga0500647_0049633 3300053091 Bacteria 2018
459 Ga0500583_0061517 3300053092 Bacteria 1773
460 Ga0500651_0003210 3300053093 Bacteria 8883
461 Ga0500566_0015189 3300053094 Bacteria 4518
462 Ga0500566_0198852 3300053094 Bacteria 1014
463 Ga0500641_0002284 3300053096 Bacteria 6803
464 Ga0500641_0002384 3300053096 Bacteria 6663
465 Ga0500641_0003388 3300053096 Bacteria 5637
466 Ga0500641_0046486 3300053096 Bacteria 1772
467 Ga0500650_0035877 3300053098 Bacteria 2274
468 Ga0500554_000324 3300053102 Bacteria 10286
469 Ga0500555_001699 3300053103 Bacteria 6625
470 Ga0500556_0001068 3300053104 Bacteria 14047
471 Ga0500556_0027981 3300053104 Bacteria 1888
472 Ga0500556_0083999 3300053104 Bacteria 1207
473 Ga0500562_000644 3300053108 Bacteria 8433
474 Ga0500562_004084 3300053108 Bacteria 3679
475 Ga0500569_000322 3300053109 Bacteria 7683
476 Ga0500572_066175 3300053111 Bacteria 1108
477 Ga0500593_106042 3300053117 Bacteria 1164
478 Ga0500594_0000153 3300053118 Bacteria 18197
479 Ga0500595_001651 3300053119 Bacteria 11721
480 Ga0500595_007692 3300053119 Bacteria 4456
481 Ga0500607_051245 3300053121 Bacteria 2195
482 Ga0500608_000165 3300053122 Bacteria 27378
483 Ga0500608_004302 3300053122 Bacteria 5487
484 Ga0500608_117892 3300053122 Bacteria 1208
485 Ga0500614_000617 3300053123 Bacteria 9057
486 Ga0500614_054013 3300053123 Bacteria 1063
487 Ga0500618_000703 3300053125 Bacteria 19670
488 Ga0500628_108157 3300053129 Bacteria 743
489 Ga0500652_102870 3300053131 Bacteria 1194
490 Ga0500655_020777 3300053133 Bacteria 1228
491 Ga0500658_0001787 3300053134 Bacteria 8487
492 Ga0500559_0000113 3300053136 Bacteria 63512
493 Ga0500559_0001398 3300053136 Bacteria 13721
494 Ga0500559_0016148 3300053136 Bacteria 3152
495 Ga0500564_000145 3300053138 Bacteria 18335
496 Ga0500568_0044246 3300053139 Bacteria 1777
497 Ga0500590_085514 3300053148 Bacteria 1540
498 Ga0500603_003920 3300053150 Bacteria 3184
499 Ga0500616_0081933 3300053153 Bacteria 1619
500 Ga0500620_060729 3300053155 Bacteria 1286
501 Ga0500622_0000771 3300053156 Bacteria 27846
502 Ga0500622_0002771 3300053156 Bacteria 12332
503 Ga0500622_0003985 3300053156 Bacteria 9528
504 Ga0500624_001098 3300053157 Bacteria 5109
505 Ga0500627_0046520 3300053158 Bacteria 1880
506 Ga0500636_0123722 3300053177 Bacteria 1448
507 Ga0500637_0061953 3300053178 Bacteria 2143
508 Ga0500576_091809 3300053725 Bacteria 1259
509 Ga0500625_102172 3300053729 Bacteria 1199
510 Ga0500645_005399 3300053730 Bacteria 4711
511 Ga0500645_009863 3300053730 Bacteria 3189
512 Ga0500645_030083 3300053730 Bacteria 1636
513 Ga0500645_038787 3300053730 Bacteria 1412
514 Ga0500609_000093 3300053731 Bacteria 11592
515 Ga0500596_000363 3300053735 Bacteria 8223
516 Ga0500601_003237 3300053737 Bacteria 1765
517 Ga0500661_020169 3300055283 Bacteria 1185
518 Ga0587070_002120 3300059491 Bacteria 2195
519 Ga0587070_072604 3300059491 Bacteria 737
520 Ga0587082_018665 3300059504 Bacteria 1106
521 Ga0587090_001712 3300059510 Bacteria 2275
522 Ga0587092_012557 3300059512 Bacteria 1197
523 Ga0587101_008635 3300059623 Bacteria 1237
524 Ga0587076_030912 3300059645 Bacteria 948
525 Ga0587079_005405 3300059647 Bacteria 1805

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0117572 Ga0495670_0117572_388_1026 189
2 3300013105 Ga0157369_10406132 Ga0157369_104061322 193
3 3300049535 Ga0501319_005224 Ga0501319_005224_91_672 193
4 3300035111 Ga0373923_0172448 Ga0373923_0172448_111_749 194
5 3300053078 Ga0495612_0033758 Ga0495612_0033758_1083_1721 194
6 3300048917 Ga0496114_0245251 Ga0496114_0245251_547_1143 198
7 3300021384 Ga0213876_10000244 Ga0213876_1000024426 200
8 3300039437 Ga0436365_0376847 Ga0436365_0376847_8664_9302 200
9 3300039450 Ga0436363_0347296 Ga0436363_0347296_625_1263 200
10 3300025933 Ga0207706_10561516 Ga0207706_105615162 201
11 3300048906 Ga0496103_0131457 Ga0496103_0131457_466_1071 201
12 iso_pu_bacteria 2840878972 2840883971 201
13 iso_pu_bacteria 2854681122 2854685319 202
14 iso_pu_bacteria 2898795034 2898796997 202
15 iso_pu_bacteria 2899259804 2899262500 202
16 iso_pu_bacteria 3000017691 3000019217 202
17 3300033541 Ga0316596_1076669 Ga0316596_10766692 205
18 3300039062 Ga0400483_014056 Ga0400483_014056_398_1015 205
19 3300039062 Ga0400483_052325 Ga0400483_052325_634_1251 205
20 3300039062 Ga0400483_169471 Ga0400483_169471_834_1451 205
21 3300039062 Ga0400483_187305 Ga0400483_187305_3181_3798 205
22 iso_pu_bacteria 2739367756 2739792097 205
23 3300032168 Ga0316593_10019819 Ga0316593_100198191 206
24 3300032168 Ga0316593_10029449 Ga0316593_100294492 206
25 3300037418 Ga0395900_0130918 Ga0395900_0130918_1110_1730 206
26 3300037471 Ga0395905_0012867 Ga0395905_0012867_659_1279 206
27 3300037471 Ga0395905_0055624 Ga0395905_0055624_1184_1804 206
28 3300037471 Ga0395905_0079876 Ga0395905_0079876_806_1426 206
29 3300037853 Ga0436364_0059029 Ga0436364_0059029_247_867 206
30 3300045051 Ga0451576_0043660 Ga0451576_0043660_1519_2139 206
31 3300049529 Ga0501313_015433 Ga0501313_015433_232_852 206
32 3300049569 Ga0501032_0097203 Ga0501032_0097203_363_983 206
33 3300049571 Ga0501034_0000482 Ga0501034_0000482_46680_47300 206
34 3300049575 Ga0501039_0195868 Ga0501039_0195868_162_782 206
35 3300049577 Ga0501041_0093540 Ga0501041_0093540_609_1229 206
36 3300049587 Ga0501071_0320492 Ga0501071_0320492_503_1123 206
37 3300049776 Ga0501280_046869 Ga0501280_046869_86_706 206
38 3300049824 Ga0501045_0324855 Ga0501045_0324855_431_1051 206
39 3300059491 Ga0587070_002120 Ga0587070_002120_215_835 206
40 3300059623 Ga0587101_008635 Ga0587101_008635_82_702 206
41 3300059647 Ga0587079_005405 Ga0587079_005405_591_1211 206
42 3300039438 Ga0436360_0905641 Ga0436360_0905641_499_1137 207
43 3300042006 Ga0439432_034018 Ga0439432_034018_529_1152 207
44 3300046459 Ga0495629_0018598 Ga0495629_0018598_2522_3145 207
45 3300048906 Ga0496103_0177218 Ga0496103_0177218_536_1159 207
46 3300032133 Ga0316583_10029332 Ga0316583_100293323 208
47 iso_pu_bacteria 2510917020 2511120810 208
48 iso_pu_bacteria 2582581279 2585150050 208
49 iso_pu_bacteria 2582581280 2585155427 208
50 iso_pu_bacteria 2582581293 2585199211 208
51 iso_pu_bacteria 2585428106 2587919505 208
52 iso_pu_bacteria 2643221545 2643747995 208
53 iso_pu_bacteria 2643221552 2643781708 208
54 iso_pu_bacteria 2643221583 2643926357 208
55 iso_pu_bacteria 2643221584 2643931648 208
56 iso_pu_bacteria 2643221598 2643997884 208
57 iso_pu_bacteria 2643221614 2644088878 208
58 iso_pu_bacteria 2643221640 2644226564 208
59 iso_pu_bacteria 2643221642 2644236052 208
60 iso_pu_bacteria 2643221661 2644342240 208
61 iso_pu_bacteria 2643221666 2644369623 208
62 iso_pu_bacteria 2643221691 2644507902 208
63 iso_pu_bacteria 2791355048 2792463711 208
64 iso_pu_bacteria 2818991435 2819536864 208
65 iso_pu_bacteria 2818991454 2819646025 208
66 iso_pu_bacteria 2843744320 2843747085 208
67 iso_pu_bacteria 2849560528 2849560624 208
68 iso_pu_bacteria 2849573788 2849578465 208
69 iso_pu_bacteria 2851153111 2851154292 208
70 iso_pu_bacteria 2857504554 2857509517 208
71 iso_pu_bacteria 2884960567 2884961095 208
72 iso_pu_bacteria 2898329390 2898331304 208
73 iso_pu_bacteria 2928531327 2928535754 208
74 iso_pu_bacteria 2941485952 2941486936 208
75 3300039450 Ga0436363_0411020 Ga0436363_0411020_68_700 210
76 3300049581 Ga0501047_0199368 Ga0501047_0199368_874_1506 210
77 3300053087 Ga0500643_013812 Ga0500643_013812_1344_1976 210
78 3300053087 Ga0500643_029867 Ga0500643_029867_185_817 210
79 3300053096 Ga0500641_0002284 Ga0500641_0002284_1774_2406 210
80 3300053104 Ga0500556_0083999 Ga0500556_0083999_312_944 210
81 3300053108 Ga0500562_000644 Ga0500562_000644_371_1003 210
82 3300053108 Ga0500562_004084 Ga0500562_004084_802_1434 210
83 3300053117 Ga0500593_106042 Ga0500593_106042_448_1080 210
84 3300053139 Ga0500568_0044246 Ga0500568_0044246_394_1026 210
85 3300053153 Ga0500616_0081933 Ga0500616_0081933_689_1321 210
86 3300053730 Ga0500645_009863 Ga0500645_009863_1537_2169 210
87 3300053730 Ga0500645_030083 Ga0500645_030083_451_1083 210
88 3300005335 Ga0070666_10304828 Ga0070666_103048282 211
89 3300005834 Ga0068851_10283195 Ga0068851_102831952 211
90 3300005842 Ga0068858_100524477 Ga0068858_1005244772 211
91 3300009093 Ga0105240_10000798 Ga0105240_100007985 211
92 3300009177 Ga0105248_11214471 Ga0105248_112144712 211
93 3300013100 Ga0157373_10136423 Ga0157373_101364233 211
94 3300021361 Ga0213872_10005913 Ga0213872_100059136 211
95 3300025903 Ga0207680_10057755 Ga0207680_100577554 211
96 3300025913 Ga0207695_10010884 Ga0207695_1001088418 211
97 3300026035 Ga0207703_10464885 Ga0207703_104648852 211
98 3300027378 Ga0209981_1000276 Ga0209981_100027611 211
99 3300027462 Ga0210000_1022595 Ga0210000_10225952 211
100 3300027543 Ga0209999_1001058 Ga0209999_10010587 211
101 3300027665 Ga0209983_1005860 Ga0209983_10058602 211
102 3300028558 Ga0265326_10027785 Ga0265326_100277853 211
103 3300028573 Ga0265334_10006043 Ga0265334_100060432 211
104 3300028800 Ga0265338_10019380 Ga0265338_1001938011 211
105 3300028800 Ga0265338_10048593 Ga0265338_100485937 211
106 3300031456 Ga0307513_10016219 Ga0307513_100162196 211
107 3300031711 Ga0265314_10183534 Ga0265314_101835342 211
108 3300036401 Ga0373937_0407622 Ga0373937_0407622_473_1108 211
109 3300037853 Ga0436364_0151535 Ga0436364_0151535_113_754 211
110 3300039437 Ga0436365_1905157 Ga0436365_1905157_15_659 211
111 3300039438 Ga0436360_0409977 Ga0436360_0409977_579_1214 211
112 3300039447 Ga0436361_0953537 Ga0436361_0953537_19340_19978 211
113 3300039453 Ga0436362_0858043 Ga0436362_0858043_690_1334 211
114 3300045051 Ga0451576_0628970 Ga0451576_0628970_246_890 211
115 3300049581 Ga0501047_0569577 Ga0501047_0569577_159_794 211
116 3300053077 Ga0495601_0153663 Ga0495601_0153663_845_1480 211
117 3300053087 Ga0500643_003760 Ga0500643_003760_5800_6438 211
118 3300003693 Ga0032354_1009883 Ga0032354_10098833 212
119 3300003693 Ga0032354_1036765 Ga0032354_10367653 212
120 3300003773 Ga0055537_1004503 Ga0055537_10045032 212
121 3300003775 Ga0055524_1019052 Ga0055524_10190522 212
122 3300003790 Ga0055528_1007701 Ga0055528_10077019 212
123 3300003791 Ga0055530_10004523 Ga0055530_100045235 212
124 3300003791 Ga0055530_10022053 Ga0055530_100220531 212
125 3300003794 Ga0055531_10023544 Ga0055531_100235443 212
126 3300003794 Ga0055531_10029209 Ga0055531_100292092 212
127 3300005262 Ga0065165_1002762 Ga0065165_10027627 212
128 3300005262 Ga0065165_1007044 Ga0065165_10070445 212
129 3300005328 Ga0070676_10327453 Ga0070676_103274532 212
130 3300005329 Ga0070683_100461961 Ga0070683_1004619611 212
131 3300005331 Ga0070670_100000958 Ga0070670_1000009584 212
132 3300005331 Ga0070670_100063759 Ga0070670_1000637594 212
133 3300005331 Ga0070670_100528860 Ga0070670_1005288602 212
134 3300005334 Ga0068869_100511504 Ga0068869_1005115042 212
135 3300005335 Ga0070666_10288826 Ga0070666_102888262 212
136 3300005335 Ga0070666_10323942 Ga0070666_103239422 212
137 3300005339 Ga0070660_100140471 Ga0070660_1001404712 212
138 3300005341 Ga0070691_10004797 Ga0070691_100047976 212
139 3300005347 Ga0070668_100002473 Ga0070668_10000247322 212
140 3300005347 Ga0070668_100018845 Ga0070668_1000188452 212
141 3300005353 Ga0070669_100019075 Ga0070669_1000190754 212
142 3300005355 Ga0070671_100001396 Ga0070671_1000013965 212
143 3300005355 Ga0070671_100308137 Ga0070671_1003081372 212
144 3300005364 Ga0070673_100051075 Ga0070673_1000510752 212
145 3300005366 Ga0070659_100074275 Ga0070659_1000742752 212
146 3300005366 Ga0070659_100174117 Ga0070659_1001741172 212
147 3300005367 Ga0070667_100026034 Ga0070667_1000260348 212
148 3300005436 Ga0070713_101138790 Ga0070713_1011387901 212
149 3300005456 Ga0070678_100198955 Ga0070678_1001989553 212
150 3300005457 Ga0070662_100432256 Ga0070662_1004322561 212
151 3300005458 Ga0070681_10068278 Ga0070681_100682782 212
152 3300005458 Ga0070681_10099585 Ga0070681_100995852 212
153 3300005539 Ga0068853_100233197 Ga0068853_1002331972 212
154 3300005539 Ga0068853_100399888 Ga0068853_1003998882 212
155 3300005548 Ga0070665_100055537 Ga0070665_1000555373 212
156 3300005548 Ga0070665_100063485 Ga0070665_1000634856 212
157 3300005548 Ga0070665_100076823 Ga0070665_1000768236 212
158 3300005548 Ga0070665_100182043 Ga0070665_1001820433 212
159 3300005563 Ga0068855_100722076 Ga0068855_1007220762 212
160 3300005563 Ga0068855_100853769 Ga0068855_1008537692 212
161 3300005564 Ga0070664_100036245 Ga0070664_1000362456 212
162 3300005578 Ga0068854_100283607 Ga0068854_1002836072 212
163 3300005578 Ga0068854_100496692 Ga0068854_1004966921 212
164 3300005614 Ga0068856_100221172 Ga0068856_1002211723 212
165 3300005614 Ga0068856_100667723 Ga0068856_1006677232 212
166 3300005614 Ga0068856_101011214 Ga0068856_1010112141 212
167 3300005617 Ga0068859_100268032 Ga0068859_1002680323 212
168 3300005618 Ga0068864_100043582 Ga0068864_1000435823 212
169 3300005718 Ga0068866_10385722 Ga0068866_103857222 212
170 3300005719 Ga0068861_100060108 Ga0068861_1000601082 212
171 3300005841 Ga0068863_100045890 Ga0068863_1000458903 212
172 3300005841 Ga0068863_100064635 Ga0068863_1000646353 212
173 3300005842 Ga0068858_100050547 Ga0068858_1000505474 212
174 3300005843 Ga0068860_100001684 Ga0068860_1000016841 212
175 3300005843 Ga0068860_100022119 Ga0068860_1000221194 212
176 3300005844 Ga0068862_100028223 Ga0068862_1000282233 212
177 3300005844 Ga0068862_100305543 Ga0068862_1003055433 212
178 3300006042 Ga0075368_10008167 Ga0075368_100081674 212
179 3300006048 Ga0075363_100047678 Ga0075363_1000476782 212
180 3300006048 Ga0075363_100103319 Ga0075363_1001033192 212
181 3300006048 Ga0075363_100438543 Ga0075363_1004385432 212
182 3300006051 Ga0075364_10001038 Ga0075364_1000103822 212
183 3300006178 Ga0075367_10001012 Ga0075367_100010124 212
184 3300006186 Ga0075369_10010071 Ga0075369_100100713 212
185 3300006195 Ga0075366_10059395 Ga0075366_100593953 212
186 3300006195 Ga0075366_10115902 Ga0075366_101159023 212
187 3300006195 Ga0075366_10127469 Ga0075366_101274692 212
188 3300006195 Ga0075366_10355356 Ga0075366_103553562 212
189 3300006195 Ga0075366_10571149 Ga0075366_105711491 212
190 3300006353 Ga0075370_10027150 Ga0075370_100271502 212
191 3300006353 Ga0075370_10202409 Ga0075370_102024093 212
192 3300006881 Ga0068865_100013511 Ga0068865_1000135115 212
193 3300006931 Ga0097620_100268025 Ga0097620_1002680252 212
194 3300009093 Ga0105240_10230206 Ga0105240_102302063 212
195 3300009093 Ga0105240_10335083 Ga0105240_103350833 212
196 3300009093 Ga0105240_10386595 Ga0105240_103865952 212
197 3300009093 Ga0105240_10406436 Ga0105240_104064362 212
198 3300009093 Ga0105240_10524597 Ga0105240_105245972 212
199 3300009098 Ga0105245_10635073 Ga0105245_106350733 212
200 3300009148 Ga0105243_11099686 Ga0105243_110996862 212
201 3300009174 Ga0105241_10051142 Ga0105241_100511425 212
202 3300009176 Ga0105242_10218000 Ga0105242_102180002 212
203 3300009177 Ga0105248_10008835 Ga0105248_100088357 212
204 3300009177 Ga0105248_10259890 Ga0105248_102598902 212
205 3300009177 Ga0105248_10382456 Ga0105248_103824563 212
206 3300009551 Ga0105238_10232374 Ga0105238_102323742 212
207 3300009551 Ga0105238_10593494 Ga0105238_105934942 212
208 3300009553 Ga0105249_10041843 Ga0105249_100418436 212
209 3300009553 Ga0105249_10257956 Ga0105249_102579562 212
210 3300010375 Ga0105239_10294484 Ga0105239_102944843 212
211 3300010375 Ga0105239_10652689 Ga0105239_106526892 212
212 3300011119 Ga0105246_10521316 Ga0105246_105213162 212
213 3300013104 Ga0157370_10114023 Ga0157370_101140232 212
214 3300013105 Ga0157369_10018315 Ga0157369_100183152 212
215 3300013296 Ga0157374_10493874 Ga0157374_104938742 212
216 3300013296 Ga0157374_10986379 Ga0157374_109863791 212
217 3300013297 Ga0157378_10653213 Ga0157378_106532132 212
218 3300013306 Ga0163162_10080358 Ga0163162_100803582 212
219 3300013307 Ga0157372_10364270 Ga0157372_103642702 212
220 3300013308 Ga0157375_10429715 Ga0157375_104297153 212
221 3300014325 Ga0163163_10009581 Ga0163163_1000958115 212
222 3300014325 Ga0163163_10439545 Ga0163163_104395452 212
223 3300014326 Ga0157380_10548407 Ga0157380_105484072 212
224 3300014497 Ga0182008_10084129 Ga0182008_100841292 212
225 3300014968 Ga0157379_10041021 Ga0157379_100410214 212
226 3300014968 Ga0157379_10898562 Ga0157379_108985621 212
227 3300015262 Ga0182007_10037419 Ga0182007_100374191 212
228 3300025273 Ga0209673_1001876 Ga0209673_10018768 212
229 3300025292 Ga0209676_1022325 Ga0209676_10223253 212
230 3300025295 Ga0209564_1007568 Ga0209564_100756812 212
231 3300025297 Ga0209758_1002168 Ga0209758_10021686 212
232 3300025297 Ga0209758_1023594 Ga0209758_10235942 212
233 3300025298 Ga0209050_1000161 Ga0209050_100016188 212
234 3300025298 Ga0209050_1019693 Ga0209050_10196933 212
235 3300025299 Ga0209256_1003893 Ga0209256_10038934 212
236 3300025303 Ga0209051_1000877 Ga0209051_100087724 212
237 3300025304 Ga0209257_1000252 Ga0209257_100025288 212
238 3300025304 Ga0209257_1000976 Ga0209257_100097650 212
239 3300025304 Ga0209257_1008377 Ga0209257_100837711 212
240 3300025304 Ga0209257_1010622 Ga0209257_10106227 212
241 3300025321 Ga0207656_10099352 Ga0207656_100993522 212
242 3300025903 Ga0207680_10043744 Ga0207680_100437443 212
243 3300025907 Ga0207645_10029047 Ga0207645_100290475 212
244 3300025908 Ga0207643_10064023 Ga0207643_100640233 212
245 3300025909 Ga0207705_10018153 Ga0207705_100181533 212
246 3300025911 Ga0207654_10077845 Ga0207654_100778452 212
247 3300025912 Ga0207707_10183495 Ga0207707_101834952 212
248 3300025913 Ga0207695_10000575 Ga0207695_100005756 212
249 3300025913 Ga0207695_10273409 Ga0207695_102734092 212
250 3300025913 Ga0207695_10372193 Ga0207695_103721932 212
251 3300025914 Ga0207671_10217066 Ga0207671_102170662 212
252 3300025917 Ga0207660_10000537 Ga0207660_100005376 212
253 3300025917 Ga0207660_10193464 Ga0207660_101934643 212
254 3300025920 Ga0207649_10107742 Ga0207649_101077422 212
255 3300025920 Ga0207649_10355036 Ga0207649_103550362 212
256 3300025921 Ga0207652_10002134 Ga0207652_1000213425 212
257 3300025923 Ga0207681_10164779 Ga0207681_101647793 212
258 3300025924 Ga0207694_10228390 Ga0207694_102283902 212
259 3300025924 Ga0207694_10244076 Ga0207694_102440763 212
260 3300025925 Ga0207650_10000883 Ga0207650_1000088334 212
261 3300025925 Ga0207650_10051081 Ga0207650_100510812 212
262 3300025928 Ga0207700_10184548 Ga0207700_101845482 212
263 3300025931 Ga0207644_10019776 Ga0207644_100197765 212
264 3300025931 Ga0207644_10035600 Ga0207644_100356005 212
265 3300025932 Ga0207690_10018048 Ga0207690_100180482 212
266 3300025932 Ga0207690_10175415 Ga0207690_101754152 212
267 3300025933 Ga0207706_10019813 Ga0207706_100198133 212
268 3300025941 Ga0207711_10001469 Ga0207711_100014697 212
269 3300025941 Ga0207711_10112712 Ga0207711_101127124 212
270 3300025941 Ga0207711_10245260 Ga0207711_102452601 212
271 3300025942 Ga0207689_10604496 Ga0207689_106044961 212
272 3300025945 Ga0207679_10207149 Ga0207679_102071492 212
273 3300025949 Ga0207667_10166618 Ga0207667_101666182 212
274 3300025949 Ga0207667_10259986 Ga0207667_102599862 212
275 3300025949 Ga0207667_10906985 Ga0207667_109069852 212
276 3300025960 Ga0207651_10395513 Ga0207651_103955131 212
277 3300025961 Ga0207712_10002131 Ga0207712_1000213120 212
278 3300025972 Ga0207668_10000363 Ga0207668_1000036331 212
279 3300025972 Ga0207668_10000571 Ga0207668_100005714 212
280 3300025972 Ga0207668_10037129 Ga0207668_100371295 212
281 3300025972 Ga0207668_10037130 Ga0207668_100371302 212
282 3300025981 Ga0207640_10178996 Ga0207640_101789962 212
283 3300025981 Ga0207640_10410162 Ga0207640_104101622 212
284 3300025986 Ga0207658_10001253 Ga0207658_1000125332 212
285 3300025986 Ga0207658_10012581 Ga0207658_100125816 212
286 3300026023 Ga0207677_10475628 Ga0207677_104756283 212
287 3300026035 Ga0207703_10013988 Ga0207703_100139882 212
288 3300026035 Ga0207703_10086143 Ga0207703_100861435 212
289 3300026041 Ga0207639_10053240 Ga0207639_100532403 212
290 3300026067 Ga0207678_10183294 Ga0207678_101832943 212
291 3300026078 Ga0207702_10266138 Ga0207702_102661382 212
292 3300026078 Ga0207702_10348651 Ga0207702_103486513 212
293 3300026089 Ga0207648_10273356 Ga0207648_102733561 212
294 3300026095 Ga0207676_10010270 Ga0207676_100102706 212
295 3300026116 Ga0207674_10336853 Ga0207674_103368531 212
296 3300026118 Ga0207675_100039241 Ga0207675_1000392415 212
297 3300027866 Ga0209813_10061568 Ga0209813_100615683 212
298 3300028379 Ga0268266_10000311 Ga0268266_1000031170 212
299 3300028379 Ga0268266_10023680 Ga0268266_100236806 212
300 3300028379 Ga0268266_10040775 Ga0268266_100407757 212
301 3300028379 Ga0268266_10053859 Ga0268266_100538596 212
302 3300028379 Ga0268266_10077149 Ga0268266_100771493 212
303 3300028380 Ga0268265_10004022 Ga0268265_1000402210 212
304 3300028380 Ga0268265_10695882 Ga0268265_106958822 212
305 3300028381 Ga0268264_10000383 Ga0268264_100003833 212
306 3300028381 Ga0268264_10002325 Ga0268264_100023256 212
307 3300028381 Ga0268264_10072664 Ga0268264_100726641 212
308 3300028786 Ga0307517_10130623 Ga0307517_101306233 212
309 3300028800 Ga0265338_10442167 Ga0265338_104421672 212
310 3300029957 Ga0265324_10119872 Ga0265324_101198722 212
311 3300030521 Ga0307511_10006537 Ga0307511_100065375 212
312 3300030522 Ga0307512_10169625 Ga0307512_101696253 212
313 3300031251 Ga0265327_10000381 Ga0265327_1000038176 212
314 3300031251 Ga0265327_10007046 Ga0265327_100070464 212
315 3300031251 Ga0265327_10042304 Ga0265327_100423043 212
316 3300031251 Ga0265327_10055621 Ga0265327_100556212 212
317 3300031456 Ga0307513_10000162 Ga0307513_100001625 212
318 3300031456 Ga0307513_10010515 Ga0307513_100105154 212
319 3300031456 Ga0307513_10198590 Ga0307513_101985902 212
320 3300031711 Ga0265314_10053314 Ga0265314_100533146 212
321 3300031711 Ga0265314_10083091 Ga0265314_100830913 212
322 3300031730 Ga0307516_10001565 Ga0307516_1000156542 212
323 3300031824 Ga0307413_10002271 Ga0307413_100022714 212
324 3300031901 Ga0307406_10115754 Ga0307406_101157543 212
325 3300032002 Ga0307416_100235587 Ga0307416_1002355872 212
326 3300032005 Ga0307411_10055871 Ga0307411_100558713 212
327 3300033180 Ga0307510_10078548 Ga0307510_100785482 212
328 3300035083 Ga0373926_0062463 Ga0373926_0062463_352_990 212
329 3300035171 Ga0373946_0016115 Ga0373946_0016115_1381_2019 212
330 3300035691 Ga0373931_0114957 Ga0373931_0114957_712_1350 212
331 3300035695 Ga0373927_0000479 Ga0373927_0000479_28764_29402 212
332 3300035695 Ga0373927_0165324 Ga0373927_0165324_595_1233 212
333 3300035725 Ga0373947_0084504 Ga0373947_0084504_412_1050 212
334 3300037068 Ga0373925_0000023 Ga0373925_0000023_14859_15497 212
335 3300037068 Ga0373925_0175832 Ga0373925_0175832_449_1087 212
336 3300037312 Ga0395899_0001195 Ga0395899_0001195_3409_4047 212
337 3300037312 Ga0395899_0322286 Ga0395899_0322286_323_961 212
338 3300037418 Ga0395900_0006999 Ga0395900_0006999_7636_8274 212
339 3300037418 Ga0395900_0250561 Ga0395900_0250561_736_1374 212
340 3300037466 Ga0395898_0004322 Ga0395898_0004322_3410_4048 212
341 3300037466 Ga0395898_0071967 Ga0395898_0071967_624_1262 212
342 3300037466 Ga0395898_0118241 Ga0395898_0118241_1096_1734 212
343 3300037471 Ga0395905_0006270 Ga0395905_0006270_7196_7834 212
344 3300037471 Ga0395905_0096583 Ga0395905_0096583_1325_1963 212
345 3300038443 Ga0395901_0000342 Ga0395901_0000342_52708_53346 212
346 3300038443 Ga0395901_0140376 Ga0395901_0140376_1084_1722 212
347 3300039437 Ga0436365_1891356 Ga0436365_1891356_1661_2311 212
348 3300039438 Ga0436360_0164499 Ga0436360_0164499_95_748 212
349 3300039447 Ga0436361_0100802 Ga0436361_0100802_51_689 212
350 3300039450 Ga0436363_0944849 Ga0436363_0944849_238_879 212
351 3300039450 Ga0436363_1544180 Ga0436363_1544180_287_925 212
352 3300041410 Ga0439461_0048469 Ga0439461_0048469_126_764 212
353 3300041452 Ga0451793_0183211 Ga0451793_0183211_355_993 212
354 3300041509 Ga0451843_1158826 Ga0451843_1158826_528_1166 212
355 3300042000 Ga0439437_004749 Ga0439437_004749_454_1092 212
356 3300042002 Ga0439442_014552 Ga0439442_014552_324_962 212
357 3300042004 Ga0439445_0007571 Ga0439445_0007571_1158_1796 212
358 3300042007 Ga0439449_0064267 Ga0439449_0064267_606_1244 212
359 3300042127 Ga0450890_010332 Ga0450890_010332_104_742 212
360 3300042156 Ga0439446_0066307 Ga0439446_0066307_340_978 212
361 3300042156 Ga0439446_0110932 Ga0439446_0110932_10_648 212
362 3300042438 Ga0439459_0000576 Ga0439459_0000576_2030_2668 212
363 3300042530 Ga0450916_000234 Ga0450916_000234_3220_3858 212
364 3300042532 Ga0450893_0006119 Ga0450893_0006119_1276_1914 212
365 3300044693 Ga0466961_0106082 Ga0466961_0106082_73_711 212
366 3300044712 Ga0453684_0534082 Ga0453684_0534082_632_1270 212
367 3300044765 Ga0466970_0057669 Ga0466970_0057669_716_1354 212
368 3300046453 Ga0495627_000399 Ga0495627_000399_3245_3883 212
369 3300046454 Ga0495592_0250504 Ga0495592_0250504_41_679 212
370 3300046457 Ga0495590_0000851 Ga0495590_0000851_11126_11764 212
371 3300046471 Ga0495650_0001571 Ga0495650_0001571_15391_16029 212
372 3300046491 Ga0495584_0192109 Ga0495584_0192109_184_822 212
373 3300046492 Ga0495585_0057569 Ga0495585_0057569_195_833 212
374 3300046492 Ga0495585_0205759 Ga0495585_0205759_100_738 212
375 3300046501 Ga0495607_0207421 Ga0495607_0207421_240_878 212
376 3300046506 Ga0495583_0000650 Ga0495583_0000650_12204_12842 212
377 3300046507 Ga0495606_0013477 Ga0495606_0013477_4601_5239 212
378 3300046507 Ga0495606_0067825 Ga0495606_0067825_256_894 212
379 3300046507 Ga0495606_0137467 Ga0495606_0137467_513_1151 212
380 3300046507 Ga0495606_0151705 Ga0495606_0151705_194_832 212
381 3300046512 Ga0495610_0013510 Ga0495610_0013510_2907_3545 212
382 3300046512 Ga0495610_0026700 Ga0495610_0026700_23_661 212
383 3300046513 Ga0495616_0069112 Ga0495616_0069112_87_725 212
384 3300046515 Ga0495620_0013485 Ga0495620_0013485_1471_2109 212
385 3300046518 Ga0495631_0019391 Ga0495631_0019391_751_1389 212
386 3300046519 Ga0495632_0004552 Ga0495632_0004552_748_1386 212
387 3300046520 Ga0495637_0016956 Ga0495637_0016956_2432_3070 212
388 3300046522 Ga0495643_0002864 Ga0495643_0002864_8960_9598 212
389 3300046522 Ga0495643_0206625 Ga0495643_0206625_89_727 212
390 3300046523 Ga0495644_0147466 Ga0495644_0147466_178_816 212
391 3300046524 Ga0495648_0002288 Ga0495648_0002288_15283_15921 212
392 3300046524 Ga0495648_0137128 Ga0495648_0137128_566_1204 212
393 3300046525 Ga0495663_0065355 Ga0495663_0065355_254_892 212
394 3300046525 Ga0495663_0071665 Ga0495663_0071665_70_708 212
395 3300046528 Ga0495642_0013507 Ga0495642_0013507_1736_2374 212
396 3300046530 Ga0495654_0006712 Ga0495654_0006712_5787_6425 212
397 3300046538 Ga0495609_0030354 Ga0495609_0030354_1360_1998 212
398 3300046542 Ga0495597_0013809 Ga0495597_0013809_769_1407 212
399 3300046542 Ga0495597_0033708 Ga0495597_0033708_541_1179 212
400 3300046542 Ga0495597_0043806 Ga0495597_0043806_865_1503 212
401 3300046557 Ga0495622_0002985 Ga0495622_0002985_6858_7496 212
402 3300046558 Ga0495633_0080184 Ga0495633_0080184_654_1292 212
403 3300046616 Ga0495668_0001818 Ga0495668_0001818_13303_13941 212
404 3300046616 Ga0495668_0019185 Ga0495668_0019185_1944_2582 212
405 3300046616 Ga0495668_0050196 Ga0495668_0050196_93_731 212
406 3300046616 Ga0495668_0098794 Ga0495668_0098794_269_907 212
407 3300046616 Ga0495668_0213466 Ga0495668_0213466_34_672 212
408 3300046648 Ga0495611_0077613 Ga0495611_0077613_70_708 212
409 3300046660 Ga0495625_0001925 Ga0495625_0001925_10906_11544 212
410 3300046660 Ga0495625_0058314 Ga0495625_0058314_305_943 212
411 3300046660 Ga0495625_0083154 Ga0495625_0083154_131_769 212
412 3300046660 Ga0495625_0210534 Ga0495625_0210534_94_732 212
413 3300046665 Ga0495661_0138934 Ga0495661_0138934_196_834 212
414 3300046684 Ga0495669_0000044 Ga0495669_0000044_82592_83230 212
415 3300046684 Ga0495669_0000371 Ga0495669_0000371_6457_7095 212
416 3300046684 Ga0495669_0021716 Ga0495669_0021716_1128_1766 212
417 3300046684 Ga0495669_0036871 Ga0495669_0036871_1194_1832 212
418 3300046689 Ga0495613_0000576 Ga0495613_0000576_27790_28428 212
419 3300046691 Ga0495670_0168018 Ga0495670_0168018_173_811 212
420 3300046694 Ga0495649_0131040 Ga0495649_0131040_510_1148 212
421 3300046794 Ga0495589_0034715 Ga0495589_0034715_723_1361 212
422 3300047318 Ga0495636_0026912 Ga0495636_0026912_301_939 212
423 3300047320 Ga0495672_0000439 Ga0495672_0000439_44819_45457 212
424 3300047320 Ga0495672_0094949 Ga0495672_0094949_440_1078 212
425 3300047323 Ga0495683_0011199 Ga0495683_0011199_3621_4259 212
426 3300047443 Ga0495687_080693 Ga0495687_080693_76_714 212
427 3300047445 Ga0495677_0023144 Ga0495677_0023144_1310_1948 212
428 3300047445 Ga0495677_0041039 Ga0495677_0041039_721_1359 212
429 3300047446 Ga0495679_006048 Ga0495679_006048_2109_2747 212
430 3300047469 Ga0495673_0000189 Ga0495673_0000189_98358_98996 212
431 3300047469 Ga0495673_0155445 Ga0495673_0155445_98_736 212
432 3300047470 Ga0495681_0064653 Ga0495681_0064653_967_1605 212
433 3300047472 Ga0495686_0007469 Ga0495686_0007469_480_1118 212
434 3300047472 Ga0495686_0026646 Ga0495686_0026646_2488_3126 212
435 3300047472 Ga0495686_0070592 Ga0495686_0070592_794_1432 212
436 3300047472 Ga0495686_0184807 Ga0495686_0184807_470_1108 212
437 3300047673 Ga0495593_0029058 Ga0495593_0029058_1598_2236 212
438 3300048908 Ga0496105_0090149 Ga0496105_0090149_870_1508 212
439 3300048909 Ga0496106_0006912 Ga0496106_0006912_915_1553 212
440 3300048909 Ga0496106_0180175 Ga0496106_0180175_728_1366 212
441 3300048910 Ga0496107_0000073 Ga0496107_0000073_47762_48400 212
442 3300048910 Ga0496107_0146752 Ga0496107_0146752_145_783 212
443 3300048912 Ga0496109_0134272 Ga0496109_0134272_1620_2258 212
444 3300048915 Ga0496112_0020616 Ga0496112_0020616_2418_3056 212
445 3300048915 Ga0496112_0037337 Ga0496112_0037337_1287_1925 212
446 3300048916 Ga0496113_0515605 Ga0496113_0515605_217_855 212
447 3300048918 Ga0496115_0021048 Ga0496115_0021048_1003_1641 212
448 3300048918 Ga0496115_0049703 Ga0496115_0049703_1244_1882 212
449 3300048918 Ga0496115_0354921 Ga0496115_0354921_513_1151 212
450 3300048918 Ga0496115_0614869 Ga0496115_0614869_96_734 212
451 3300048919 Ga0496116_0134067 Ga0496116_0134067_599_1237 212
452 3300048920 Ga0496117_0020336 Ga0496117_0020336_2229_2867 212
453 3300048921 Ga0496118_0014068 Ga0496118_0014068_4444_5082 212
454 3300048921 Ga0496118_0293978 Ga0496118_0293978_247_885 212
455 3300048922 Ga0496119_0041993 Ga0496119_0041993_1510_2148 212
456 3300048924 Ga0496121_0000946 Ga0496121_0000946_30320_30958 212
457 3300048924 Ga0496121_0025980 Ga0496121_0025980_4461_5099 212
458 3300048924 Ga0496121_0242092 Ga0496121_0242092_540_1178 212
459 3300048928 Ga0496125_0023733 Ga0496125_0023733_996_1634 212
460 3300048928 Ga0496125_0059294 Ga0496125_0059294_100_738 212
461 3300049131 Ga0501341_02423 Ga0501341_02423_315_953 212
462 3300049459 Ga0495678_001705 Ga0495678_001705_1926_2564 212
463 3300049460 Ga0495682_0062724 Ga0495682_0062724_497_1135 212
464 3300049527 Ga0501311_018176 Ga0501311_018176_262_900 212
465 3300049528 Ga0501312_008613 Ga0501312_008613_673_1311 212
466 3300049529 Ga0501313_024125 Ga0501313_024125_27_665 212
467 3300049532 Ga0501316_018267 Ga0501316_018267_129_767 212
468 3300049535 Ga0501319_000756 Ga0501319_000756_889_1527 212
469 3300049536 Ga0501320_011731 Ga0501320_011731_14_652 212
470 3300049537 Ga0501321_006939 Ga0501321_006939_387_1028 212
471 3300049539 Ga0501323_002237 Ga0501323_002237_137_775 212
472 3300049540 Ga0501324_002768 Ga0501324_002768_345_983 212
473 3300049541 Ga0501325_003636 Ga0501325_003636_46_684 212
474 3300049569 Ga0501032_0316542 Ga0501032_0316542_149_790 212
475 3300049570 Ga0501033_0109003 Ga0501033_0109003_837_1475 212
476 3300049570 Ga0501033_0121202 Ga0501033_0121202_277_915 212
477 3300049571 Ga0501034_0077264 Ga0501034_0077264_847_1488 212
478 3300049573 Ga0501037_0132584 Ga0501037_0132584_282_920 212
479 3300049579 Ga0501043_0233205 Ga0501043_0233205_665_1303 212
480 3300049581 Ga0501047_0021902 Ga0501047_0021902_1069_1707 212
481 3300049586 Ga0501070_0063354 Ga0501070_0063354_2080_2721 212
482 3300049671 Ga0501238_000524 Ga0501238_000524_911_1549 212
483 3300049686 Ga0501257_016026 Ga0501257_016026_89_727 212
484 3300049744 Ga0501083_0314903 Ga0501083_0314903_324_962 212
485 3300049823 Ga0501044_0032239 Ga0501044_0032239_2629_3267 212
486 3300050490 nmdc:mga03n38_123713_c1 nmdc:mga03n38_123713_c1_286_924 212
487 3300050491 nmdc:mga00v17_4550_c1 nmdc:mga00v17_4550_c1_5638_6276 212
488 3300050493 nmdc:mga0k408_174832_c1 nmdc:mga0k408_174832_c1_451_1089 212
489 3300050493 nmdc:mga0k408_62374_c1 nmdc:mga0k408_62374_c1_233_871 212
490 3300050494 nmdc:mga06z11_319018_c1 nmdc:mga06z11_319018_c1_242_880 212
491 3300050494 nmdc:mga06z11_6498_c1 nmdc:mga06z11_6498_c1_540_1178 212
492 3300050495 nmdc:mga04h51_7138_c1 nmdc:mga04h51_7138_c1_1651_2289 212
493 3300050496 nmdc:mga07m45_250452_c1 nmdc:mga07m45_250452_c1_348_986 212
494 3300050496 nmdc:mga07m45_45178_c1 nmdc:mga07m45_45178_c1_981_1619 212
495 3300050496 nmdc:mga07m45_57184_c1 nmdc:mga07m45_57184_c1_48_689 212
496 3300050496 nmdc:mga07m45_60756_c1 nmdc:mga07m45_60756_c1_1324_1962 212
497 3300053080 Ga0500635_0000205 Ga0500635_0000205_25822_26460 212
498 3300053086 Ga0500578_0000459 Ga0500578_0000459_35463_36101 212
499 3300053087 Ga0500643_022575 Ga0500643_022575_920_1558 212
500 3300053088 Ga0500644_0000193 Ga0500644_0000193_13272_13910 212
501 3300053090 Ga0500646_0077311 Ga0500646_0077311_88_726 212
502 3300053091 Ga0500647_0049633 Ga0500647_0049633_1107_1745 212
503 3300053092 Ga0500583_0061517 Ga0500583_0061517_794_1432 212
504 3300053093 Ga0500651_0003210 Ga0500651_0003210_896_1534 212
505 3300053094 Ga0500566_0015189 Ga0500566_0015189_2381_3019 212
506 3300053094 Ga0500566_0198852 Ga0500566_0198852_305_943 212
507 3300053096 Ga0500641_0002384 Ga0500641_0002384_4573_5214 212
508 3300053096 Ga0500641_0003388 Ga0500641_0003388_1731_2369 212
509 3300053096 Ga0500641_0046486 Ga0500641_0046486_351_989 212
510 3300053098 Ga0500650_0035877 Ga0500650_0035877_626_1264 212
511 3300053102 Ga0500554_000324 Ga0500554_000324_8738_9376 212
512 3300053103 Ga0500555_001699 Ga0500555_001699_2511_3149 212
513 3300053104 Ga0500556_0001068 Ga0500556_0001068_11928_12566 212
514 3300053104 Ga0500556_0027981 Ga0500556_0027981_279_917 212
515 3300053109 Ga0500569_000322 Ga0500569_000322_2389_3027 212
516 3300053111 Ga0500572_066175 Ga0500572_066175_110_748 212
517 3300053118 Ga0500594_0000153 Ga0500594_0000153_4106_4744 212
518 3300053119 Ga0500595_001651 Ga0500595_001651_8140_8778 212
519 3300053119 Ga0500595_007692 Ga0500595_007692_1967_2605 212
520 3300053121 Ga0500607_051245 Ga0500607_051245_576_1214 212
521 3300053122 Ga0500608_000165 Ga0500608_000165_1140_1778 212
522 3300053122 Ga0500608_004302 Ga0500608_004302_3921_4559 212
523 3300053122 Ga0500608_117892 Ga0500608_117892_460_1098 212
524 3300053123 Ga0500614_000617 Ga0500614_000617_2178_2816 212
525 3300053123 Ga0500614_054013 Ga0500614_054013_88_726 212
526 3300053125 Ga0500618_000703 Ga0500618_000703_6315_6953 212
527 3300053129 Ga0500628_108157 Ga0500628_108157_64_702 212
528 3300053131 Ga0500652_102870 Ga0500652_102870_261_899 212
529 3300053133 Ga0500655_020777 Ga0500655_020777_235_873 212
530 3300053134 Ga0500658_0001787 Ga0500658_0001787_2474_3112 212
531 3300053136 Ga0500559_0000113 Ga0500559_0000113_58091_58729 212
532 3300053136 Ga0500559_0001398 Ga0500559_0001398_1154_1792 212
533 3300053136 Ga0500559_0016148 Ga0500559_0016148_980_1618 212
534 3300053138 Ga0500564_000145 Ga0500564_000145_4426_5064 212
535 3300053148 Ga0500590_085514 Ga0500590_085514_356_994 212
536 3300053150 Ga0500603_003920 Ga0500603_003920_860_1498 212
537 3300053155 Ga0500620_060729 Ga0500620_060729_272_910 212
538 3300053156 Ga0500622_0000771 Ga0500622_0000771_9937_10575 212
539 3300053156 Ga0500622_0002771 Ga0500622_0002771_4817_5458 212
540 3300053156 Ga0500622_0003985 Ga0500622_0003985_7725_8363 212
541 3300053157 Ga0500624_001098 Ga0500624_001098_519_1157 212
542 3300053158 Ga0500627_0046520 Ga0500627_0046520_803_1441 212
543 3300053177 Ga0500636_0123722 Ga0500636_0123722_776_1414 212
544 3300053178 Ga0500637_0061953 Ga0500637_0061953_737_1375 212
545 3300053725 Ga0500576_091809 Ga0500576_091809_590_1228 212
546 3300053729 Ga0500625_102172 Ga0500625_102172_387_1025 212
547 3300053730 Ga0500645_005399 Ga0500645_005399_783_1421 212
548 3300053730 Ga0500645_038787 Ga0500645_038787_339_977 212
549 3300053731 Ga0500609_000093 Ga0500609_000093_3782_4420 212
550 3300053735 Ga0500596_000363 Ga0500596_000363_7158_7796 212
551 3300053737 Ga0500601_003237 Ga0500601_003237_138_776 212
552 3300055283 Ga0500661_020169 Ga0500661_020169_33_671 212
553 3300059491 Ga0587070_072604 Ga0587070_072604_70_708 212
554 3300059504 Ga0587082_018665 Ga0587082_018665_269_907 212
555 3300059510 Ga0587090_001712 Ga0587090_001712_1314_1952 212
556 3300059512 Ga0587092_012557 Ga0587092_012557_370_1008 212
557 3300059645 Ga0587076_030912 Ga0587076_030912_165_803 212
558 3300039438 Ga0436360_0551958 Ga0436360_0551958_1412_2215 213
559 3300003215 JGI25153J46596_10020623 JGI25153J46596_100206233 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

16

205

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8907 13 203
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8783 3 203
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8626 3 203
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8616 3 203
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8464 3 203
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7883 1 203 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7753 1 203 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7497 1 203 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7493 1 203 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7392 1 203 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A434FBH1-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9843 108 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A258B788-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9764 127 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A537R4I8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9646 108 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A529VK89-F1-model_v4 deleted 0.9551 90 203
AF-A0A356NL58-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9471 98 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
76.5 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map