F463411

General Info

Members Datasets Scaffolds Average Seq Length
558 304 1116 194

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100111150|Ga0070707_1001111502
Length 222
Sequence LLAADWPPILHAPTGKQPRMPADIDEQARHKAKMANRKAVQDAEVADKTVEKGLLIVHTGKGKGKSTAAWGLLLRAIGRGLRCGVVQFGKGAWQTGERAAIERLGDQVEWHTLGEGFTWETQDRNRDVEAARRAWAKTRELMANPAIRLIVLDELNIALRYDHLDIKDVVEALKARRPDQHIVVTGRNAKPELIEAADLVTEMTLVKHHFAAGVKAQEGIEF

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
120 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
235 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
243 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
244 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
252 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
255 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
258 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
261 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
265 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
266 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
267 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
268 2643221645 Massilia sp. Root351 Isolate Unclassified
269 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
270 2643221664 Massilia sp. Root418 Isolate Unclassified
271 2643221719 Rhizobium sp. Root274 Isolate Unclassified
272 2738541280 Massilia sp. GV090 Isolate Unclassified
273 2738541297 Duganella sp. GV083 Isolate Unclassified
274 2738541300 Massilia sp. GV016 Isolate Unclassified
275 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
276 2738541357 Duganella sp. GV053 Isolate Unclassified
277 2738543003 Duganella sp. GV066 Isolate Unclassified
278 2738543018 Massilia sp. GV045 Isolate Unclassified
279 2738543026 Duganella sp. GV089 Isolate Unclassified
280 2738543029 Duganella sp. GV039 Isolate Unclassified
281 2738543030 Massilia sp. GV097 Isolate Unclassified
282 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
283 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
284 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
285 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
286 2818991467 Bosea vestrisii 3192 Isolate Unclassified
287 2821131069 Duganella sp. 1224 Isolate Unclassified
288 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
289 2842694124 Methylopila sp. R-72369 Isolate Unclassified
290 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
291 2842711865 Duganella sp. R-73148 Isolate Unclassified
292 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
293 2857564685 Duganella sp. R-74599 Isolate Unclassified
294 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
295 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
296 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
297 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
298 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
299 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
300 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
301 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
302 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
303 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
304 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.47
Metatranscriptomes 0.18
Isolates 7.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.24
Nodule 0.72
Rhizoplane 3.41
Rhizosphere 75.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100111150 3300005468 Bacteria 2657
2 JGI25154J39366_1001374 3300002738 Bacteria 8835
3 JGI25150J39212_1012883 3300002774 Bacteria 1464
4 rootL2_10048407 3300003322 Bacteria 9581
5 JGI25161J50226_1014720 3300003374 Bacteria 868
6 Ga0006562J51391_1058120 3300003578 Bacteria 904
7 Ga0055529_1000829 3300003763 Bacteria 18265
8 Ga0055526_1000877 3300003771 Bacteria 22381
9 Ga0055526_1000900 3300003771 Bacteria 22136
10 Ga0055524_1000840 3300003775 Bacteria 20142
11 Ga0055543_1002285 3300004625 Bacteria 6471
12 Ga0065165_1002135 3300005262 Bacteria 17962
13 Ga0065165_1002855 3300005262 Bacteria 13402
14 Ga0065714_10126169 3300005288 Bacteria 1294
15 Ga0070677_10071218 3300005333 Bacteria 1463
16 Ga0068868_100337024 3300005338 Bacteria 1289
17 Ga0070661_100099049 3300005344 Bacteria 2165
18 Ga0070713_100731241 3300005436 Bacteria 946
19 Ga0070698_100002900 3300005471 Bacteria 18876
20 Ga0070697_100046322 3300005536 Bacteria 3525
21 Ga0070665_100088853 3300005548 Bacteria 3096
22 Ga0070664_100048956 3300005564 Bacteria 3573
23 Ga0070664_100234510 3300005564 Bacteria 1646
24 Ga0068856_100103008 3300005614 Bacteria 2848
25 Ga0068852_100121126 3300005616 Bacteria 2395
26 Ga0068859_100223312 3300005617 Bacteria 1972
27 Ga0068863_100140282 3300005841 Bacteria 2310
28 Ga0068860_100130310 3300005843 Bacteria 2413
29 Ga0081455_10011026 3300005937 Bacteria 9103
30 Ga0081538_10089603 3300005981 Bacteria 1596
31 Ga0081539_10001936 3300005985 Bacteria 31745
32 Ga0081539_10006495 3300005985 Bacteria 11180
33 Ga0070717_10765919 3300006028 Bacteria 877
34 Ga0075365_10084979 3300006038 Bacteria 2149
35 Ga0075365_10498632 3300006038 Bacteria 860
36 Ga0075368_10099384 3300006042 Bacteria 1194
37 Ga0075362_10023742 3300006177 Bacteria 2596
38 Ga0075362_10032946 3300006177 Bacteria 2252
39 Ga0075367_10003354 3300006178 Bacteria 7617
40 Ga0075367_10079454 3300006178 Bacteria 1982
41 Ga0075369_10027174 3300006186 Bacteria 2391
42 Ga0097621_100360009 3300006237 Bacteria 1296
43 Ga0075370_10196208 3300006353 Bacteria 1190
44 Ga0097620_100223296 3300006931 Bacteria 1972
45 Ga0099826_10000422 3300006948 Bacteria 20102
46 Ga0105244_10002702 3300009036 Bacteria 13261
47 Ga0105244_10262141 3300009036 Bacteria 804
48 Ga0105250_10040950 3300009092 Bacteria 1858
49 Ga0111539_10346368 3300009094 Bacteria 1729
50 Ga0111539_11135206 3300009094 Bacteria 908
51 Ga0105247_10154808 3300009101 Bacteria 1513
52 Ga0105238_10382951 3300009551 Bacteria 1398
53 Ga0105035_102264 3300009988 Bacteria 1408
54 Ga0099796_10013125 3300010159 Bacteria 2358
55 Ga0105239_10492272 3300010375 Bacteria 1394
56 Ga0105239_10682258 3300010375 Bacteria 1174
57 Ga0157371_10067128 3300013102 Bacteria 2539
58 Ga0157370_10925029 3300013104 Bacteria 791
59 Ga0157378_10252149 3300013297 Bacteria 1690
60 Ga0157378_10258042 3300013297 Bacteria 1671
61 Ga0163162_11010938 3300013306 Bacteria 940
62 Ga0157375_10535316 3300013308 Bacteria 1334
63 Ga0182008_10005542 3300014497 Bacteria 7171
64 Ga0182006_1000030 3300015261 Bacteria 242894
65 Ga0182007_10000803 3300015262 Bacteria 17533
66 Ga0182005_1000021 3300015265 Bacteria 272185
67 Ga0163161_10028114 3300017792 Bacteria 3991
68 Ga0163161_10101951 3300017792 Bacteria 2137
69 Ga0163161_10869812 3300017792 Bacteria 762
70 Ga0213872_10001038 3300021361 Bacteria 19363
71 Ga0213871_10012402 3300021441 Bacteria 1979
72 Ga0209437_115415 3300025233 Bacteria 1044
73 Ga0207425_1001348 3300025245 Bacteria 10512
74 Ga0207425_1005129 3300025245 Bacteria 3784
75 Ga0209646_1000478 3300025246 Bacteria 19998
76 Ga0209677_112116 3300025253 Bacteria 1299
77 Ga0209565_1025040 3300025263 Bacteria 1209
78 Ga0209455_1000750 3300025272 Bacteria 18541
79 Ga0209130_1001230 3300025284 Bacteria 17998
80 Ga0209025_1007793 3300025294 Bacteria 7878
81 Ga0209564_1001562 3300025295 Bacteria 22487
82 Ga0209564_1001592 3300025295 Bacteria 22188
83 Ga0209758_1001629 3300025297 Bacteria 25551
84 Ga0209256_1001792 3300025299 Bacteria 20292
85 Ga0207655_1010380 3300025728 Bacteria 5650
86 Ga0207685_10341660 3300025905 Bacteria 752
87 Ga0207705_10479216 3300025909 Bacteria 966
88 Ga0207657_10317950 3300025919 Bacteria 1231
89 Ga0207644_10870782 3300025931 Bacteria 755
90 Ga0207679_10103046 3300025945 Bacteria 2236
91 Ga0207679_10157232 3300025945 Bacteria 1857
92 Ga0207641_10089728 3300026088 Bacteria 2687
93 Ga0207674_10478437 3300026116 Bacteria 1204
94 Ga0209282_1000454 3300027666 Bacteria 20110
95 Ga0207428_10393733 3300027907 Bacteria 1015
96 Ga0207428_10413452 3300027907 Bacteria 987
97 Ga0268266_10054432 3300028379 Bacteria 3438
98 Ga0268266_11038936 3300028379 Bacteria 793
99 Ga0268264_10222831 3300028381 Bacteria 1737
100 Ga0265326_10004572 3300028558 Bacteria 4422
101 Ga0265319_1000354 3300028563 Bacteria 33255
102 Ga0265334_10001600 3300028573 Bacteria 10889
103 Ga0265318_10044567 3300028577 Bacteria 1678
104 Ga0265323_10000264 3300028653 Bacteria 30779
105 Ga0265336_10000291 3300028666 Bacteria 34334
106 Ga0265338_10000317 3300028800 Bacteria 87318
107 Ga0265328_10000085 3300031239 Bacteria 48380
108 Ga0265328_10009605 3300031239 Bacteria 3933
109 Ga0265328_10105938 3300031239 Bacteria 1043
110 Ga0265331_10001315 3300031250 Bacteria 18423
111 Ga0265331_10005130 3300031250 Bacteria 7979
112 Ga0265331_10033172 3300031250 Bacteria 2554
113 Ga0265327_10006926 3300031251 Bacteria 8908
114 Ga0265327_10015010 3300031251 Bacteria 5034
115 Ga0265327_10164576 3300031251 Bacteria 1022
116 Ga0265316_10003717 3300031344 Bacteria 15360
117 Ga0265316_10083847 3300031344 Bacteria 2441
118 Ga0265316_10416639 3300031344 Bacteria 966
119 Ga0265314_10024881 3300031711 Bacteria 4529
120 Ga0265342_10055585 3300031712 Bacteria 2349
121 Ga0307412_10328646 3300031911 Bacteria 1219
122 Ga0307412_10621972 3300031911 Bacteria 917
123 Ga0307416_100130727 3300032002 Bacteria 2259
124 Ga0307416_100316552 3300032002 Bacteria 1560
125 Ga0373934_0188250 3300035086 Bacteria 849
126 Ga0373953_0087699 3300035117 Bacteria 1299
127 Ga0373954_0160605 3300035118 Bacteria 1099
128 Ga0373956_0202821 3300035119 Bacteria 940
129 Ga0373955_0011640 3300035172 Bacteria 4201
130 Ga0373961_0165219 3300035241 Bacteria 763
131 Ga0373924_0085857 3300035410 Bacteria 1342
132 Ga0373927_0000556 3300035695 Bacteria 28426
133 Ga0373933_0038986 3300035724 Bacteria 2794
134 Ga0373925_0035085 3300037068 Bacteria 3699
135 Ga0395899_0084666 3300037312 Bacteria 2305
136 Ga0395900_0000020 3300037418 Bacteria 353500
137 Ga0395898_0000104 3300037466 Bacteria 223462
138 Ga0395898_0123610 3300037466 Bacteria 2480
139 Ga0395905_0000019 3300037471 Bacteria 353500
140 Ga0395905_0164412 3300037471 Bacteria 2085
141 Ga0436364_0233354 3300037853 Bacteria 1495
142 Ga0436364_0240121 3300037853 Bacteria 732
143 Ga0395901_0000016 3300038443 Bacteria 354008
144 Ga0395901_0027334 3300038443 Bacteria 5860
145 Ga0395901_1451681 3300038443 Bacteria 643
146 Ga0436365_0157200 3300039437 Bacteria 743
147 Ga0436360_0276376 3300039438 Bacteria 14151
148 Ga0436360_0486597 3300039438 Bacteria 2803
149 Ga0436360_1088619 3300039438 Bacteria 1133
150 Ga0436360_1204653 3300039438 Bacteria 934
151 Ga0436361_0463751 3300039447 Bacteria 19403
152 Ga0436363_1556987 3300039450 Bacteria 698
153 Ga0436362_0083770 3300039453 Bacteria 1507
154 Ga0439432_130444 3300042006 Bacteria 742
155 Ga0450904_000471 3300042139 Bacteria 7911
156 Ga0439459_0016381 3300042438 Bacteria 1370
157 Ga0451577_0054509 3300042876 Bacteria 3569
158 Ga0466982_0324581 3300044672 Bacteria 866
159 Ga0466965_0503012 3300044683 Bacteria 680
160 Ga0466964_0042266 3300044706 Bacteria 1846
161 Ga0453684_0000048 3300044712 Bacteria 559743
162 Ga0466971_0043818 3300044719 Bacteria 2010
163 Ga0466968_0070880 3300044735 Bacteria 1517
164 Ga0466970_0096986 3300044765 Bacteria 1604
165 Ga0466957_0020541 3300044842 Bacteria 3887
166 Ga0466957_0189917 3300044842 Bacteria 1345
167 Ga0466960_0051188 3300044901 Bacteria 1994
168 Ga0466959_0037916 3300045049 Bacteria 3562
169 Ga0451576_0171287 3300045051 Bacteria 2266
170 Ga0466967_0033352 3300045976 Bacteria 4357
171 Ga0495617_000441 3300046452 Bacteria 22411
172 Ga0495617_001986 3300046452 Bacteria 8525
173 Ga0495627_007918 3300046453 Bacteria 4026
174 Ga0495627_053454 3300046453 Bacteria 1209
175 Ga0495592_0158648 3300046454 Bacteria 1558
176 Ga0495590_0000382 3300046457 Bacteria 22518
177 Ga0495590_0000697 3300046457 Bacteria 15390
178 Ga0495590_0009717 3300046457 Bacteria 3646
179 Ga0495590_0030415 3300046457 Bacteria 1892
180 Ga0495591_002965 3300046458 Bacteria 9064
181 Ga0495591_010303 3300046458 Bacteria 3633
182 Ga0495638_0001370 3300046460 Bacteria 22328
183 Ga0495638_0026933 3300046460 Bacteria 3724
184 Ga0495638_0036152 3300046460 Bacteria 3147
185 Ga0495638_0059303 3300046460 Bacteria 2370
186 Ga0495638_0069300 3300046460 Bacteria 2162
187 Ga0495638_0106851 3300046460 Bacteria 1667
188 Ga0495651_0078255 3300046462 Bacteria 2501
189 Ga0495653_0000925 3300046463 Bacteria 22692
190 Ga0495653_0311056 3300046463 Bacteria 1024
191 Ga0495650_0001486 3300046471 Bacteria 22438
192 Ga0495650_0001777 3300046471 Bacteria 19562
193 Ga0495650_0001842 3300046471 Bacteria 18973
194 Ga0495650_0002555 3300046471 Bacteria 14451
195 Ga0495650_0002810 3300046471 Bacteria 13359
196 Ga0495650_0020283 3300046471 Bacteria 3245
197 Ga0495605_0000802 3300046474 Bacteria 22441
198 Ga0495605_0002350 3300046474 Bacteria 11774
199 Ga0495605_0016140 3300046474 Bacteria 4047
200 Ga0495605_0058189 3300046474 Bacteria 1858
201 Ga0495605_0079552 3300046474 Bacteria 1535
202 Ga0495605_0194390 3300046474 Bacteria 886
203 Ga0495639_0025932 3300046475 Bacteria 2587
204 Ga0495664_0126629 3300046477 Bacteria 1545
205 Ga0495584_0000946 3300046491 Bacteria 18272
206 Ga0495584_0001277 3300046491 Bacteria 15320
207 Ga0495584_0044566 3300046491 Bacteria 2238
208 Ga0495585_0003632 3300046492 Bacteria 10330
209 Ga0495585_0005643 3300046492 Bacteria 7860
210 Ga0495585_0009043 3300046492 Bacteria 6000
211 Ga0495585_0009991 3300046492 Bacteria 5670
212 Ga0495596_0002084 3300046500 Bacteria 10960
213 Ga0495596_0002347 3300046500 Bacteria 10251
214 Ga0495596_0002769 3300046500 Bacteria 9181
215 Ga0495596_0003972 3300046500 Bacteria 7309
216 Ga0495596_0009139 3300046500 Bacteria 4373
217 Ga0495596_0020833 3300046500 Bacteria 2680
218 Ga0495596_0064875 3300046500 Bacteria 1420
219 Ga0495607_0001294 3300046501 Bacteria 22348
220 Ga0495607_0005328 3300046501 Bacteria 9241
221 Ga0495607_0009636 3300046501 Bacteria 6527
222 Ga0495607_0010921 3300046501 Bacteria 6076
223 Ga0495607_0019504 3300046501 Bacteria 4306
224 Ga0495607_0062908 3300046501 Bacteria 2101
225 Ga0495607_0072595 3300046501 Bacteria 1915
226 Ga0495607_0141667 3300046501 Bacteria 1239
227 Ga0495607_0158027 3300046501 Bacteria 1154
228 Ga0495583_0001441 3300046506 Bacteria 24155
229 Ga0495583_0001587 3300046506 Bacteria 22385
230 Ga0495583_0002012 3300046506 Bacteria 18526
231 Ga0495583_0002508 3300046506 Bacteria 15547
232 Ga0495583_0010701 3300046506 Bacteria 5326
233 Ga0495583_0020901 3300046506 Bacteria 3376
234 Ga0495583_0056120 3300046506 Bacteria 1777
235 Ga0495583_0075820 3300046506 Bacteria 1470
236 Ga0495606_0002177 3300046507 Bacteria 23548
237 Ga0495606_0002301 3300046507 Bacteria 22541
238 Ga0495606_0002310 3300046507 Bacteria 22457
239 Ga0495606_0010860 3300046507 Bacteria 7501
240 Ga0495606_0019107 3300046507 Bacteria 5111
241 Ga0495608_0224133 3300046511 Bacteria 1178
242 Ga0495610_0001281 3300046512 Bacteria 22474
243 Ga0495610_0005073 3300046512 Bacteria 9488
244 Ga0495610_0016479 3300046512 Bacteria 4250
245 Ga0495610_0139233 3300046512 Bacteria 1046
246 Ga0495616_0008733 3300046513 Bacteria 5971
247 Ga0495616_0014299 3300046513 Bacteria 4446
248 Ga0495616_0059386 3300046513 Bacteria 1881
249 Ga0495616_0136465 3300046513 Bacteria 1120
250 Ga0495616_0274101 3300046513 Bacteria 718
251 Ga0495618_0053893 3300046514 Bacteria 2543
252 Ga0495620_0063594 3300046515 Bacteria 1529
253 Ga0495628_0354785 3300046516 Bacteria 1077
254 Ga0495631_0001506 3300046518 Bacteria 14043
255 Ga0495631_0026959 3300046518 Bacteria 2633
256 Ga0495631_0101634 3300046518 Bacteria 1237
257 Ga0495631_0199965 3300046518 Bacteria 854
258 Ga0495632_0053643 3300046519 Bacteria 1979
259 Ga0495637_0001253 3300046520 Bacteria 15327
260 Ga0495637_0036976 3300046520 Bacteria 2122
261 Ga0495643_0001402 3300046522 Bacteria 22388
262 Ga0495643_0082243 3300046522 Bacteria 1673
263 Ga0495643_0238159 3300046522 Bacteria 855
264 Ga0495644_0000617 3300046523 Bacteria 14941
265 Ga0495644_0000677 3300046523 Bacteria 14170
266 Ga0495644_0004334 3300046523 Bacteria 5575
267 Ga0495644_0012466 3300046523 Bacteria 3268
268 Ga0495644_0037735 3300046523 Bacteria 1823
269 Ga0495644_0089648 3300046523 Bacteria 1160
270 Ga0495648_0001548 3300046524 Bacteria 22454
271 Ga0495648_0003952 3300046524 Bacteria 12833
272 Ga0495648_0004671 3300046524 Bacteria 11617
273 Ga0495648_0007230 3300046524 Bacteria 8918
274 Ga0495648_0018016 3300046524 Bacteria 5023
275 Ga0495648_0067123 3300046524 Bacteria 2099
276 Ga0495663_0071254 3300046525 Bacteria 1107
277 Ga0495642_0001056 3300046528 Bacteria 12758
278 Ga0495642_0014163 3300046528 Bacteria 3090
279 Ga0495642_0047121 3300046528 Bacteria 1764
280 Ga0495642_0062696 3300046528 Bacteria 1544
281 Ga0495642_0078709 3300046528 Bacteria 1385
282 Ga0495642_0187612 3300046528 Bacteria 900
283 Ga0495652_0338556 3300046529 Bacteria 1081
284 Ga0495654_0002902 3300046530 Bacteria 10750
285 Ga0495640_0034126 3300046533 Bacteria 3612
286 Ga0495586_0190915 3300046535 Bacteria 1160
287 Ga0495609_0001195 3300046538 Bacteria 17862
288 Ga0495609_0001452 3300046538 Bacteria 15745
289 Ga0495609_0003724 3300046538 Bacteria 8610
290 Ga0495609_0004604 3300046538 Bacteria 7492
291 Ga0495609_0023049 3300046538 Bacteria 2863
292 Ga0495597_0000937 3300046542 Bacteria 22509
293 Ga0495597_0001684 3300046542 Bacteria 15338
294 Ga0495597_0004571 3300046542 Bacteria 7564
295 Ga0495597_0088340 3300046542 Bacteria 1318
296 Ga0495597_0116760 3300046542 Bacteria 1115
297 Ga0495645_0023911 3300046543 Bacteria 4429
298 Ga0495622_0000393 3300046557 Bacteria 29591
299 Ga0495622_0000554 3300046557 Bacteria 22441
300 Ga0495622_0025651 3300046557 Bacteria 2753
301 Ga0495622_0030866 3300046557 Bacteria 2505
302 Ga0495633_0000914 3300046558 Bacteria 25035
303 Ga0495633_0001052 3300046558 Bacteria 22514
304 Ga0495633_0001946 3300046558 Bacteria 15002
305 Ga0495633_0003562 3300046558 Bacteria 10297
306 Ga0495633_0004089 3300046558 Bacteria 9413
307 Ga0495633_0004106 3300046558 Bacteria 9394
308 Ga0495633_0037619 3300046558 Bacteria 2314
309 Ga0495668_0001481 3300046616 Bacteria 22492
310 Ga0495668_0001997 3300046616 Bacteria 17831
311 Ga0495668_0002082 3300046616 Bacteria 17326
312 Ga0495668_0010757 3300046616 Bacteria 5525
313 Ga0495668_0017201 3300046616 Bacteria 4198
314 Ga0495668_0021967 3300046616 Bacteria 3651
315 Ga0495668_0091327 3300046616 Bacteria 1668
316 Ga0495634_0120477 3300046642 Bacteria 1680
317 Ga0495611_0001011 3300046648 Bacteria 14895
318 Ga0495611_0001330 3300046648 Bacteria 12528
319 Ga0495611_0007478 3300046648 Bacteria 4635
320 Ga0495611_0013892 3300046648 Bacteria 3434
321 Ga0495611_0067994 3300046648 Bacteria 1625
322 Ga0495625_0002013 3300046660 Bacteria 22900
323 Ga0495625_0002064 3300046660 Bacteria 22515
324 Ga0495625_0016595 3300046660 Bacteria 5788
325 Ga0495625_0029026 3300046660 Bacteria 4141
326 Ga0495625_0038356 3300046660 Bacteria 3508
327 Ga0495625_0234217 3300046660 Bacteria 1198
328 Ga0495635_0037937 3300046663 Bacteria 3335
329 Ga0495659_0000322 3300046664 Bacteria 18883
330 Ga0495659_0000611 3300046664 Bacteria 13148
331 Ga0495659_0003392 3300046664 Bacteria 5093
332 Ga0495661_0008427 3300046665 Bacteria 7128
333 Ga0495661_0048553 3300046665 Bacteria 2578
334 Ga0495661_0065370 3300046665 Bacteria 2143
335 Ga0495661_0090815 3300046665 Bacteria 1737
336 Ga0495661_0128241 3300046665 Bacteria 1393
337 Ga0495661_0159823 3300046665 Bacteria 1210
338 Ga0495661_0188647 3300046665 Bacteria 1087
339 Ga0495657_0036839 3300046675 Bacteria 3377
340 Ga0495599_0051786 3300046678 Bacteria 2572
341 Ga0495623_0056669 3300046679 Bacteria 2466
342 Ga0495646_0017430 3300046680 Bacteria 4556
343 Ga0495669_0000656 3300046684 Bacteria 15037
344 Ga0495669_0084770 3300046684 Bacteria 1457
345 Ga0495624_0106093 3300046690 Bacteria 1729
346 Ga0495670_0002302 3300046691 Bacteria 9439
347 Ga0495670_0045650 3300046691 Bacteria 2187
348 Ga0495670_0097669 3300046691 Bacteria 1509
349 Ga0495670_0110264 3300046691 Bacteria 1423
350 Ga0495671_0001117 3300046692 Bacteria 18541
351 Ga0495671_0002076 3300046692 Bacteria 12852
352 Ga0495671_0008181 3300046692 Bacteria 5902
353 Ga0495671_0048794 3300046692 Bacteria 2111
354 Ga0495671_0054921 3300046692 Bacteria 1973
355 Ga0495671_0068975 3300046692 Bacteria 1738
356 Ga0495671_0177249 3300046692 Bacteria 1035
357 Ga0495671_0179187 3300046692 Bacteria 1029
358 Ga0495649_0001876 3300046694 Bacteria 15366
359 Ga0495649_0030002 3300046694 Bacteria 3004
360 Ga0495649_0058506 3300046694 Bacteria 2076
361 Ga0495649_0105591 3300046694 Bacteria 1495
362 Ga0495649_0231670 3300046694 Bacteria 953
363 Ga0495589_0004107 3300046794 Bacteria 7796
364 Ga0495589_0005713 3300046794 Bacteria 6560
365 Ga0495589_0006715 3300046794 Bacteria 6060
366 Ga0495589_0181650 3300046794 Bacteria 997
367 Ga0495600_0070127 3300046809 Bacteria 2290
368 Ga0495660_0001178 3300046810 Bacteria 18436
369 Ga0495660_0004244 3300046810 Bacteria 8700
370 Ga0495660_0004344 3300046810 Bacteria 8583
371 Ga0495660_0006519 3300046810 Bacteria 6894
372 Ga0495660_0011430 3300046810 Bacteria 5151
373 Ga0495660_0012016 3300046810 Bacteria 5022
374 Ga0495660_0023901 3300046810 Bacteria 3483
375 Ga0495660_0035465 3300046810 Bacteria 2786
376 Ga0495660_0072075 3300046810 Bacteria 1830
377 Ga0495581_0335702 3300047315 Bacteria 882
378 Ga0495604_0174693 3300047317 Bacteria 1507
379 Ga0495636_0000622 3300047318 Bacteria 12995
380 Ga0495636_0001889 3300047318 Bacteria 7997
381 Ga0495636_0061519 3300047318 Bacteria 1588
382 Ga0495672_0002076 3300047320 Bacteria 18808
383 Ga0495672_0003190 3300047320 Bacteria 14258
384 Ga0495672_0003721 3300047320 Bacteria 12860
385 Ga0495672_0003834 3300047320 Bacteria 12653
386 Ga0495672_0033972 3300047320 Bacteria 3155
387 Ga0495676_0253599 3300047321 Bacteria 1199
388 Ga0495680_0106085 3300047322 Bacteria 2088
389 Ga0495683_0003077 3300047323 Bacteria 9784
390 Ga0495683_0003094 3300047323 Bacteria 9754
391 Ga0495683_0019247 3300047323 Bacteria 3524
392 Ga0495683_0026636 3300047323 Bacteria 2958
393 Ga0495683_0241521 3300047323 Bacteria 796
394 Ga0495687_001871 3300047443 Bacteria 18235
395 Ga0495687_001987 3300047443 Bacteria 17397
396 Ga0495687_002610 3300047443 Bacteria 14164
397 Ga0495687_004208 3300047443 Bacteria 9868
398 Ga0495687_026733 3300047443 Bacteria 2711
399 Ga0495675_0183160 3300047444 Bacteria 1281
400 Ga0495677_0001296 3300047445 Bacteria 9985
401 Ga0495677_0004991 3300047445 Bacteria 5060
402 Ga0495677_0011368 3300047445 Bacteria 3258
403 Ga0495677_0013081 3300047445 Bacteria 3019
404 Ga0495677_0044301 3300047445 Bacteria 1631
405 Ga0495677_0093519 3300047445 Bacteria 1134
406 Ga0495679_007668 3300047446 Bacteria 4475
407 Ga0495679_033743 3300047446 Bacteria 1632
408 Ga0495679_034198 3300047446 Bacteria 1619
409 Ga0495685_001257 3300047447 Bacteria 7759
410 Ga0495685_003331 3300047447 Bacteria 5111
411 Ga0495685_106295 3300047447 Bacteria 925
412 Ga0495673_0001145 3300047469 Bacteria 22673
413 Ga0495673_0001156 3300047469 Bacteria 22410
414 Ga0495681_0000433 3300047470 Bacteria 32077
415 Ga0495681_0067497 3300047470 Bacteria 1629
416 Ga0495681_0097490 3300047470 Bacteria 1289
417 Ga0495681_0137760 3300047470 Bacteria 1033
418 Ga0495686_0002901 3300047472 Bacteria 15394
419 Ga0495686_0003304 3300047472 Bacteria 14076
420 Ga0495686_0037903 3300047472 Bacteria 3086
421 Ga0495686_0060146 3300047472 Bacteria 2362
422 Ga0495593_0027288 3300047673 Bacteria 3144
423 Ga0495602_0037499 3300048088 Bacteria 4497
424 Ga0495626_0002174 3300048091 Bacteria 14104
425 Ga0495626_0005185 3300048091 Bacteria 7717
426 Ga0495626_0009078 3300048091 Bacteria 5393
427 Ga0496100_0321329 3300048903 Bacteria 1163
428 Ga0496102_0024797 3300048905 Bacteria 5335
429 Ga0496102_0516224 3300048905 Bacteria 1117
430 Ga0496103_0217815 3300048906 Bacteria 1228
431 Ga0496104_0002205 3300048907 Bacteria 16852
432 Ga0496104_0005460 3300048907 Bacteria 11131
433 Ga0496104_0462434 3300048907 Bacteria 1180
434 Ga0496104_1379429 3300048907 Bacteria 608
435 Ga0496107_0139193 3300048910 Bacteria 1794
436 Ga0496108_0203453 3300048911 Bacteria 1718
437 Ga0496109_0159252 3300048912 Bacteria 2115
438 Ga0496112_0192563 3300048915 Bacteria 2000
439 Ga0496112_0819221 3300048915 Bacteria 855
440 Ga0496113_0366211 3300048916 Bacteria 1157
441 Ga0496113_0497950 3300048916 Bacteria 978
442 Ga0496114_0527602 3300048917 Bacteria 1044
443 Ga0496115_0039687 3300048918 Bacteria 3740
444 Ga0496116_0034676 3300048919 Bacteria 3556
445 Ga0496116_0076355 3300048919 Bacteria 2099
446 Ga0496116_0150994 3300048919 Bacteria 1290
447 Ga0496117_0000056 3300048920 Bacteria 271417
448 Ga0496118_0000047 3300048921 Bacteria 271417
449 Ga0496118_0017403 3300048921 Bacteria 6544
450 Ga0496118_0160384 3300048921 Bacteria 1392
451 Ga0496119_0051673 3300048922 Bacteria 2524
452 Ga0496120_0290989 3300048923 Bacteria 751
453 Ga0496121_0015798 3300048924 Bacteria 7861
454 Ga0496121_0033980 3300048924 Bacteria 4600
455 Ga0496121_0158234 3300048924 Bacteria 1659
456 Ga0496121_0232196 3300048924 Bacteria 1291
457 Ga0496122_0005330 3300048925 Bacteria 15377
458 Ga0496122_0015447 3300048925 Bacteria 7299
459 Ga0496122_0054453 3300048925 Bacteria 3004
460 Ga0496122_0066320 3300048925 Bacteria 2609
461 Ga0496122_0287932 3300048925 Bacteria 894
462 Ga0496123_0001547 3300048926 Bacteria 31705
463 Ga0496123_0043336 3300048926 Bacteria 3092
464 Ga0496123_0227661 3300048926 Bacteria 935
465 Ga0496124_0035769 3300048927 Bacteria 4341
466 Ga0496124_0092390 3300048927 Bacteria 2465
467 Ga0496124_0161147 3300048927 Bacteria 1748
468 Ga0496124_0179325 3300048927 Bacteria 1632
469 Ga0496124_0257646 3300048927 Bacteria 1286
470 Ga0496125_0223970 3300048928 Bacteria 1209
471 Ga0496125_0443761 3300048928 Bacteria 745
472 Ga0496126_0119612 3300048929 Bacteria 2286
473 Ga0496126_0316141 3300048929 Bacteria 1285
474 Ga0495678_001109 3300049459 Bacteria 22514
475 Ga0495678_001873 3300049459 Bacteria 15296
476 Ga0495678_001982 3300049459 Bacteria 14750
477 Ga0495678_002649 3300049459 Bacteria 11881
478 Ga0495682_0000880 3300049460 Bacteria 18619
479 Ga0495682_0000885 3300049460 Bacteria 18555
480 Ga0495682_0001690 3300049460 Bacteria 11247
481 Ga0495682_0008049 3300049460 Bacteria 4169
482 Ga0495682_0050988 3300049460 Bacteria 1505
483 Ga0501033_0000167 3300049570 Bacteria 63051
484 Ga0501034_0002707 3300049571 Bacteria 20879
485 Ga0501034_0008079 3300049571 Bacteria 11159
486 Ga0501034_0788799 3300049571 Bacteria 843
487 Ga0501034_1035999 3300049571 Bacteria 703
488 Ga0501043_0647170 3300049579 Bacteria 777
489 Ga0501046_0000063 3300049580 Bacteria 117905
490 Ga0501068_0008036 3300049584 Bacteria 5849
491 Ga0501070_0258053 3300049586 Bacteria 1425
492 Ga0501070_0398338 3300049586 Bacteria 1113
493 Ga0501235_010034 3300049669 Bacteria 2071
494 Ga0501238_002483 3300049671 Bacteria 2211
495 Ga0501280_000672 3300049776 Bacteria 7593
496 Ga0501035_0001088 3300049822 Bacteria 28512
497 nmdc:mga03683_1274_c1 3300050489 Bacteria 7467
498 nmdc:mga03n38_517970_c1 3300050490 Bacteria 671
499 nmdc:mga04h51_271981_c1 3300050495 Bacteria 684
500 nmdc:mga08y16_1201784_c1 3300050511 Bacteria 729
501 nmdc:mga08y16_635363_c1 3300050511 Bacteria 1073
502 nmdc:mga0sz30_7300_c1 3300050516 Bacteria 4141
503 Ga0500610_0266600 3300053079 Bacteria 778
504 Ga0500583_0356586 3300053092 Bacteria 708
505 Ga0500641_0001556 3300053096 Bacteria 8174
506 Ga0500618_037162 3300053125 Bacteria 1126
507 Ga0500642_0124065 3300053130 Bacteria 1209
508 Ga0500559_0001422 3300053136 Bacteria 13576
509 Ga0500577_0086742 3300053142 Bacteria 1258
510 Ga0500586_000260 3300053145 Bacteria 10537
511 Ga0500616_0000923 3300053153 Bacteria 32124
512 Ga0500616_0101397 3300053153 Bacteria 1406
513 Ga0500636_0270852 3300053177 Bacteria 853
514 Ga0500601_001468 3300053737 Bacteria 2586
515 Ga0501082_0855940 3300060353 Bacteria 795
516 Ga0466962_0060033 3300061719 Bacteria 1815
517 Ga0466962_0220462 3300061719 Bacteria 929
518 2509078374 2508501114 Bacteria 7082538
519 2510840525 2510461069 Bacteria 5505000
520 2561466472 2558860983 Bacteria 4133860
521 2601672124 2600255292 Bacteria 6300551
522 2644252558 2643221645 Bacteria 7207331
523 2644300277 2643221653 Bacteria 4569637
524 2644356118 2643221664 Bacteria 7272945
525 2644658503 2643221719 Bacteria 4568197
526 2738743006 2738541280 Bacteria 6630198
527 2738830631 2738541297 Bacteria 6549566
528 2738847158 2738541300 Bacteria 6675882
529 2738946111 2738541317 Bacteria 5340176
530 2739154427 2738541357 Bacteria 6549408
531 2739196347 2738543003 Bacteria 6549560
532 2739277937 2738543018 Bacteria 6718814
533 2739322823 2738543026 Bacteria 6549408
534 2739341064 2738543029 Bacteria 6549249
535 2739346980 2738543030 Bacteria 6719714
536 2776259579 2775506901 Bacteria 9631051
537 2776913591 2775507049 Bacteria 6284736
538 2809147760 2808606418 Bacteria 6724496
539 2819242105 2818991272 Bacteria 4622173
540 2819720424 2818991467 Bacteria 5893227
541 2821136530 2821131069 Bacteria 6108407
542 2828309449 2828305725 Bacteria 4916900
543 2842695943 2842694124 Bacteria 4063419
544 2842700964 2842698319 Bacteria 5190321
545 2842718123 2842711865 Bacteria 7155354
546 2857552480 2857547612 Bacteria 6179999
547 2857570414 2857564685 Bacteria 6290584
548 2885085879 2885080285 Bacteria 6355622
549 2898798057 2898795034 Bacteria 4294459
550 2899809061 2899803654 Bacteria 5577784
551 2913311306 2913308742 Bacteria 5350706
552 2932415304 2932410948 Bacteria 6312192
553 2932421048 2932416698 Bacteria 6315112
554 2989778618 2989776772 Bacteria 4843317
555 8002288848 8002285264 Bacteria 6717907
556 8005250883 8005246636 Bacteria 4933972
557 8005659584 8005658619 Bacteria 4500593
558 8055435924 8055431914 Bacteria 4551896
559 Ga0070707_100111150
560 JGI25154J39366_1001374
561 JGI25150J39212_1012883
562 rootL2_10048407
563 JGI25161J50226_1014720
564 Ga0006562J51391_1058120
565 Ga0055529_1000829
566 Ga0055526_1000877
567 Ga0055526_1000900
568 Ga0055524_1000840
569 Ga0055543_1002285
570 Ga0065165_1002135
571 Ga0065165_1002855
572 Ga0065714_10126169
573 Ga0070677_10071218
574 Ga0068868_100337024
575 Ga0070661_100099049
576 Ga0070713_100731241
577 Ga0070698_100002900
578 Ga0070697_100046322
579 Ga0070665_100088853
580 Ga0070664_100048956
581 Ga0070664_100234510
582 Ga0068856_100103008
583 Ga0068852_100121126
584 Ga0068859_100223312
585 Ga0068863_100140282
586 Ga0068860_100130310
587 Ga0081455_10011026
588 Ga0081538_10089603
589 Ga0081539_10001936
590 Ga0081539_10006495
591 Ga0070717_10765919
592 Ga0075365_10084979
593 Ga0075365_10498632
594 Ga0075368_10099384
595 Ga0075362_10023742
596 Ga0075362_10032946
597 Ga0075367_10003354
598 Ga0075367_10079454
599 Ga0075369_10027174
600 Ga0097621_100360009
601 Ga0075370_10196208
602 Ga0097620_100223296
603 Ga0099826_10000422
604 Ga0105244_10002702
605 Ga0105244_10262141
606 Ga0105250_10040950
607 Ga0111539_10346368
608 Ga0111539_11135206
609 Ga0105247_10154808
610 Ga0105238_10382951
611 Ga0105035_102264
612 Ga0099796_10013125
613 Ga0105239_10492272
614 Ga0105239_10682258
615 Ga0157371_10067128
616 Ga0157370_10925029
617 Ga0157378_10252149
618 Ga0157378_10258042
619 Ga0163162_11010938
620 Ga0157375_10535316
621 Ga0182008_10005542
622 Ga0182006_1000030
623 Ga0182007_10000803
624 Ga0182005_1000021
625 Ga0163161_10028114
626 Ga0163161_10101951
627 Ga0163161_10869812
628 Ga0213872_10001038
629 Ga0213871_10012402
630 Ga0209437_115415
631 Ga0207425_1001348
632 Ga0207425_1005129
633 Ga0209646_1000478
634 Ga0209677_112116
635 Ga0209565_1025040
636 Ga0209455_1000750
637 Ga0209130_1001230
638 Ga0209025_1007793
639 Ga0209564_1001562
640 Ga0209564_1001592
641 Ga0209758_1001629
642 Ga0209256_1001792
643 Ga0207655_1010380
644 Ga0207685_10341660
645 Ga0207705_10479216
646 Ga0207657_10317950
647 Ga0207644_10870782
648 Ga0207679_10103046
649 Ga0207679_10157232
650 Ga0207641_10089728
651 Ga0207674_10478437
652 Ga0209282_1000454
653 Ga0207428_10393733
654 Ga0207428_10413452
655 Ga0268266_10054432
656 Ga0268266_11038936
657 Ga0268264_10222831
658 Ga0265326_10004572
659 Ga0265319_1000354
660 Ga0265334_10001600
661 Ga0265318_10044567
662 Ga0265323_10000264
663 Ga0265336_10000291
664 Ga0265338_10000317
665 Ga0265328_10000085
666 Ga0265328_10009605
667 Ga0265328_10105938
668 Ga0265331_10001315
669 Ga0265331_10005130
670 Ga0265331_10033172
671 Ga0265327_10006926
672 Ga0265327_10015010
673 Ga0265327_10164576
674 Ga0265316_10003717
675 Ga0265316_10083847
676 Ga0265316_10416639
677 Ga0265314_10024881
678 Ga0265342_10055585
679 Ga0307412_10328646
680 Ga0307412_10621972
681 Ga0307416_100130727
682 Ga0307416_100316552
683 Ga0373934_0188250
684 Ga0373953_0087699
685 Ga0373954_0160605
686 Ga0373956_0202821
687 Ga0373955_0011640
688 Ga0373961_0165219
689 Ga0373924_0085857
690 Ga0373927_0000556
691 Ga0373933_0038986
692 Ga0373925_0035085
693 Ga0395899_0084666
694 Ga0395900_0000020
695 Ga0395898_0000104
696 Ga0395898_0123610
697 Ga0395905_0000019
698 Ga0395905_0164412
699 Ga0436364_0233354
700 Ga0436364_0240121
701 Ga0395901_0000016
702 Ga0395901_0027334
703 Ga0395901_1451681
704 Ga0436365_0157200
705 Ga0436360_0276376
706 Ga0436360_0486597
707 Ga0436360_1088619
708 Ga0436360_1204653
709 Ga0436361_0463751
710 Ga0436363_1556987
711 Ga0436362_0083770
712 Ga0439432_130444
713 Ga0450904_000471
714 Ga0439459_0016381
715 Ga0451577_0054509
716 Ga0466982_0324581
717 Ga0466965_0503012
718 Ga0466964_0042266
719 Ga0453684_0000048
720 Ga0466971_0043818
721 Ga0466968_0070880
722 Ga0466970_0096986
723 Ga0466957_0020541
724 Ga0466957_0189917
725 Ga0466960_0051188
726 Ga0466959_0037916
727 Ga0451576_0171287
728 Ga0466967_0033352
729 Ga0495617_000441
730 Ga0495617_001986
731 Ga0495627_007918
732 Ga0495627_053454
733 Ga0495592_0158648
734 Ga0495590_0000382
735 Ga0495590_0000697
736 Ga0495590_0009717
737 Ga0495590_0030415
738 Ga0495591_002965
739 Ga0495591_010303
740 Ga0495638_0001370
741 Ga0495638_0026933
742 Ga0495638_0036152
743 Ga0495638_0059303
744 Ga0495638_0069300
745 Ga0495638_0106851
746 Ga0495651_0078255
747 Ga0495653_0000925
748 Ga0495653_0311056
749 Ga0495650_0001486
750 Ga0495650_0001777
751 Ga0495650_0001842
752 Ga0495650_0002555
753 Ga0495650_0002810
754 Ga0495650_0020283
755 Ga0495605_0000802
756 Ga0495605_0002350
757 Ga0495605_0016140
758 Ga0495605_0058189
759 Ga0495605_0079552
760 Ga0495605_0194390
761 Ga0495639_0025932
762 Ga0495664_0126629
763 Ga0495584_0000946
764 Ga0495584_0001277
765 Ga0495584_0044566
766 Ga0495585_0003632
767 Ga0495585_0005643
768 Ga0495585_0009043
769 Ga0495585_0009991
770 Ga0495596_0002084
771 Ga0495596_0002347
772 Ga0495596_0002769
773 Ga0495596_0003972
774 Ga0495596_0009139
775 Ga0495596_0020833
776 Ga0495596_0064875
777 Ga0495607_0001294
778 Ga0495607_0005328
779 Ga0495607_0009636
780 Ga0495607_0010921
781 Ga0495607_0019504
782 Ga0495607_0062908
783 Ga0495607_0072595
784 Ga0495607_0141667
785 Ga0495607_0158027
786 Ga0495583_0001441
787 Ga0495583_0001587
788 Ga0495583_0002012
789 Ga0495583_0002508
790 Ga0495583_0010701
791 Ga0495583_0020901
792 Ga0495583_0056120
793 Ga0495583_0075820
794 Ga0495606_0002177
795 Ga0495606_0002301
796 Ga0495606_0002310
797 Ga0495606_0010860
798 Ga0495606_0019107
799 Ga0495608_0224133
800 Ga0495610_0001281
801 Ga0495610_0005073
802 Ga0495610_0016479
803 Ga0495610_0139233
804 Ga0495616_0008733
805 Ga0495616_0014299
806 Ga0495616_0059386
807 Ga0495616_0136465
808 Ga0495616_0274101
809 Ga0495618_0053893
810 Ga0495620_0063594
811 Ga0495628_0354785
812 Ga0495631_0001506
813 Ga0495631_0026959
814 Ga0495631_0101634
815 Ga0495631_0199965
816 Ga0495632_0053643
817 Ga0495637_0001253
818 Ga0495637_0036976
819 Ga0495643_0001402
820 Ga0495643_0082243
821 Ga0495643_0238159
822 Ga0495644_0000617
823 Ga0495644_0000677
824 Ga0495644_0004334
825 Ga0495644_0012466
826 Ga0495644_0037735
827 Ga0495644_0089648
828 Ga0495648_0001548
829 Ga0495648_0003952
830 Ga0495648_0004671
831 Ga0495648_0007230
832 Ga0495648_0018016
833 Ga0495648_0067123
834 Ga0495663_0071254
835 Ga0495642_0001056
836 Ga0495642_0014163
837 Ga0495642_0047121
838 Ga0495642_0062696
839 Ga0495642_0078709
840 Ga0495642_0187612
841 Ga0495652_0338556
842 Ga0495654_0002902
843 Ga0495640_0034126
844 Ga0495586_0190915
845 Ga0495609_0001195
846 Ga0495609_0001452
847 Ga0495609_0003724
848 Ga0495609_0004604
849 Ga0495609_0023049
850 Ga0495597_0000937
851 Ga0495597_0001684
852 Ga0495597_0004571
853 Ga0495597_0088340
854 Ga0495597_0116760
855 Ga0495645_0023911
856 Ga0495622_0000393
857 Ga0495622_0000554
858 Ga0495622_0025651
859 Ga0495622_0030866
860 Ga0495633_0000914
861 Ga0495633_0001052
862 Ga0495633_0001946
863 Ga0495633_0003562
864 Ga0495633_0004089
865 Ga0495633_0004106
866 Ga0495633_0037619
867 Ga0495668_0001481
868 Ga0495668_0001997
869 Ga0495668_0002082
870 Ga0495668_0010757
871 Ga0495668_0017201
872 Ga0495668_0021967
873 Ga0495668_0091327
874 Ga0495634_0120477
875 Ga0495611_0001011
876 Ga0495611_0001330
877 Ga0495611_0007478
878 Ga0495611_0013892
879 Ga0495611_0067994
880 Ga0495625_0002013
881 Ga0495625_0002064
882 Ga0495625_0016595
883 Ga0495625_0029026
884 Ga0495625_0038356
885 Ga0495625_0234217
886 Ga0495635_0037937
887 Ga0495659_0000322
888 Ga0495659_0000611
889 Ga0495659_0003392
890 Ga0495661_0008427
891 Ga0495661_0048553
892 Ga0495661_0065370
893 Ga0495661_0090815
894 Ga0495661_0128241
895 Ga0495661_0159823
896 Ga0495661_0188647
897 Ga0495657_0036839
898 Ga0495599_0051786
899 Ga0495623_0056669
900 Ga0495646_0017430
901 Ga0495669_0000656
902 Ga0495669_0084770
903 Ga0495624_0106093
904 Ga0495670_0002302
905 Ga0495670_0045650
906 Ga0495670_0097669
907 Ga0495670_0110264
908 Ga0495671_0001117
909 Ga0495671_0002076
910 Ga0495671_0008181
911 Ga0495671_0048794
912 Ga0495671_0054921
913 Ga0495671_0068975
914 Ga0495671_0177249
915 Ga0495671_0179187
916 Ga0495649_0001876
917 Ga0495649_0030002
918 Ga0495649_0058506
919 Ga0495649_0105591
920 Ga0495649_0231670
921 Ga0495589_0004107
922 Ga0495589_0005713
923 Ga0495589_0006715
924 Ga0495589_0181650
925 Ga0495600_0070127
926 Ga0495660_0001178
927 Ga0495660_0004244
928 Ga0495660_0004344
929 Ga0495660_0006519
930 Ga0495660_0011430
931 Ga0495660_0012016
932 Ga0495660_0023901
933 Ga0495660_0035465
934 Ga0495660_0072075
935 Ga0495581_0335702
936 Ga0495604_0174693
937 Ga0495636_0000622
938 Ga0495636_0001889
939 Ga0495636_0061519
940 Ga0495672_0002076
941 Ga0495672_0003190
942 Ga0495672_0003721
943 Ga0495672_0003834
944 Ga0495672_0033972
945 Ga0495676_0253599
946 Ga0495680_0106085
947 Ga0495683_0003077
948 Ga0495683_0003094
949 Ga0495683_0019247
950 Ga0495683_0026636
951 Ga0495683_0241521
952 Ga0495687_001871
953 Ga0495687_001987
954 Ga0495687_002610
955 Ga0495687_004208
956 Ga0495687_026733
957 Ga0495675_0183160
958 Ga0495677_0001296
959 Ga0495677_0004991
960 Ga0495677_0011368
961 Ga0495677_0013081
962 Ga0495677_0044301
963 Ga0495677_0093519
964 Ga0495679_007668
965 Ga0495679_033743
966 Ga0495679_034198
967 Ga0495685_001257
968 Ga0495685_003331
969 Ga0495685_106295
970 Ga0495673_0001145
971 Ga0495673_0001156
972 Ga0495681_0000433
973 Ga0495681_0067497
974 Ga0495681_0097490
975 Ga0495681_0137760
976 Ga0495686_0002901
977 Ga0495686_0003304
978 Ga0495686_0037903
979 Ga0495686_0060146
980 Ga0495593_0027288
981 Ga0495602_0037499
982 Ga0495626_0002174
983 Ga0495626_0005185
984 Ga0495626_0009078
985 Ga0496100_0321329
986 Ga0496102_0024797
987 Ga0496102_0516224
988 Ga0496103_0217815
989 Ga0496104_0002205
990 Ga0496104_0005460
991 Ga0496104_0462434
992 Ga0496104_1379429
993 Ga0496107_0139193
994 Ga0496108_0203453
995 Ga0496109_0159252
996 Ga0496112_0192563
997 Ga0496112_0819221
998 Ga0496113_0366211
999 Ga0496113_0497950
1000 Ga0496114_0527602
1001 Ga0496115_0039687
1002 Ga0496116_0034676
1003 Ga0496116_0076355
1004 Ga0496116_0150994
1005 Ga0496117_0000056
1006 Ga0496118_0000047
1007 Ga0496118_0017403
1008 Ga0496118_0160384
1009 Ga0496119_0051673
1010 Ga0496120_0290989
1011 Ga0496121_0015798
1012 Ga0496121_0033980
1013 Ga0496121_0158234
1014 Ga0496121_0232196
1015 Ga0496122_0005330
1016 Ga0496122_0015447
1017 Ga0496122_0054453
1018 Ga0496122_0066320
1019 Ga0496122_0287932
1020 Ga0496123_0001547
1021 Ga0496123_0043336
1022 Ga0496123_0227661
1023 Ga0496124_0035769
1024 Ga0496124_0092390
1025 Ga0496124_0161147
1026 Ga0496124_0179325
1027 Ga0496124_0257646
1028 Ga0496125_0223970
1029 Ga0496125_0443761
1030 Ga0496126_0119612
1031 Ga0496126_0316141
1032 Ga0495678_001109
1033 Ga0495678_001873
1034 Ga0495678_001982
1035 Ga0495678_002649
1036 Ga0495682_0000880
1037 Ga0495682_0000885
1038 Ga0495682_0001690
1039 Ga0495682_0008049
1040 Ga0495682_0050988
1041 Ga0501033_0000167
1042 Ga0501034_0002707
1043 Ga0501034_0008079
1044 Ga0501034_0788799
1045 Ga0501034_1035999
1046 Ga0501043_0647170
1047 Ga0501046_0000063
1048 Ga0501068_0008036
1049 Ga0501070_0258053
1050 Ga0501070_0398338
1051 Ga0501235_010034
1052 Ga0501238_002483
1053 Ga0501280_000672
1054 Ga0501035_0001088
1055 nmdc:mga03683_1274_c1
1056 nmdc:mga03n38_517970_c1
1057 nmdc:mga04h51_271981_c1
1058 nmdc:mga08y16_1201784_c1
1059 nmdc:mga08y16_635363_c1
1060 nmdc:mga0sz30_7300_c1
1061 Ga0500610_0266600
1062 Ga0500583_0356586
1063 Ga0500641_0001556
1064 Ga0500618_037162
1065 Ga0500642_0124065
1066 Ga0500559_0001422
1067 Ga0500577_0086742
1068 Ga0500586_000260
1069 Ga0500616_0000923
1070 Ga0500616_0101397
1071 Ga0500636_0270852
1072 Ga0500601_001468
1073 Ga0501082_0855940
1074 Ga0466962_0060033
1075 Ga0466962_0220462
1076 2509078374
1077 2510840525
1078 2561466472
1079 2601672124
1080 2644252558
1081 2644300277
1082 2644356118
1083 2644658503
1084 2738743006
1085 2738830631
1086 2738847158
1087 2738946111
1088 2739154427
1089 2739196347
1090 2739277937
1091 2739322823
1092 2739341064
1093 2739346980
1094 2776259579
1095 2776913591
1096 2809147760
1097 2819242105
1098 2819720424
1099 2821136530
1100 2828309449
1101 2842695943
1102 2842700964
1103 2842718123
1104 2857552480
1105 2857570414
1106 2885085879
1107 2898798057
1108 2899809061
1109 2913311306
1110 2932415304
1111 2932421048
1112 2989778618
1113 8002288848
1114 8005250883
1115 8005659584
1116 8055435924

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02572

CobA_CobO_BtuR

ATP:corrinoid adenosyltransferase BtuR/CobO/CobP

51

222

0.99

PF12557

Co_AT_N

Cob(I)alamin adenosyltransferase N terminal

20

45

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8876 43 193
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.8798 43 183
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.785 43 193
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.781 43 183
1g64-assembly1.cif.gz_B the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex 0.7727 23 193
ID Description Score Start End Superfamily
1g5rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8743 43 183 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8502 38 196 3.40.50.300
af_I6Y1V6_9_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8254 43 196 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.791 38 196 3.40.50.300
1g5rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7732 43 183 3.40.50.300
ID Description Score Start End GO Terms
AF-V9PFW6-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9446 43 172 GO:0005524
GO:0008817
GO:0009236
AF-A0A3D1XR81-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase 0.9392 44 151 GO:0005524
GO:0008817
GO:0009236
AF-A0A227J7G0-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9384 43 151 GO:0005524
GO:0008817
GO:0009236
AF-A0A528N548-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9376 48 143 GO:0005524
GO:0008817
GO:0009236
AF-A0A2X4TV31-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9272 55 170 GO:0005524
GO:0008817
GO:0009236

Map