F463430

General Info

Members Datasets Scaffolds Average Seq Length
558 348 1116 182

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11436778|Ga0105245_114367781
Length 204
Sequence LVRNDPGAPAARILVFRRSLTMTVEISELTGDYVLDPAHTRIGFVARHAMVTKVRGSFDEFAGTAVLDGANPANSRVEVTIEAASIDTRNAQRDEHLRGNDFLAMQEYPKITFASTSVRQAGETTFEVTGDLTIKGVTNEITIPFEFEGAAKDPFGNQRVGFEGAVTINRKDYGVTWNAALEGGGVLVSDKVTLEFEISAIKNA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
94 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
95 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
96 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
108 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
336 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
343 2857727296 Kocuria sp. R-72562 Isolate Unclassified
344 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
345 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
346 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
347 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
348 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.42
Metatranscriptomes 21.33
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 3.58
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_11436778 3300009098 Bacteria 740
2 LJQas_1007609 3300000549 Bacteria 1329
3 Ga0006759J45824_1023206 3300003163 Bacteria 615
4 Ga0007421J48921_107594 3300003291 Bacteria 586
5 Ga0006777J48905_1027565 3300003308 Bacteria 799
6 Ga0006781J51513_1008924 3300003568 Bacteria 613
7 Ga0007410J51695_1008052 3300003574 Bacteria 620
8 Ga0007410J51695_1071643 3300003574 Bacteria 654
9 Ga0007410J51695_1099369 3300003574 Bacteria 603
10 Ga0007409J51694_1019461 3300003575 Bacteria 617
11 Ga0007409J51694_1036946 3300003575 Bacteria 694
12 Ga0006562J51391_1008540 3300003578 Bacteria 1370
13 Ga0007429J51699_1009571 3300003579 Bacteria 616
14 Ga0007429J51699_1017224 3300003579 Bacteria 1467
15 Ga0007429J51699_1047111 3300003579 Bacteria 616
16 Ga0007429J51699_1077971 3300003579 Bacteria 624
17 Ga0007429J51699_1079537 3300003579 Bacteria 652
18 Ga0007411J51799_107783 3300003611 Bacteria 621
19 JGI25404J52841_10003389 3300003659 Bacteria 3147
20 Ga0032354_1025493 3300003693 Bacteria 605
21 Ga0055542_1002604 3300003762 Bacteria 5699
22 JGI25405J52794_10018077 3300003911 Bacteria 1405
23 Ga0058858_1349167 3300004785 Bacteria 940
24 Ga0058860_10228110 3300004801 Bacteria 1079
25 Ga0070658_10175108 3300005327 Bacteria 1804
26 Ga0070683_100020080 3300005329 Bacteria 5941
27 Ga0070683_100099407 3300005329 Bacteria 2738
28 Ga0070683_100713400 3300005329 Bacteria 961
29 Ga0070670_100191029 3300005331 Bacteria 1779
30 Ga0068869_100113677 3300005334 Bacteria 2062
31 Ga0070666_10020240 3300005335 Bacteria 4300
32 Ga0070682_100119600 3300005337 Bacteria 1766
33 Ga0070682_100128169 3300005337 Bacteria 1714
34 Ga0068868_100129720 3300005338 Bacteria 2062
35 Ga0068868_100620983 3300005338 Bacteria 959
36 Ga0070660_100138721 3300005339 Bacteria 1949
37 Ga0070660_100742907 3300005339 Bacteria 824
38 Ga0070691_10036601 3300005341 Bacteria 2313
39 Ga0070687_100293597 3300005343 Bacteria 1028
40 Ga0070661_100046095 3300005344 Bacteria 3188
41 Ga0070692_10192306 3300005345 Bacteria 1190
42 Ga0070675_100258489 3300005354 Bacteria 1525
43 Ga0070671_100089049 3300005355 Bacteria 2583
44 Ga0070674_100713115 3300005356 Bacteria 859
45 Ga0070673_100407694 3300005364 Bacteria 1216
46 Ga0070688_100014210 3300005365 Bacteria 4508
47 Ga0070659_100220994 3300005366 Bacteria 1563
48 Ga0070703_10007341 3300005406 Bacteria 3092
49 Ga0070709_10264787 3300005434 Bacteria 1243
50 Ga0070714_100005108 3300005435 Bacteria 9981
51 Ga0070714_100340812 3300005435 Bacteria 1406
52 Ga0070713_100320795 3300005436 Bacteria 1431
53 Ga0070711_100572321 3300005439 Bacteria 939
54 Ga0070705_100028168 3300005440 Bacteria 3074
55 Ga0070705_100578553 3300005440 Bacteria 865
56 Ga0070700_100029805 3300005441 Bacteria 3256
57 Ga0070694_100086251 3300005444 Bacteria 2193
58 Ga0070663_100021537 3300005455 Bacteria 4290
59 Ga0070681_10105550 3300005458 Bacteria 2759
60 Ga0070685_10231374 3300005466 Bacteria 1216
61 Ga0070706_100154079 3300005467 Bacteria 2145
62 Ga0070706_100242809 3300005467 Bacteria 1682
63 Ga0070698_100092265 3300005471 Bacteria 3009
64 Ga0070699_100001133 3300005518 Bacteria 24789
65 Ga0070679_100088879 3300005530 Bacteria 3076
66 Ga0070684_100100173 3300005535 Bacteria 2587
67 Ga0070684_100383613 3300005535 Bacteria 1294
68 Ga0070697_100001413 3300005536 Bacteria 18222
69 Ga0068853_100021026 3300005539 Bacteria 5432
70 Ga0070672_100136345 3300005543 Bacteria 2021
71 Ga0070686_100091791 3300005544 Bacteria 2032
72 Ga0070695_100019179 3300005545 Bacteria 4161
73 Ga0070696_100053924 3300005546 Bacteria 2800
74 Ga0070665_100670832 3300005548 Bacteria 1050
75 Ga0070665_100762570 3300005548 Bacteria 980
76 Ga0070704_100170966 3300005549 Bacteria 1728
77 Ga0068855_100117887 3300005563 Bacteria 3041
78 Ga0068855_101309425 3300005563 Bacteria 749
79 Ga0070664_100007294 3300005564 Bacteria 8913
80 Ga0068857_100041577 3300005577 Bacteria 4076
81 Ga0068857_100277543 3300005577 Bacteria 1541
82 Ga0068856_100655320 3300005614 Bacteria 1070
83 Ga0070702_100023279 3300005615 Bacteria 3289
84 Ga0068852_100046789 3300005616 Bacteria 3687
85 Ga0068859_100012698 3300005617 Bacteria 8469
86 Ga0068859_100042330 3300005617 Bacteria 4574
87 Ga0068859_100111890 3300005617 Bacteria 2793
88 Ga0068864_100055942 3300005618 Bacteria 3408
89 Ga0068866_10566812 3300005718 Bacteria 762
90 Ga0068851_10078816 3300005834 Bacteria 1717
91 Ga0068870_10027732 3300005840 Bacteria 2836
92 Ga0068858_100098607 3300005842 Bacteria 2724
93 Ga0068860_100030767 3300005843 Bacteria 5161
94 Ga0081455_10002449 3300005937 Bacteria 22098
95 Ga0081455_10403860 3300005937 Bacteria 947
96 Ga0081540_1001721 3300005983 Bacteria 18516
97 Ga0070717_10588166 3300006028 Bacteria 1009
98 Ga0070717_10618498 3300006028 Bacteria 983
99 Ga0075432_10005407 3300006058 Bacteria 4353
100 Ga0070715_10039166 3300006163 Bacteria 1973
101 Ga0070715_10266830 3300006163 Bacteria 901
102 Ga0070716_100193252 3300006173 Bacteria 1346
103 Ga0070716_100445658 3300006173 Bacteria 942
104 Ga0070712_100067769 3300006175 Bacteria 2540
105 Ga0070712_100422160 3300006175 Bacteria 1105
106 Ga0097621_100029968 3300006237 Bacteria 4302
107 Ga0068871_100056238 3300006358 Bacteria 3197
108 Ga0075428_100431380 3300006844 Bacteria 1412
109 Ga0075433_10408448 3300006852 Bacteria 1198
110 Ga0075433_10860844 3300006852 Bacteria 791
111 Ga0097620_100012698 3300006931 Bacteria 8469
112 Ga0097620_100042331 3300006931 Bacteria 4574
113 Ga0097620_100111897 3300006931 Bacteria 2793
114 Ga0075435_100193636 3300007076 Bacteria 1721
115 Ga0105245_10280402 3300009098 Bacteria 1628
116 Ga0105247_10004427 3300009101 Bacteria 8968
117 Ga0114129_10549919 3300009147 Bacteria 1501
118 Ga0114129_11119061 3300009147 Bacteria 985
119 Ga0105242_10376143 3300009176 Bacteria 1319
120 Ga0105248_10387545 3300009177 Bacteria 1573
121 Ga0105237_10137496 3300009545 Bacteria 2437
122 Ga0105239_10240931 3300010375 Bacteria 2030
123 Ga0105239_10562054 3300010375 Bacteria 1300
124 Ga0105246_10008006 3300011119 Bacteria 6486
125 Ga0157344_1002415 3300012476 Bacteria 986
126 Ga0157319_1001511 3300012497 Bacteria 1214
127 Ga0157342_1003035 3300012507 Bacteria 1413
128 Ga0154016_103220 3300013045 Bacteria 710
129 Ga0157373_10100316 3300013100 Bacteria 2037
130 Ga0157369_10273698 3300013105 Bacteria 1759
131 Ga0157378_10159457 3300013297 Bacteria 2109
132 Ga0163162_10078561 3300013306 Bacteria 3365
133 Ga0157372_10890230 3300013307 Bacteria 1033
134 Ga0157372_11810560 3300013307 Bacteria 702
135 Ga0157377_10122740 3300014745 Bacteria 1577
136 Ga0157379_10080906 3300014968 Bacteria 2910
137 Ga0197907_10077722 3300020069 Bacteria 647
138 Ga0197907_10672679 3300020069 Bacteria 1816
139 Ga0197907_10801637 3300020069 Bacteria 611
140 Ga0206356_10099254 3300020070 Bacteria 667
141 Ga0206356_10600753 3300020070 Bacteria 702
142 Ga0206356_10679330 3300020070 Bacteria 616
143 Ga0206356_11012750 3300020070 Bacteria 1109
144 Ga0206349_1026349 3300020075 Bacteria 929
145 Ga0206349_1406514 3300020075 Bacteria 1266
146 Ga0206349_1657819 3300020075 Bacteria 1131
147 Ga0206349_1668021 3300020075 Bacteria 788
148 Ga0206355_1053808 3300020076 Bacteria 1891
149 Ga0206355_1458676 3300020076 Bacteria 659
150 Ga0206355_1712904 3300020076 Bacteria 640
151 Ga0206351_10382967 3300020077 Bacteria 650
152 Ga0206351_10398536 3300020077 Bacteria 1235
153 Ga0206351_10743783 3300020077 Bacteria 617
154 Ga0206352_10123293 3300020078 Bacteria 855
155 Ga0206352_11100158 3300020078 Bacteria 835
156 Ga0206352_11313498 3300020078 Bacteria 609
157 Ga0206352_11315786 3300020078 Bacteria 1090
158 Ga0206350_10048547 3300020080 Bacteria 1535
159 Ga0206350_10716410 3300020080 Bacteria 626
160 Ga0206350_11210859 3300020080 Bacteria 676
161 Ga0206354_10353886 3300020081 Bacteria 1810
162 Ga0206354_11510252 3300020081 Bacteria 1221
163 Ga0206353_10157288 3300020082 Bacteria 1028
164 Ga0206353_10313677 3300020082 Bacteria 1335
165 Ga0206353_10667855 3300020082 Bacteria 2269
166 Ga0206353_10908876 3300020082 Bacteria 725
167 Ga0154015_1176301 3300020610 Bacteria 1974
168 Ga0154015_1183240 3300020610 Bacteria 1013
169 Ga0213875_10000587 3300021388 Bacteria 29436
170 Ga0213875_10039671 3300021388 Bacteria 2218
171 Ga0224712_10280059 3300022467 Bacteria 776
172 Ga0224712_10429772 3300022467 Bacteria 632
173 Ga0209148_1001911 3300025254 Bacteria 8530
174 Ga0207656_10210978 3300025321 Bacteria 941
175 Ga0207653_10001710 3300025885 Bacteria 7016
176 Ga0207692_10025659 3300025898 Bacteria 2756
177 Ga0207710_10010319 3300025900 Bacteria 3931
178 Ga0207710_10052748 3300025900 Bacteria 1829
179 Ga0207688_10004099 3300025901 Bacteria 7942
180 Ga0207647_10033522 3300025904 Bacteria 3288
181 Ga0207647_10081694 3300025904 Bacteria 1936
182 Ga0207647_10155957 3300025904 Bacteria 1333
183 Ga0207647_10163539 3300025904 Bacteria 1297
184 Ga0207699_10019798 3300025906 Bacteria 3596
185 Ga0207645_10014207 3300025907 Bacteria 5333
186 Ga0207643_10004674 3300025908 Bacteria 7347
187 Ga0207705_10034848 3300025909 Bacteria 3600
188 Ga0207705_10231240 3300025909 Bacteria 1406
189 Ga0207684_10452569 3300025910 Bacteria 1102
190 Ga0207654_10080998 3300025911 Bacteria 1954
191 Ga0207707_10268441 3300025912 Bacteria 1479
192 Ga0207671_10101649 3300025914 Bacteria 2178
193 Ga0207693_10184904 3300025915 Bacteria 1640
194 Ga0207693_10245127 3300025915 Bacteria 1406
195 Ga0207693_10598124 3300025915 Bacteria 859
196 Ga0207663_10016663 3300025916 Bacteria 4082
197 Ga0207660_10049728 3300025917 Bacteria 2974
198 Ga0207662_10018037 3300025918 Bacteria 3998
199 Ga0207657_10003580 3300025919 Bacteria 16573
200 Ga0207657_10035730 3300025919 Bacteria 4453
201 Ga0207657_10781927 3300025919 Bacteria 739
202 Ga0207646_10142979 3300025922 Bacteria 2155
203 Ga0207694_10021043 3300025924 Bacteria 4938
204 Ga0207650_10185275 3300025925 Bacteria 1660
205 Ga0207687_10464350 3300025927 Bacteria 1052
206 Ga0207700_10138521 3300025928 Bacteria 1996
207 Ga0207700_10180702 3300025928 Bacteria 1766
208 Ga0207700_10339745 3300025928 Bacteria 1305
209 Ga0207700_10445752 3300025928 Bacteria 1140
210 Ga0207664_10001359 3300025929 Bacteria 16076
211 Ga0207664_10027836 3300025929 Bacteria 4290
212 Ga0207664_10132417 3300025929 Bacteria 2100
213 Ga0207664_10636553 3300025929 Bacteria 958
214 Ga0207644_10884155 3300025931 Bacteria 748
215 Ga0207706_10030002 3300025933 Bacteria 4853
216 Ga0207686_10258643 3300025934 Bacteria 1275
217 Ga0207670_10103042 3300025936 Bacteria 2041
218 Ga0207669_10318148 3300025937 Bacteria 1190
219 Ga0207665_10039377 3300025939 Bacteria 3152
220 Ga0207665_10045154 3300025939 Bacteria 2950
221 Ga0207665_10085596 3300025939 Bacteria 2177
222 Ga0207691_10056062 3300025940 Bacteria 3591
223 Ga0207711_10132476 3300025941 Bacteria 2236
224 Ga0207689_10057883 3300025942 Bacteria 3188
225 Ga0207661_10242034 3300025944 Bacteria 1601
226 Ga0207661_10394423 3300025944 Bacteria 1254
227 Ga0207661_11449950 3300025944 Bacteria 629
228 Ga0207679_11334702 3300025945 Bacteria 658
229 Ga0207667_10250051 3300025949 Bacteria 1813
230 Ga0207667_10307847 3300025949 Bacteria 1618
231 Ga0207651_10295900 3300025960 Bacteria 1344
232 Ga0207658_10082281 3300025986 Bacteria 2472
233 Ga0207678_10277819 3300026067 Bacteria 1437
234 Ga0207678_10457644 3300026067 Bacteria 1110
235 Ga0207702_10013932 3300026078 Bacteria 6679
236 Ga0207641_10091945 3300026088 Bacteria 2656
237 Ga0207648_10063808 3300026089 Bacteria 3210
238 Ga0207676_10054819 3300026095 Bacteria 3125
239 Ga0207674_10013699 3300026116 Bacteria 8981
240 Ga0207674_10277872 3300026116 Bacteria 1622
241 Ga0207675_100125234 3300026118 Bacteria 2434
242 Ga0207683_10001019 3300026121 Bacteria 25528
243 Ga0207698_10327209 3300026142 Bacteria 1438
244 Ga0209974_10069691 3300027876 Bacteria 1198
245 Ga0207428_10103418 3300027907 Bacteria 2199
246 Ga0268265_10068224 3300028380 Bacteria 2757
247 Ga0268264_10172126 3300028381 Bacteria 1959
248 Ga0316181_1025539 3300030744 Bacteria 732
249 Ga0307509_10311023 3300031507 Bacteria 1318
250 Ga0307408_100133176 3300031548 Bacteria 1941
251 Ga0307405_10024830 3300031731 Bacteria 3431
252 Ga0307413_10003513 3300031824 Bacteria 6611
253 Ga0307413_10077106 3300031824 Bacteria 2121
254 Ga0307410_10001349 3300031852 Bacteria 11008
255 Ga0307406_10283425 3300031901 Bacteria 1265
256 Ga0307407_10021450 3300031903 Bacteria 3331
257 Ga0307407_10662200 3300031903 Bacteria 783
258 Ga0307412_10030828 3300031911 Bacteria 3381
259 Ga0307409_100089151 3300031995 Bacteria 2520
260 Ga0307409_101056257 3300031995 Bacteria 832
261 Ga0307416_100013274 3300032002 Bacteria 5592
262 Ga0307415_100006467 3300032126 Bacteria 6325
263 Ga0307415_100028035 3300032126 Bacteria 3577
264 Ga0307415_100168795 3300032126 Bacteria 1704
265 Ga0307415_100808715 3300032126 Bacteria 856
266 Ga0307507_10013188 3300033179 Bacteria 10077
267 Ga0307507_10195825 3300033179 Bacteria 1410
268 Ga0373938_0015184 3300034957 Bacteria 1488
269 Ga0373926_0002565 3300035083 Bacteria 5771
270 Ga0373934_0005337 3300035086 Bacteria 4760
271 Ga0373934_0083338 3300035086 Bacteria 1285
272 Ga0373944_0001203 3300035089 Bacteria 6483
273 Ga0373944_0001999 3300035089 Bacteria 5170
274 Ga0373949_0062884 3300035090 Bacteria 958
275 Ga0373923_0063003 3300035111 Bacteria 1579
276 Ga0373923_0134812 3300035111 Bacteria 1112
277 Ga0373936_0000662 3300035113 Bacteria 11933
278 Ga0373936_0003957 3300035113 Bacteria 5584
279 Ga0373939_0097153 3300035114 Bacteria 1005
280 Ga0373953_0016027 3300035117 Bacteria 2728
281 Ga0373953_0096939 3300035117 Bacteria 1238
282 Ga0373954_0041635 3300035118 Bacteria 2142
283 Ga0373956_0093429 3300035119 Bacteria 1389
284 Ga0373956_0263444 3300035119 Bacteria 820
285 Ga0373957_0027107 3300035120 Bacteria 2079
286 Ga0373943_0029553 3300035170 Bacteria 2589
287 Ga0373943_0030489 3300035170 Bacteria 2552
288 Ga0373946_0000182 3300035171 Bacteria 19356
289 Ga0373946_0038260 3300035171 Bacteria 1953
290 Ga0373946_0482444 3300035171 Bacteria 634
291 Ga0373955_0039501 3300035172 Bacteria 2519
292 Ga0373955_0367742 3300035172 Bacteria 872
293 Ga0373942_0004132 3300035207 Bacteria 3381
294 Ga0373961_0007292 3300035241 Bacteria 2673
295 Ga0373962_0004258 3300035242 Bacteria 3453
296 Ga0373924_0000665 3300035410 Bacteria 10714
297 Ga0373924_0054539 3300035410 Bacteria 1662
298 Ga0373931_0037922 3300035691 Bacteria 2518
299 Ga0373931_0344793 3300035691 Bacteria 931
300 Ga0373935_0004225 3300035692 Bacteria 8418
301 Ga0373935_0030653 3300035692 Bacteria 3333
302 Ga0373927_0007808 3300035695 Bacteria 7238
303 Ga0373927_0015408 3300035695 Bacteria 5052
304 Ga0373933_0002831 3300035724 Bacteria 9692
305 Ga0373947_0064838 3300035725 Bacteria 2227
306 Ga0373937_0030313 3300036401 Bacteria 4899
307 Ga0373937_0198165 3300036401 Bacteria 1887
308 Ga0373937_0213791 3300036401 Bacteria 1814
309 Ga0373925_0009886 3300037068 Bacteria 6932
310 Ga0373925_0011264 3300037068 Bacteria 6486
311 Ga0395899_0451416 3300037312 Bacteria 842
312 Ga0395898_0217877 3300037466 Bacteria 1821
313 Ga0395898_0615583 3300037466 Bacteria 1029
314 Ga0436364_0249343 3300037853 Bacteria 6897
315 Ga0436364_0290389 3300037853 Bacteria 159315
316 Ga0436364_1226204 3300037853 Bacteria 5104
317 Ga0395901_0144841 3300038443 Bacteria 2498
318 Ga0436363_0926746 3300039450 Bacteria 1256
319 Ga0436362_0339709 3300039453 Bacteria 2685
320 Ga0451853_3912650 3300041512 Bacteria 611
321 Ga0466972_0001617 3300044658 Bacteria 11013
322 Ga0466966_0104768 3300044684 Bacteria 1747
323 Ga0466961_0009063 3300044693 Bacteria 6347
324 Ga0466961_0059047 3300044693 Bacteria 2439
325 Ga0466963_0023266 3300044694 Bacteria 3932
326 Ga0466963_0292877 3300044694 Bacteria 1144
327 Ga0466963_0643770 3300044694 Bacteria 748
328 Ga0466971_0066509 3300044719 Bacteria 1633
329 Ga0466971_0216858 3300044719 Bacteria 906
330 Ga0466970_0001279 3300044765 Bacteria 12173
331 Ga0466957_0423769 3300044842 Bacteria 913
332 Ga0466959_0297931 3300045049 Bacteria 1105
333 Ga0466958_0286939 3300045836 Bacteria 1055
334 Ga0466958_0333238 3300045836 Bacteria 976
335 Ga0466958_0543774 3300045836 Bacteria 754
336 Ga0466967_0003763 3300045976 Bacteria 10009
337 Ga0466967_0645624 3300045976 Bacteria 1046
338 Ga0466967_0836693 3300045976 Bacteria 914
339 Ga0466967_0861631 3300045976 Bacteria 900
340 Ga0466967_0936467 3300045976 Bacteria 862
341 Ga0495592_0003108 3300046454 Bacteria 11855
342 Ga0495592_0073926 3300046454 Bacteria 2477
343 Ga0495592_0419422 3300046454 Bacteria 844
344 Ga0495592_0440471 3300046454 Bacteria 818
345 Ga0495603_0034563 3300046455 Bacteria 3038
346 Ga0495629_0016747 3300046459 Bacteria 5260
347 Ga0495641_0034558 3300046461 Bacteria 2389
348 Ga0495641_0042917 3300046461 Bacteria 2093
349 Ga0495651_0117013 3300046462 Bacteria 1962
350 Ga0495651_0161060 3300046462 Bacteria 1607
351 Ga0495651_0328679 3300046462 Bacteria 1017
352 Ga0495653_0020288 3300046463 Bacteria 5388
353 Ga0495653_0020629 3300046463 Bacteria 5340
354 Ga0495653_0129455 3300046463 Bacteria 1788
355 Ga0495653_0174161 3300046463 Bacteria 1482
356 Ga0495580_0029938 3300046472 Bacteria 3946
357 Ga0495582_0005760 3300046473 Bacteria 6899
358 Ga0495639_0006877 3300046475 Bacteria 4885
359 Ga0495639_0420670 3300046475 Bacteria 676
360 Ga0495662_0005231 3300046476 Bacteria 6503
361 Ga0495664_0009114 3300046477 Bacteria 5547
362 Ga0495664_0012213 3300046477 Bacteria 4862
363 Ga0495664_0044242 3300046477 Bacteria 2638
364 Ga0495594_0002730 3300046499 Bacteria 9155
365 Ga0495608_0021673 3300046511 Bacteria 4410
366 Ga0495608_0230201 3300046511 Bacteria 1160
367 Ga0495608_0338769 3300046511 Bacteria 927
368 Ga0495618_0002787 3300046514 Bacteria 11086
369 Ga0495618_0106060 3300046514 Bacteria 1799
370 Ga0495618_0179139 3300046514 Bacteria 1347
371 Ga0495628_0093204 3300046516 Bacteria 2329
372 Ga0495628_0187999 3300046516 Bacteria 1560
373 Ga0495630_0002073 3300046517 Bacteria 13943
374 Ga0495630_0158019 3300046517 Bacteria 1726
375 Ga0495630_0420036 3300046517 Bacteria 1024
376 Ga0495652_0166171 3300046529 Bacteria 1707
377 Ga0495652_0239200 3300046529 Bacteria 1352
378 Ga0495652_0555006 3300046529 Bacteria 789
379 Ga0495665_0003418 3300046531 Bacteria 8621
380 Ga0495665_0018723 3300046531 Bacteria 3720
381 Ga0495640_0012376 3300046533 Bacteria 6520
382 Ga0495586_0032034 3300046535 Bacteria 2818
383 Ga0495587_0026679 3300046536 Bacteria 3521
384 Ga0495587_0073245 3300046536 Bacteria 1990
385 Ga0495645_0027741 3300046543 Bacteria 4114
386 Ga0495645_0087469 3300046543 Bacteria 2229
387 Ga0495645_0092784 3300046543 Bacteria 2155
388 Ga0495633_0044836 3300046558 Bacteria 2095
389 Ga0495667_0011942 3300046559 Bacteria 5885
390 Ga0495667_0015980 3300046559 Bacteria 5072
391 Ga0495667_0022123 3300046559 Bacteria 4284
392 Ga0495667_0044111 3300046559 Bacteria 2953
393 Ga0495667_0081942 3300046559 Bacteria 2097
394 Ga0495656_0001617 3300046615 Bacteria 7361
395 Ga0495634_0007881 3300046642 Bacteria 7951
396 Ga0495634_0039103 3300046642 Bacteria 3231
397 Ga0495634_0172797 3300046642 Bacteria 1357
398 Ga0495635_0003958 3300046663 Bacteria 10306
399 Ga0495635_0011637 3300046663 Bacteria 6165
400 Ga0495635_0171116 3300046663 Bacteria 1477
401 Ga0495635_0181941 3300046663 Bacteria 1428
402 Ga0495659_0026626 3300046664 Bacteria 1989
403 Ga0495661_0135315 3300046665 Bacteria 1346
404 Ga0495588_0023584 3300046674 Bacteria 3048
405 Ga0495657_0041150 3300046675 Bacteria 3165
406 Ga0495657_0131633 3300046675 Bacteria 1566
407 Ga0495657_0185351 3300046675 Bacteria 1274
408 Ga0495599_0183595 3300046678 Bacteria 1288
409 Ga0495623_0101572 3300046679 Bacteria 1752
410 Ga0495623_0113459 3300046679 Bacteria 1639
411 Ga0495646_0337430 3300046680 Bacteria 791
412 Ga0495647_0005996 3300046681 Bacteria 4005
413 Ga0495647_0306795 3300046681 Bacteria 716
414 Ga0495658_0025736 3300046683 Bacteria 3148
415 Ga0495613_0002459 3300046689 Bacteria 13958
416 Ga0495624_0018919 3300046690 Bacteria 4602
417 Ga0495624_0061343 3300046690 Bacteria 2356
418 Ga0495670_0010261 3300046691 Bacteria 4602
419 Ga0495649_0025344 3300046694 Bacteria 3303
420 Ga0495600_0374008 3300046809 Bacteria 890
421 Ga0495660_0261927 3300046810 Bacteria 798
422 Ga0495581_0000115 3300047315 Bacteria 33687
423 Ga0495581_0113255 3300047315 Bacteria 1577
424 Ga0495604_0004536 3300047317 Bacteria 10996
425 Ga0495636_0036971 3300047318 Bacteria 2015
426 Ga0495674_0000062 3300047319 Bacteria 72134
427 Ga0495674_0034954 3300047319 Bacteria 4538
428 Ga0495674_0434275 3300047319 Bacteria 1057
429 Ga0495676_0028450 3300047321 Bacteria 4771
430 Ga0495676_0057100 3300047321 Bacteria 3082
431 Ga0495680_0012919 3300047322 Bacteria 7316
432 Ga0495680_0027326 3300047322 Bacteria 4690
433 Ga0495680_0101304 3300047322 Bacteria 2145
434 Ga0495680_0177277 3300047322 Bacteria 1540
435 Ga0495687_022466 3300047443 Bacteria 3028
436 Ga0495675_0024496 3300047444 Bacteria 3847
437 Ga0495675_0143996 3300047444 Bacteria 1476
438 Ga0495677_0006786 3300047445 Bacteria 4307
439 Ga0495681_0177213 3300047470 Bacteria 878
440 Ga0495684_0001794 3300047471 Bacteria 17241
441 Ga0495684_0004516 3300047471 Bacteria 10870
442 Ga0495684_0005383 3300047471 Bacteria 9967
443 Ga0495684_0207973 3300047471 Bacteria 1440
444 Ga0495593_0012409 3300047673 Bacteria 4872
445 Ga0495593_0018824 3300047673 Bacteria 3876
446 Ga0495602_0327328 3300048088 Bacteria 1112
447 Ga0496100_0109891 3300048903 Bacteria 1913
448 Ga0496101_0053839 3300048904 Bacteria 2904
449 Ga0496101_0098022 3300048904 Bacteria 2190
450 Ga0496102_0000013 3300048905 Bacteria 311668
451 Ga0496103_0000039 3300048906 Bacteria 174284
452 Ga0496103_0034422 3300048906 Bacteria 3097
453 Ga0496104_0128926 3300048907 Bacteria 2429
454 Ga0496104_1305405 3300048907 Bacteria 629
455 Ga0496105_0036479 3300048908 Bacteria 4050
456 Ga0496105_0136733 3300048908 Bacteria 2019
457 Ga0496106_0062207 3300048909 Bacteria 2833
458 Ga0496109_0052777 3300048912 Bacteria 3706
459 Ga0496109_0429507 3300048912 Bacteria 1248
460 Ga0496109_0723513 3300048912 Bacteria 933
461 Ga0496111_0865836 3300048914 Bacteria 652
462 Ga0496113_0243351 3300048916 Bacteria 1435
463 Ga0496114_0148843 3300048917 Bacteria 2030
464 Ga0496114_0231608 3300048917 Bacteria 1623
465 Ga0496115_0007991 3300048918 Bacteria 7810
466 Ga0496115_0376191 3300048918 Bacteria 1156
467 Ga0496118_0009684 3300048921 Bacteria 9683
468 Ga0496119_0037542 3300048922 Bacteria 3145
469 Ga0496120_0011207 3300048923 Bacteria 6184
470 Ga0496126_0000036 3300048929 Bacteria 354901
471 Ga0501306_028411 3300049127 Bacteria 819
472 Ga0501306_028612 3300049127 Bacteria 817
473 Ga0501306_045821 3300049127 Bacteria 690
474 Ga0501308_037259 3300049128 Bacteria 674
475 Ga0501308_050642 3300049128 Bacteria 607
476 Ga0501309_016249 3300049129 Bacteria 1013
477 Ga0501309_020173 3300049129 Bacteria 931
478 Ga0501309_032092 3300049129 Bacteria 778
479 Ga0501310_034025 3300049130 Bacteria 687
480 Ga0501341_04858 3300049131 Bacteria 793
481 Ga0501304_025273 3300049160 Bacteria 608
482 Ga0501305_020353 3300049161 Bacteria 975
483 Ga0501305_032635 3300049161 Bacteria 818
484 Ga0501305_038321 3300049161 Bacteria 772
485 Ga0501305_057484 3300049161 Bacteria 664
486 Ga0501305_071606 3300049161 Bacteria 611
487 Ga0501307_018759 3300049162 Bacteria 882
488 Ga0501307_070091 3300049162 Bacteria 558
489 Ga0501311_015607 3300049527 Bacteria 982
490 Ga0501312_013886 3300049528 Bacteria 1126
491 Ga0501312_016989 3300049528 Bacteria 1047
492 Ga0501312_029832 3300049528 Bacteria 851
493 Ga0501312_048158 3300049528 Bacteria 713
494 Ga0501313_013247 3300049529 Bacteria 967
495 Ga0501314_012095 3300049530 Bacteria 824
496 Ga0501315_028911 3300049531 Bacteria 789
497 Ga0501315_040366 3300049531 Bacteria 704
498 Ga0501315_045309 3300049531 Bacteria 677
499 Ga0501315_061103 3300049531 Bacteria 610
500 Ga0501316_013257 3300049532 Bacteria 973
501 Ga0501316_050594 3300049532 Bacteria 598
502 Ga0501317_002174 3300049533 Bacteria 1817
503 Ga0501317_014749 3300049533 Bacteria 994
504 Ga0501317_043208 3300049533 Bacteria 695
505 Ga0501318_001940 3300049534 Bacteria 1719
506 Ga0501318_004518 3300049534 Bacteria 1337
507 Ga0501318_012024 3300049534 Bacteria 986
508 Ga0501319_011698 3300049535 Bacteria 712
509 Ga0501320_057923 3300049536 Bacteria 540
510 Ga0501321_003263 3300049537 Bacteria 1472
511 Ga0501321_005601 3300049537 Bacteria 1248
512 Ga0501321_025410 3300049537 Bacteria 763
513 Ga0501321_031581 3300049537 Bacteria 710
514 Ga0501321_062137 3300049537 Bacteria 566
515 Ga0501322_004143 3300049538 Bacteria 964
516 Ga0501322_006928 3300049538 Bacteria 816
517 Ga0501322_017276 3300049538 Bacteria 610
518 Ga0501323_015513 3300049539 Bacteria 963
519 Ga0501323_044110 3300049539 Bacteria 662
520 Ga0501323_050316 3300049539 Bacteria 631
521 Ga0501324_024719 3300049540 Bacteria 631
522 Ga0501324_025243 3300049540 Bacteria 626
523 Ga0501325_005308 3300049541 Bacteria 1020
524 Ga0501325_010890 3300049541 Bacteria 832
525 Ga0501325_015092 3300049541 Bacteria 758
526 Ga0501326_07604 3300049542 Bacteria 620
527 Ga0501328_06249 3300049544 Bacteria 615
528 Ga0501330_013208 3300049546 Bacteria 611
529 Ga0501332_06739 3300049548 Bacteria 724
530 Ga0501334_12877 3300049550 Bacteria 624
531 Ga0501336_014170 3300049552 Bacteria 673
532 Ga0501337_004225 3300049553 Bacteria 932
533 Ga0501069_0097593 3300049585 Bacteria 1666
534 Ga0501070_0540776 3300049586 Bacteria 933
535 Ga0501080_0314691 3300049742 Bacteria 1418
536 Ga0501044_0398542 3300049823 Bacteria 1289
537 nmdc:mga05p37_1541866_c1 3300050507 Bacteria 659
538 nmdc:mga0n895_791938_c1 3300050512 Bacteria 939
539 nmdc:mga0rr50_172776_c1 3300050513 Bacteria 1762
540 nmdc:mga0rr50_512803_c1 3300050513 Bacteria 1020
541 Ga0495601_0020806 3300053077 Bacteria 4010
542 Ga0495612_0039064 3300053078 Bacteria 1929
543 Ga0500635_0151666 3300053080 Bacteria 885
544 Ga0495655_0103896 3300053083 Bacteria 845
545 Ga0495595_0020167 3300053084 Bacteria 2899
546 Ga0495595_0024971 3300053084 Bacteria 2642
547 Ga0495619_0083672 3300053085 Bacteria 2152
548 Ga0587120_020884 3300059659 Bacteria 622
549 Ga0587071_027128 3300060344 Bacteria 1084
550 Ga0587071_038790 3300060344 Bacteria 947
551 Ga0466962_0029115 3300061719 Bacteria 2643
552 2817509997 2816332305 Bacteria 2697803
553 2857729298 2857727296 Bacteria 2745552
554 2861526367 2861520306 Bacteria 8348283
555 2868093769 2868088558 Bacteria 7609351
556 2917743779 2917736166 Bacteria 9690793
557 8001787056 8001781756 Bacteria 9586736
558 8055073356 8055066027 Bacteria 9479577
559 Ga0105245_11436778
560 LJQas_1007609
561 Ga0006759J45824_1023206
562 Ga0007421J48921_107594
563 Ga0006777J48905_1027565
564 Ga0006781J51513_1008924
565 Ga0007410J51695_1008052
566 Ga0007410J51695_1071643
567 Ga0007410J51695_1099369
568 Ga0007409J51694_1019461
569 Ga0007409J51694_1036946
570 Ga0006562J51391_1008540
571 Ga0007429J51699_1009571
572 Ga0007429J51699_1017224
573 Ga0007429J51699_1047111
574 Ga0007429J51699_1077971
575 Ga0007429J51699_1079537
576 Ga0007411J51799_107783
577 JGI25404J52841_10003389
578 Ga0032354_1025493
579 Ga0055542_1002604
580 JGI25405J52794_10018077
581 Ga0058858_1349167
582 Ga0058860_10228110
583 Ga0070658_10175108
584 Ga0070683_100020080
585 Ga0070683_100099407
586 Ga0070683_100713400
587 Ga0070670_100191029
588 Ga0068869_100113677
589 Ga0070666_10020240
590 Ga0070682_100119600
591 Ga0070682_100128169
592 Ga0068868_100129720
593 Ga0068868_100620983
594 Ga0070660_100138721
595 Ga0070660_100742907
596 Ga0070691_10036601
597 Ga0070687_100293597
598 Ga0070661_100046095
599 Ga0070692_10192306
600 Ga0070675_100258489
601 Ga0070671_100089049
602 Ga0070674_100713115
603 Ga0070673_100407694
604 Ga0070688_100014210
605 Ga0070659_100220994
606 Ga0070703_10007341
607 Ga0070709_10264787
608 Ga0070714_100005108
609 Ga0070714_100340812
610 Ga0070713_100320795
611 Ga0070711_100572321
612 Ga0070705_100028168
613 Ga0070705_100578553
614 Ga0070700_100029805
615 Ga0070694_100086251
616 Ga0070663_100021537
617 Ga0070681_10105550
618 Ga0070685_10231374
619 Ga0070706_100154079
620 Ga0070706_100242809
621 Ga0070698_100092265
622 Ga0070699_100001133
623 Ga0070679_100088879
624 Ga0070684_100100173
625 Ga0070684_100383613
626 Ga0070697_100001413
627 Ga0068853_100021026
628 Ga0070672_100136345
629 Ga0070686_100091791
630 Ga0070695_100019179
631 Ga0070696_100053924
632 Ga0070665_100670832
633 Ga0070665_100762570
634 Ga0070704_100170966
635 Ga0068855_100117887
636 Ga0068855_101309425
637 Ga0070664_100007294
638 Ga0068857_100041577
639 Ga0068857_100277543
640 Ga0068856_100655320
641 Ga0070702_100023279
642 Ga0068852_100046789
643 Ga0068859_100012698
644 Ga0068859_100042330
645 Ga0068859_100111890
646 Ga0068864_100055942
647 Ga0068866_10566812
648 Ga0068851_10078816
649 Ga0068870_10027732
650 Ga0068858_100098607
651 Ga0068860_100030767
652 Ga0081455_10002449
653 Ga0081455_10403860
654 Ga0081540_1001721
655 Ga0070717_10588166
656 Ga0070717_10618498
657 Ga0075432_10005407
658 Ga0070715_10039166
659 Ga0070715_10266830
660 Ga0070716_100193252
661 Ga0070716_100445658
662 Ga0070712_100067769
663 Ga0070712_100422160
664 Ga0097621_100029968
665 Ga0068871_100056238
666 Ga0075428_100431380
667 Ga0075433_10408448
668 Ga0075433_10860844
669 Ga0097620_100012698
670 Ga0097620_100042331
671 Ga0097620_100111897
672 Ga0075435_100193636
673 Ga0105245_10280402
674 Ga0105247_10004427
675 Ga0114129_10549919
676 Ga0114129_11119061
677 Ga0105242_10376143
678 Ga0105248_10387545
679 Ga0105237_10137496
680 Ga0105239_10240931
681 Ga0105239_10562054
682 Ga0105246_10008006
683 Ga0157344_1002415
684 Ga0157319_1001511
685 Ga0157342_1003035
686 Ga0154016_103220
687 Ga0157373_10100316
688 Ga0157369_10273698
689 Ga0157378_10159457
690 Ga0163162_10078561
691 Ga0157372_10890230
692 Ga0157372_11810560
693 Ga0157377_10122740
694 Ga0157379_10080906
695 Ga0197907_10077722
696 Ga0197907_10672679
697 Ga0197907_10801637
698 Ga0206356_10099254
699 Ga0206356_10600753
700 Ga0206356_10679330
701 Ga0206356_11012750
702 Ga0206349_1026349
703 Ga0206349_1406514
704 Ga0206349_1657819
705 Ga0206349_1668021
706 Ga0206355_1053808
707 Ga0206355_1458676
708 Ga0206355_1712904
709 Ga0206351_10382967
710 Ga0206351_10398536
711 Ga0206351_10743783
712 Ga0206352_10123293
713 Ga0206352_11100158
714 Ga0206352_11313498
715 Ga0206352_11315786
716 Ga0206350_10048547
717 Ga0206350_10716410
718 Ga0206350_11210859
719 Ga0206354_10353886
720 Ga0206354_11510252
721 Ga0206353_10157288
722 Ga0206353_10313677
723 Ga0206353_10667855
724 Ga0206353_10908876
725 Ga0154015_1176301
726 Ga0154015_1183240
727 Ga0213875_10000587
728 Ga0213875_10039671
729 Ga0224712_10280059
730 Ga0224712_10429772
731 Ga0209148_1001911
732 Ga0207656_10210978
733 Ga0207653_10001710
734 Ga0207692_10025659
735 Ga0207710_10010319
736 Ga0207710_10052748
737 Ga0207688_10004099
738 Ga0207647_10033522
739 Ga0207647_10081694
740 Ga0207647_10155957
741 Ga0207647_10163539
742 Ga0207699_10019798
743 Ga0207645_10014207
744 Ga0207643_10004674
745 Ga0207705_10034848
746 Ga0207705_10231240
747 Ga0207684_10452569
748 Ga0207654_10080998
749 Ga0207707_10268441
750 Ga0207671_10101649
751 Ga0207693_10184904
752 Ga0207693_10245127
753 Ga0207693_10598124
754 Ga0207663_10016663
755 Ga0207660_10049728
756 Ga0207662_10018037
757 Ga0207657_10003580
758 Ga0207657_10035730
759 Ga0207657_10781927
760 Ga0207646_10142979
761 Ga0207694_10021043
762 Ga0207650_10185275
763 Ga0207687_10464350
764 Ga0207700_10138521
765 Ga0207700_10180702
766 Ga0207700_10339745
767 Ga0207700_10445752
768 Ga0207664_10001359
769 Ga0207664_10027836
770 Ga0207664_10132417
771 Ga0207664_10636553
772 Ga0207644_10884155
773 Ga0207706_10030002
774 Ga0207686_10258643
775 Ga0207670_10103042
776 Ga0207669_10318148
777 Ga0207665_10039377
778 Ga0207665_10045154
779 Ga0207665_10085596
780 Ga0207691_10056062
781 Ga0207711_10132476
782 Ga0207689_10057883
783 Ga0207661_10242034
784 Ga0207661_10394423
785 Ga0207661_11449950
786 Ga0207679_11334702
787 Ga0207667_10250051
788 Ga0207667_10307847
789 Ga0207651_10295900
790 Ga0207658_10082281
791 Ga0207678_10277819
792 Ga0207678_10457644
793 Ga0207702_10013932
794 Ga0207641_10091945
795 Ga0207648_10063808
796 Ga0207676_10054819
797 Ga0207674_10013699
798 Ga0207674_10277872
799 Ga0207675_100125234
800 Ga0207683_10001019
801 Ga0207698_10327209
802 Ga0209974_10069691
803 Ga0207428_10103418
804 Ga0268265_10068224
805 Ga0268264_10172126
806 Ga0316181_1025539
807 Ga0307509_10311023
808 Ga0307408_100133176
809 Ga0307405_10024830
810 Ga0307413_10003513
811 Ga0307413_10077106
812 Ga0307410_10001349
813 Ga0307406_10283425
814 Ga0307407_10021450
815 Ga0307407_10662200
816 Ga0307412_10030828
817 Ga0307409_100089151
818 Ga0307409_101056257
819 Ga0307416_100013274
820 Ga0307415_100006467
821 Ga0307415_100028035
822 Ga0307415_100168795
823 Ga0307415_100808715
824 Ga0307507_10013188
825 Ga0307507_10195825
826 Ga0373938_0015184
827 Ga0373926_0002565
828 Ga0373934_0005337
829 Ga0373934_0083338
830 Ga0373944_0001203
831 Ga0373944_0001999
832 Ga0373949_0062884
833 Ga0373923_0063003
834 Ga0373923_0134812
835 Ga0373936_0000662
836 Ga0373936_0003957
837 Ga0373939_0097153
838 Ga0373953_0016027
839 Ga0373953_0096939
840 Ga0373954_0041635
841 Ga0373956_0093429
842 Ga0373956_0263444
843 Ga0373957_0027107
844 Ga0373943_0029553
845 Ga0373943_0030489
846 Ga0373946_0000182
847 Ga0373946_0038260
848 Ga0373946_0482444
849 Ga0373955_0039501
850 Ga0373955_0367742
851 Ga0373942_0004132
852 Ga0373961_0007292
853 Ga0373962_0004258
854 Ga0373924_0000665
855 Ga0373924_0054539
856 Ga0373931_0037922
857 Ga0373931_0344793
858 Ga0373935_0004225
859 Ga0373935_0030653
860 Ga0373927_0007808
861 Ga0373927_0015408
862 Ga0373933_0002831
863 Ga0373947_0064838
864 Ga0373937_0030313
865 Ga0373937_0198165
866 Ga0373937_0213791
867 Ga0373925_0009886
868 Ga0373925_0011264
869 Ga0395899_0451416
870 Ga0395898_0217877
871 Ga0395898_0615583
872 Ga0436364_0249343
873 Ga0436364_0290389
874 Ga0436364_1226204
875 Ga0395901_0144841
876 Ga0436363_0926746
877 Ga0436362_0339709
878 Ga0451853_3912650
879 Ga0466972_0001617
880 Ga0466966_0104768
881 Ga0466961_0009063
882 Ga0466961_0059047
883 Ga0466963_0023266
884 Ga0466963_0292877
885 Ga0466963_0643770
886 Ga0466971_0066509
887 Ga0466971_0216858
888 Ga0466970_0001279
889 Ga0466957_0423769
890 Ga0466959_0297931
891 Ga0466958_0286939
892 Ga0466958_0333238
893 Ga0466958_0543774
894 Ga0466967_0003763
895 Ga0466967_0645624
896 Ga0466967_0836693
897 Ga0466967_0861631
898 Ga0466967_0936467
899 Ga0495592_0003108
900 Ga0495592_0073926
901 Ga0495592_0419422
902 Ga0495592_0440471
903 Ga0495603_0034563
904 Ga0495629_0016747
905 Ga0495641_0034558
906 Ga0495641_0042917
907 Ga0495651_0117013
908 Ga0495651_0161060
909 Ga0495651_0328679
910 Ga0495653_0020288
911 Ga0495653_0020629
912 Ga0495653_0129455
913 Ga0495653_0174161
914 Ga0495580_0029938
915 Ga0495582_0005760
916 Ga0495639_0006877
917 Ga0495639_0420670
918 Ga0495662_0005231
919 Ga0495664_0009114
920 Ga0495664_0012213
921 Ga0495664_0044242
922 Ga0495594_0002730
923 Ga0495608_0021673
924 Ga0495608_0230201
925 Ga0495608_0338769
926 Ga0495618_0002787
927 Ga0495618_0106060
928 Ga0495618_0179139
929 Ga0495628_0093204
930 Ga0495628_0187999
931 Ga0495630_0002073
932 Ga0495630_0158019
933 Ga0495630_0420036
934 Ga0495652_0166171
935 Ga0495652_0239200
936 Ga0495652_0555006
937 Ga0495665_0003418
938 Ga0495665_0018723
939 Ga0495640_0012376
940 Ga0495586_0032034
941 Ga0495587_0026679
942 Ga0495587_0073245
943 Ga0495645_0027741
944 Ga0495645_0087469
945 Ga0495645_0092784
946 Ga0495633_0044836
947 Ga0495667_0011942
948 Ga0495667_0015980
949 Ga0495667_0022123
950 Ga0495667_0044111
951 Ga0495667_0081942
952 Ga0495656_0001617
953 Ga0495634_0007881
954 Ga0495634_0039103
955 Ga0495634_0172797
956 Ga0495635_0003958
957 Ga0495635_0011637
958 Ga0495635_0171116
959 Ga0495635_0181941
960 Ga0495659_0026626
961 Ga0495661_0135315
962 Ga0495588_0023584
963 Ga0495657_0041150
964 Ga0495657_0131633
965 Ga0495657_0185351
966 Ga0495599_0183595
967 Ga0495623_0101572
968 Ga0495623_0113459
969 Ga0495646_0337430
970 Ga0495647_0005996
971 Ga0495647_0306795
972 Ga0495658_0025736
973 Ga0495613_0002459
974 Ga0495624_0018919
975 Ga0495624_0061343
976 Ga0495670_0010261
977 Ga0495649_0025344
978 Ga0495600_0374008
979 Ga0495660_0261927
980 Ga0495581_0000115
981 Ga0495581_0113255
982 Ga0495604_0004536
983 Ga0495636_0036971
984 Ga0495674_0000062
985 Ga0495674_0034954
986 Ga0495674_0434275
987 Ga0495676_0028450
988 Ga0495676_0057100
989 Ga0495680_0012919
990 Ga0495680_0027326
991 Ga0495680_0101304
992 Ga0495680_0177277
993 Ga0495687_022466
994 Ga0495675_0024496
995 Ga0495675_0143996
996 Ga0495677_0006786
997 Ga0495681_0177213
998 Ga0495684_0001794
999 Ga0495684_0004516
1000 Ga0495684_0005383
1001 Ga0495684_0207973
1002 Ga0495593_0012409
1003 Ga0495593_0018824
1004 Ga0495602_0327328
1005 Ga0496100_0109891
1006 Ga0496101_0053839
1007 Ga0496101_0098022
1008 Ga0496102_0000013
1009 Ga0496103_0000039
1010 Ga0496103_0034422
1011 Ga0496104_0128926
1012 Ga0496104_1305405
1013 Ga0496105_0036479
1014 Ga0496105_0136733
1015 Ga0496106_0062207
1016 Ga0496109_0052777
1017 Ga0496109_0429507
1018 Ga0496109_0723513
1019 Ga0496111_0865836
1020 Ga0496113_0243351
1021 Ga0496114_0148843
1022 Ga0496114_0231608
1023 Ga0496115_0007991
1024 Ga0496115_0376191
1025 Ga0496118_0009684
1026 Ga0496119_0037542
1027 Ga0496120_0011207
1028 Ga0496126_0000036
1029 Ga0501306_028411
1030 Ga0501306_028612
1031 Ga0501306_045821
1032 Ga0501308_037259
1033 Ga0501308_050642
1034 Ga0501309_016249
1035 Ga0501309_020173
1036 Ga0501309_032092
1037 Ga0501310_034025
1038 Ga0501341_04858
1039 Ga0501304_025273
1040 Ga0501305_020353
1041 Ga0501305_032635
1042 Ga0501305_038321
1043 Ga0501305_057484
1044 Ga0501305_071606
1045 Ga0501307_018759
1046 Ga0501307_070091
1047 Ga0501311_015607
1048 Ga0501312_013886
1049 Ga0501312_016989
1050 Ga0501312_029832
1051 Ga0501312_048158
1052 Ga0501313_013247
1053 Ga0501314_012095
1054 Ga0501315_028911
1055 Ga0501315_040366
1056 Ga0501315_045309
1057 Ga0501315_061103
1058 Ga0501316_013257
1059 Ga0501316_050594
1060 Ga0501317_002174
1061 Ga0501317_014749
1062 Ga0501317_043208
1063 Ga0501318_001940
1064 Ga0501318_004518
1065 Ga0501318_012024
1066 Ga0501319_011698
1067 Ga0501320_057923
1068 Ga0501321_003263
1069 Ga0501321_005601
1070 Ga0501321_025410
1071 Ga0501321_031581
1072 Ga0501321_062137
1073 Ga0501322_004143
1074 Ga0501322_006928
1075 Ga0501322_017276
1076 Ga0501323_015513
1077 Ga0501323_044110
1078 Ga0501323_050316
1079 Ga0501324_024719
1080 Ga0501324_025243
1081 Ga0501325_005308
1082 Ga0501325_010890
1083 Ga0501325_015092
1084 Ga0501326_07604
1085 Ga0501328_06249
1086 Ga0501330_013208
1087 Ga0501332_06739
1088 Ga0501334_12877
1089 Ga0501336_014170
1090 Ga0501337_004225
1091 Ga0501069_0097593
1092 Ga0501070_0540776
1093 Ga0501080_0314691
1094 Ga0501044_0398542
1095 nmdc:mga05p37_1541866_c1
1096 nmdc:mga0n895_791938_c1
1097 nmdc:mga0rr50_172776_c1
1098 nmdc:mga0rr50_512803_c1
1099 Ga0495601_0020806
1100 Ga0495612_0039064
1101 Ga0500635_0151666
1102 Ga0495655_0103896
1103 Ga0495595_0020167
1104 Ga0495595_0024971
1105 Ga0495619_0083672
1106 Ga0587120_020884
1107 Ga0587071_027128
1108 Ga0587071_038790
1109 Ga0466962_0029115
1110 2817509997
1111 2857729298
1112 2861526367
1113 2868093769
1114 2917743779
1115 8001787056
1116 8055073356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

33

200

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9268 10 181
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9215 10 181
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9196 10 182
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9144 10 182
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.905 11 179
ID Description Score Start End Superfamily
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9222 10 182 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9169 10 182 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.905 11 179 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8913 14 177 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8866 29 182 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A850D6W1-F1-model_v4 deleted 0.9648 1 149
AF-A0A165JGD9-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9642 4 152
AF-A0A1J7BJ73-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9617 3 181
AF-A0A553XYD8-F1-model_v4 YceI family protein 0.9591 5 183
AF-W4LV14-F1-model_v4 Polyprenyl-pyrophosphate binding protein 0.957 9 181

Map