F463411
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 558 | 304 | 1116 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100111150|Ga0070707_1001111502 |
| Length | 222 |
| Sequence | LLAADWPPILHAPTGKQPRMPADIDEQARHKAKMANRKAVQDAEVADKTVEKGLLIVHTGKGKGKSTAAWGLLLRAIGRGLRCGVVQFGKGAWQTGERAAIERLGDQVEWHTLGEGFTWETQDRNRDVEAARRAWAKTRELMANPAIRLIVLDELNIALRYDHLDIKDVVEALKARRPDQHIVVTGRNAKPELIEAADLVTEMTLVKHHFAAGVKAQEGIEF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 32 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 33 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 34 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 45 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 58 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 59 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 79 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 83 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 84 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 85 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 86 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 87 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 91 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 92 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 93 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 98 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 99 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 100 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 102 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 103 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 104 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 105 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 106 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 115 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 118 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 119 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 120 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 123 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 124 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 125 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 126 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 127 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 128 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 129 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 130 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 224 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 225 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 226 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 227 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 228 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 229 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 230 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 231 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 232 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 233 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 234 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 248 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 252 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 253 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 254 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 255 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 256 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 257 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 258 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 259 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 260 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 262 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 264 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 265 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 266 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 267 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 268 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 269 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 270 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 271 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 272 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 273 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 274 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 275 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 276 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 277 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 278 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 279 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 280 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 281 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 282 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 283 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 284 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 285 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 286 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 287 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 288 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 289 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 290 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 291 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 292 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 293 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 294 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 295 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 296 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 297 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 298 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 299 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 300 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 301 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 302 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 303 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 304 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.47 |
| Metatranscriptomes | 0.18 |
| Isolates | 7.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.24 |
| Nodule | 0.72 |
| Rhizoplane | 3.41 |
| Rhizosphere | 75.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100111150 | 3300005468 | Bacteria | 2657 |
| 2 | JGI25154J39366_1001374 | 3300002738 | Bacteria | 8835 |
| 3 | JGI25150J39212_1012883 | 3300002774 | Bacteria | 1464 |
| 4 | rootL2_10048407 | 3300003322 | Bacteria | 9581 |
| 5 | JGI25161J50226_1014720 | 3300003374 | Bacteria | 868 |
| 6 | Ga0006562J51391_1058120 | 3300003578 | Bacteria | 904 |
| 7 | Ga0055529_1000829 | 3300003763 | Bacteria | 18265 |
| 8 | Ga0055526_1000877 | 3300003771 | Bacteria | 22381 |
| 9 | Ga0055526_1000900 | 3300003771 | Bacteria | 22136 |
| 10 | Ga0055524_1000840 | 3300003775 | Bacteria | 20142 |
| 11 | Ga0055543_1002285 | 3300004625 | Bacteria | 6471 |
| 12 | Ga0065165_1002135 | 3300005262 | Bacteria | 17962 |
| 13 | Ga0065165_1002855 | 3300005262 | Bacteria | 13402 |
| 14 | Ga0065714_10126169 | 3300005288 | Bacteria | 1294 |
| 15 | Ga0070677_10071218 | 3300005333 | Bacteria | 1463 |
| 16 | Ga0068868_100337024 | 3300005338 | Bacteria | 1289 |
| 17 | Ga0070661_100099049 | 3300005344 | Bacteria | 2165 |
| 18 | Ga0070713_100731241 | 3300005436 | Bacteria | 946 |
| 19 | Ga0070698_100002900 | 3300005471 | Bacteria | 18876 |
| 20 | Ga0070697_100046322 | 3300005536 | Bacteria | 3525 |
| 21 | Ga0070665_100088853 | 3300005548 | Bacteria | 3096 |
| 22 | Ga0070664_100048956 | 3300005564 | Bacteria | 3573 |
| 23 | Ga0070664_100234510 | 3300005564 | Bacteria | 1646 |
| 24 | Ga0068856_100103008 | 3300005614 | Bacteria | 2848 |
| 25 | Ga0068852_100121126 | 3300005616 | Bacteria | 2395 |
| 26 | Ga0068859_100223312 | 3300005617 | Bacteria | 1972 |
| 27 | Ga0068863_100140282 | 3300005841 | Bacteria | 2310 |
| 28 | Ga0068860_100130310 | 3300005843 | Bacteria | 2413 |
| 29 | Ga0081455_10011026 | 3300005937 | Bacteria | 9103 |
| 30 | Ga0081538_10089603 | 3300005981 | Bacteria | 1596 |
| 31 | Ga0081539_10001936 | 3300005985 | Bacteria | 31745 |
| 32 | Ga0081539_10006495 | 3300005985 | Bacteria | 11180 |
| 33 | Ga0070717_10765919 | 3300006028 | Bacteria | 877 |
| 34 | Ga0075365_10084979 | 3300006038 | Bacteria | 2149 |
| 35 | Ga0075365_10498632 | 3300006038 | Bacteria | 860 |
| 36 | Ga0075368_10099384 | 3300006042 | Bacteria | 1194 |
| 37 | Ga0075362_10023742 | 3300006177 | Bacteria | 2596 |
| 38 | Ga0075362_10032946 | 3300006177 | Bacteria | 2252 |
| 39 | Ga0075367_10003354 | 3300006178 | Bacteria | 7617 |
| 40 | Ga0075367_10079454 | 3300006178 | Bacteria | 1982 |
| 41 | Ga0075369_10027174 | 3300006186 | Bacteria | 2391 |
| 42 | Ga0097621_100360009 | 3300006237 | Bacteria | 1296 |
| 43 | Ga0075370_10196208 | 3300006353 | Bacteria | 1190 |
| 44 | Ga0097620_100223296 | 3300006931 | Bacteria | 1972 |
| 45 | Ga0099826_10000422 | 3300006948 | Bacteria | 20102 |
| 46 | Ga0105244_10002702 | 3300009036 | Bacteria | 13261 |
| 47 | Ga0105244_10262141 | 3300009036 | Bacteria | 804 |
| 48 | Ga0105250_10040950 | 3300009092 | Bacteria | 1858 |
| 49 | Ga0111539_10346368 | 3300009094 | Bacteria | 1729 |
| 50 | Ga0111539_11135206 | 3300009094 | Bacteria | 908 |
| 51 | Ga0105247_10154808 | 3300009101 | Bacteria | 1513 |
| 52 | Ga0105238_10382951 | 3300009551 | Bacteria | 1398 |
| 53 | Ga0105035_102264 | 3300009988 | Bacteria | 1408 |
| 54 | Ga0099796_10013125 | 3300010159 | Bacteria | 2358 |
| 55 | Ga0105239_10492272 | 3300010375 | Bacteria | 1394 |
| 56 | Ga0105239_10682258 | 3300010375 | Bacteria | 1174 |
| 57 | Ga0157371_10067128 | 3300013102 | Bacteria | 2539 |
| 58 | Ga0157370_10925029 | 3300013104 | Bacteria | 791 |
| 59 | Ga0157378_10252149 | 3300013297 | Bacteria | 1690 |
| 60 | Ga0157378_10258042 | 3300013297 | Bacteria | 1671 |
| 61 | Ga0163162_11010938 | 3300013306 | Bacteria | 940 |
| 62 | Ga0157375_10535316 | 3300013308 | Bacteria | 1334 |
| 63 | Ga0182008_10005542 | 3300014497 | Bacteria | 7171 |
| 64 | Ga0182006_1000030 | 3300015261 | Bacteria | 242894 |
| 65 | Ga0182007_10000803 | 3300015262 | Bacteria | 17533 |
| 66 | Ga0182005_1000021 | 3300015265 | Bacteria | 272185 |
| 67 | Ga0163161_10028114 | 3300017792 | Bacteria | 3991 |
| 68 | Ga0163161_10101951 | 3300017792 | Bacteria | 2137 |
| 69 | Ga0163161_10869812 | 3300017792 | Bacteria | 762 |
| 70 | Ga0213872_10001038 | 3300021361 | Bacteria | 19363 |
| 71 | Ga0213871_10012402 | 3300021441 | Bacteria | 1979 |
| 72 | Ga0209437_115415 | 3300025233 | Bacteria | 1044 |
| 73 | Ga0207425_1001348 | 3300025245 | Bacteria | 10512 |
| 74 | Ga0207425_1005129 | 3300025245 | Bacteria | 3784 |
| 75 | Ga0209646_1000478 | 3300025246 | Bacteria | 19998 |
| 76 | Ga0209677_112116 | 3300025253 | Bacteria | 1299 |
| 77 | Ga0209565_1025040 | 3300025263 | Bacteria | 1209 |
| 78 | Ga0209455_1000750 | 3300025272 | Bacteria | 18541 |
| 79 | Ga0209130_1001230 | 3300025284 | Bacteria | 17998 |
| 80 | Ga0209025_1007793 | 3300025294 | Bacteria | 7878 |
| 81 | Ga0209564_1001562 | 3300025295 | Bacteria | 22487 |
| 82 | Ga0209564_1001592 | 3300025295 | Bacteria | 22188 |
| 83 | Ga0209758_1001629 | 3300025297 | Bacteria | 25551 |
| 84 | Ga0209256_1001792 | 3300025299 | Bacteria | 20292 |
| 85 | Ga0207655_1010380 | 3300025728 | Bacteria | 5650 |
| 86 | Ga0207685_10341660 | 3300025905 | Bacteria | 752 |
| 87 | Ga0207705_10479216 | 3300025909 | Bacteria | 966 |
| 88 | Ga0207657_10317950 | 3300025919 | Bacteria | 1231 |
| 89 | Ga0207644_10870782 | 3300025931 | Bacteria | 755 |
| 90 | Ga0207679_10103046 | 3300025945 | Bacteria | 2236 |
| 91 | Ga0207679_10157232 | 3300025945 | Bacteria | 1857 |
| 92 | Ga0207641_10089728 | 3300026088 | Bacteria | 2687 |
| 93 | Ga0207674_10478437 | 3300026116 | Bacteria | 1204 |
| 94 | Ga0209282_1000454 | 3300027666 | Bacteria | 20110 |
| 95 | Ga0207428_10393733 | 3300027907 | Bacteria | 1015 |
| 96 | Ga0207428_10413452 | 3300027907 | Bacteria | 987 |
| 97 | Ga0268266_10054432 | 3300028379 | Bacteria | 3438 |
| 98 | Ga0268266_11038936 | 3300028379 | Bacteria | 793 |
| 99 | Ga0268264_10222831 | 3300028381 | Bacteria | 1737 |
| 100 | Ga0265326_10004572 | 3300028558 | Bacteria | 4422 |
| 101 | Ga0265319_1000354 | 3300028563 | Bacteria | 33255 |
| 102 | Ga0265334_10001600 | 3300028573 | Bacteria | 10889 |
| 103 | Ga0265318_10044567 | 3300028577 | Bacteria | 1678 |
| 104 | Ga0265323_10000264 | 3300028653 | Bacteria | 30779 |
| 105 | Ga0265336_10000291 | 3300028666 | Bacteria | 34334 |
| 106 | Ga0265338_10000317 | 3300028800 | Bacteria | 87318 |
| 107 | Ga0265328_10000085 | 3300031239 | Bacteria | 48380 |
| 108 | Ga0265328_10009605 | 3300031239 | Bacteria | 3933 |
| 109 | Ga0265328_10105938 | 3300031239 | Bacteria | 1043 |
| 110 | Ga0265331_10001315 | 3300031250 | Bacteria | 18423 |
| 111 | Ga0265331_10005130 | 3300031250 | Bacteria | 7979 |
| 112 | Ga0265331_10033172 | 3300031250 | Bacteria | 2554 |
| 113 | Ga0265327_10006926 | 3300031251 | Bacteria | 8908 |
| 114 | Ga0265327_10015010 | 3300031251 | Bacteria | 5034 |
| 115 | Ga0265327_10164576 | 3300031251 | Bacteria | 1022 |
| 116 | Ga0265316_10003717 | 3300031344 | Bacteria | 15360 |
| 117 | Ga0265316_10083847 | 3300031344 | Bacteria | 2441 |
| 118 | Ga0265316_10416639 | 3300031344 | Bacteria | 966 |
| 119 | Ga0265314_10024881 | 3300031711 | Bacteria | 4529 |
| 120 | Ga0265342_10055585 | 3300031712 | Bacteria | 2349 |
| 121 | Ga0307412_10328646 | 3300031911 | Bacteria | 1219 |
| 122 | Ga0307412_10621972 | 3300031911 | Bacteria | 917 |
| 123 | Ga0307416_100130727 | 3300032002 | Bacteria | 2259 |
| 124 | Ga0307416_100316552 | 3300032002 | Bacteria | 1560 |
| 125 | Ga0373934_0188250 | 3300035086 | Bacteria | 849 |
| 126 | Ga0373953_0087699 | 3300035117 | Bacteria | 1299 |
| 127 | Ga0373954_0160605 | 3300035118 | Bacteria | 1099 |
| 128 | Ga0373956_0202821 | 3300035119 | Bacteria | 940 |
| 129 | Ga0373955_0011640 | 3300035172 | Bacteria | 4201 |
| 130 | Ga0373961_0165219 | 3300035241 | Bacteria | 763 |
| 131 | Ga0373924_0085857 | 3300035410 | Bacteria | 1342 |
| 132 | Ga0373927_0000556 | 3300035695 | Bacteria | 28426 |
| 133 | Ga0373933_0038986 | 3300035724 | Bacteria | 2794 |
| 134 | Ga0373925_0035085 | 3300037068 | Bacteria | 3699 |
| 135 | Ga0395899_0084666 | 3300037312 | Bacteria | 2305 |
| 136 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 137 | Ga0395898_0000104 | 3300037466 | Bacteria | 223462 |
| 138 | Ga0395898_0123610 | 3300037466 | Bacteria | 2480 |
| 139 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 140 | Ga0395905_0164412 | 3300037471 | Bacteria | 2085 |
| 141 | Ga0436364_0233354 | 3300037853 | Bacteria | 1495 |
| 142 | Ga0436364_0240121 | 3300037853 | Bacteria | 732 |
| 143 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 144 | Ga0395901_0027334 | 3300038443 | Bacteria | 5860 |
| 145 | Ga0395901_1451681 | 3300038443 | Bacteria | 643 |
| 146 | Ga0436365_0157200 | 3300039437 | Bacteria | 743 |
| 147 | Ga0436360_0276376 | 3300039438 | Bacteria | 14151 |
| 148 | Ga0436360_0486597 | 3300039438 | Bacteria | 2803 |
| 149 | Ga0436360_1088619 | 3300039438 | Bacteria | 1133 |
| 150 | Ga0436360_1204653 | 3300039438 | Bacteria | 934 |
| 151 | Ga0436361_0463751 | 3300039447 | Bacteria | 19403 |
| 152 | Ga0436363_1556987 | 3300039450 | Bacteria | 698 |
| 153 | Ga0436362_0083770 | 3300039453 | Bacteria | 1507 |
| 154 | Ga0439432_130444 | 3300042006 | Bacteria | 742 |
| 155 | Ga0450904_000471 | 3300042139 | Bacteria | 7911 |
| 156 | Ga0439459_0016381 | 3300042438 | Bacteria | 1370 |
| 157 | Ga0451577_0054509 | 3300042876 | Bacteria | 3569 |
| 158 | Ga0466982_0324581 | 3300044672 | Bacteria | 866 |
| 159 | Ga0466965_0503012 | 3300044683 | Bacteria | 680 |
| 160 | Ga0466964_0042266 | 3300044706 | Bacteria | 1846 |
| 161 | Ga0453684_0000048 | 3300044712 | Bacteria | 559743 |
| 162 | Ga0466971_0043818 | 3300044719 | Bacteria | 2010 |
| 163 | Ga0466968_0070880 | 3300044735 | Bacteria | 1517 |
| 164 | Ga0466970_0096986 | 3300044765 | Bacteria | 1604 |
| 165 | Ga0466957_0020541 | 3300044842 | Bacteria | 3887 |
| 166 | Ga0466957_0189917 | 3300044842 | Bacteria | 1345 |
| 167 | Ga0466960_0051188 | 3300044901 | Bacteria | 1994 |
| 168 | Ga0466959_0037916 | 3300045049 | Bacteria | 3562 |
| 169 | Ga0451576_0171287 | 3300045051 | Bacteria | 2266 |
| 170 | Ga0466967_0033352 | 3300045976 | Bacteria | 4357 |
| 171 | Ga0495617_000441 | 3300046452 | Bacteria | 22411 |
| 172 | Ga0495617_001986 | 3300046452 | Bacteria | 8525 |
| 173 | Ga0495627_007918 | 3300046453 | Bacteria | 4026 |
| 174 | Ga0495627_053454 | 3300046453 | Bacteria | 1209 |
| 175 | Ga0495592_0158648 | 3300046454 | Bacteria | 1558 |
| 176 | Ga0495590_0000382 | 3300046457 | Bacteria | 22518 |
| 177 | Ga0495590_0000697 | 3300046457 | Bacteria | 15390 |
| 178 | Ga0495590_0009717 | 3300046457 | Bacteria | 3646 |
| 179 | Ga0495590_0030415 | 3300046457 | Bacteria | 1892 |
| 180 | Ga0495591_002965 | 3300046458 | Bacteria | 9064 |
| 181 | Ga0495591_010303 | 3300046458 | Bacteria | 3633 |
| 182 | Ga0495638_0001370 | 3300046460 | Bacteria | 22328 |
| 183 | Ga0495638_0026933 | 3300046460 | Bacteria | 3724 |
| 184 | Ga0495638_0036152 | 3300046460 | Bacteria | 3147 |
| 185 | Ga0495638_0059303 | 3300046460 | Bacteria | 2370 |
| 186 | Ga0495638_0069300 | 3300046460 | Bacteria | 2162 |
| 187 | Ga0495638_0106851 | 3300046460 | Bacteria | 1667 |
| 188 | Ga0495651_0078255 | 3300046462 | Bacteria | 2501 |
| 189 | Ga0495653_0000925 | 3300046463 | Bacteria | 22692 |
| 190 | Ga0495653_0311056 | 3300046463 | Bacteria | 1024 |
| 191 | Ga0495650_0001486 | 3300046471 | Bacteria | 22438 |
| 192 | Ga0495650_0001777 | 3300046471 | Bacteria | 19562 |
| 193 | Ga0495650_0001842 | 3300046471 | Bacteria | 18973 |
| 194 | Ga0495650_0002555 | 3300046471 | Bacteria | 14451 |
| 195 | Ga0495650_0002810 | 3300046471 | Bacteria | 13359 |
| 196 | Ga0495650_0020283 | 3300046471 | Bacteria | 3245 |
| 197 | Ga0495605_0000802 | 3300046474 | Bacteria | 22441 |
| 198 | Ga0495605_0002350 | 3300046474 | Bacteria | 11774 |
| 199 | Ga0495605_0016140 | 3300046474 | Bacteria | 4047 |
| 200 | Ga0495605_0058189 | 3300046474 | Bacteria | 1858 |
| 201 | Ga0495605_0079552 | 3300046474 | Bacteria | 1535 |
| 202 | Ga0495605_0194390 | 3300046474 | Bacteria | 886 |
| 203 | Ga0495639_0025932 | 3300046475 | Bacteria | 2587 |
| 204 | Ga0495664_0126629 | 3300046477 | Bacteria | 1545 |
| 205 | Ga0495584_0000946 | 3300046491 | Bacteria | 18272 |
| 206 | Ga0495584_0001277 | 3300046491 | Bacteria | 15320 |
| 207 | Ga0495584_0044566 | 3300046491 | Bacteria | 2238 |
| 208 | Ga0495585_0003632 | 3300046492 | Bacteria | 10330 |
| 209 | Ga0495585_0005643 | 3300046492 | Bacteria | 7860 |
| 210 | Ga0495585_0009043 | 3300046492 | Bacteria | 6000 |
| 211 | Ga0495585_0009991 | 3300046492 | Bacteria | 5670 |
| 212 | Ga0495596_0002084 | 3300046500 | Bacteria | 10960 |
| 213 | Ga0495596_0002347 | 3300046500 | Bacteria | 10251 |
| 214 | Ga0495596_0002769 | 3300046500 | Bacteria | 9181 |
| 215 | Ga0495596_0003972 | 3300046500 | Bacteria | 7309 |
| 216 | Ga0495596_0009139 | 3300046500 | Bacteria | 4373 |
| 217 | Ga0495596_0020833 | 3300046500 | Bacteria | 2680 |
| 218 | Ga0495596_0064875 | 3300046500 | Bacteria | 1420 |
| 219 | Ga0495607_0001294 | 3300046501 | Bacteria | 22348 |
| 220 | Ga0495607_0005328 | 3300046501 | Bacteria | 9241 |
| 221 | Ga0495607_0009636 | 3300046501 | Bacteria | 6527 |
| 222 | Ga0495607_0010921 | 3300046501 | Bacteria | 6076 |
| 223 | Ga0495607_0019504 | 3300046501 | Bacteria | 4306 |
| 224 | Ga0495607_0062908 | 3300046501 | Bacteria | 2101 |
| 225 | Ga0495607_0072595 | 3300046501 | Bacteria | 1915 |
| 226 | Ga0495607_0141667 | 3300046501 | Bacteria | 1239 |
| 227 | Ga0495607_0158027 | 3300046501 | Bacteria | 1154 |
| 228 | Ga0495583_0001441 | 3300046506 | Bacteria | 24155 |
| 229 | Ga0495583_0001587 | 3300046506 | Bacteria | 22385 |
| 230 | Ga0495583_0002012 | 3300046506 | Bacteria | 18526 |
| 231 | Ga0495583_0002508 | 3300046506 | Bacteria | 15547 |
| 232 | Ga0495583_0010701 | 3300046506 | Bacteria | 5326 |
| 233 | Ga0495583_0020901 | 3300046506 | Bacteria | 3376 |
| 234 | Ga0495583_0056120 | 3300046506 | Bacteria | 1777 |
| 235 | Ga0495583_0075820 | 3300046506 | Bacteria | 1470 |
| 236 | Ga0495606_0002177 | 3300046507 | Bacteria | 23548 |
| 237 | Ga0495606_0002301 | 3300046507 | Bacteria | 22541 |
| 238 | Ga0495606_0002310 | 3300046507 | Bacteria | 22457 |
| 239 | Ga0495606_0010860 | 3300046507 | Bacteria | 7501 |
| 240 | Ga0495606_0019107 | 3300046507 | Bacteria | 5111 |
| 241 | Ga0495608_0224133 | 3300046511 | Bacteria | 1178 |
| 242 | Ga0495610_0001281 | 3300046512 | Bacteria | 22474 |
| 243 | Ga0495610_0005073 | 3300046512 | Bacteria | 9488 |
| 244 | Ga0495610_0016479 | 3300046512 | Bacteria | 4250 |
| 245 | Ga0495610_0139233 | 3300046512 | Bacteria | 1046 |
| 246 | Ga0495616_0008733 | 3300046513 | Bacteria | 5971 |
| 247 | Ga0495616_0014299 | 3300046513 | Bacteria | 4446 |
| 248 | Ga0495616_0059386 | 3300046513 | Bacteria | 1881 |
| 249 | Ga0495616_0136465 | 3300046513 | Bacteria | 1120 |
| 250 | Ga0495616_0274101 | 3300046513 | Bacteria | 718 |
| 251 | Ga0495618_0053893 | 3300046514 | Bacteria | 2543 |
| 252 | Ga0495620_0063594 | 3300046515 | Bacteria | 1529 |
| 253 | Ga0495628_0354785 | 3300046516 | Bacteria | 1077 |
| 254 | Ga0495631_0001506 | 3300046518 | Bacteria | 14043 |
| 255 | Ga0495631_0026959 | 3300046518 | Bacteria | 2633 |
| 256 | Ga0495631_0101634 | 3300046518 | Bacteria | 1237 |
| 257 | Ga0495631_0199965 | 3300046518 | Bacteria | 854 |
| 258 | Ga0495632_0053643 | 3300046519 | Bacteria | 1979 |
| 259 | Ga0495637_0001253 | 3300046520 | Bacteria | 15327 |
| 260 | Ga0495637_0036976 | 3300046520 | Bacteria | 2122 |
| 261 | Ga0495643_0001402 | 3300046522 | Bacteria | 22388 |
| 262 | Ga0495643_0082243 | 3300046522 | Bacteria | 1673 |
| 263 | Ga0495643_0238159 | 3300046522 | Bacteria | 855 |
| 264 | Ga0495644_0000617 | 3300046523 | Bacteria | 14941 |
| 265 | Ga0495644_0000677 | 3300046523 | Bacteria | 14170 |
| 266 | Ga0495644_0004334 | 3300046523 | Bacteria | 5575 |
| 267 | Ga0495644_0012466 | 3300046523 | Bacteria | 3268 |
| 268 | Ga0495644_0037735 | 3300046523 | Bacteria | 1823 |
| 269 | Ga0495644_0089648 | 3300046523 | Bacteria | 1160 |
| 270 | Ga0495648_0001548 | 3300046524 | Bacteria | 22454 |
| 271 | Ga0495648_0003952 | 3300046524 | Bacteria | 12833 |
| 272 | Ga0495648_0004671 | 3300046524 | Bacteria | 11617 |
| 273 | Ga0495648_0007230 | 3300046524 | Bacteria | 8918 |
| 274 | Ga0495648_0018016 | 3300046524 | Bacteria | 5023 |
| 275 | Ga0495648_0067123 | 3300046524 | Bacteria | 2099 |
| 276 | Ga0495663_0071254 | 3300046525 | Bacteria | 1107 |
| 277 | Ga0495642_0001056 | 3300046528 | Bacteria | 12758 |
| 278 | Ga0495642_0014163 | 3300046528 | Bacteria | 3090 |
| 279 | Ga0495642_0047121 | 3300046528 | Bacteria | 1764 |
| 280 | Ga0495642_0062696 | 3300046528 | Bacteria | 1544 |
| 281 | Ga0495642_0078709 | 3300046528 | Bacteria | 1385 |
| 282 | Ga0495642_0187612 | 3300046528 | Bacteria | 900 |
| 283 | Ga0495652_0338556 | 3300046529 | Bacteria | 1081 |
| 284 | Ga0495654_0002902 | 3300046530 | Bacteria | 10750 |
| 285 | Ga0495640_0034126 | 3300046533 | Bacteria | 3612 |
| 286 | Ga0495586_0190915 | 3300046535 | Bacteria | 1160 |
| 287 | Ga0495609_0001195 | 3300046538 | Bacteria | 17862 |
| 288 | Ga0495609_0001452 | 3300046538 | Bacteria | 15745 |
| 289 | Ga0495609_0003724 | 3300046538 | Bacteria | 8610 |
| 290 | Ga0495609_0004604 | 3300046538 | Bacteria | 7492 |
| 291 | Ga0495609_0023049 | 3300046538 | Bacteria | 2863 |
| 292 | Ga0495597_0000937 | 3300046542 | Bacteria | 22509 |
| 293 | Ga0495597_0001684 | 3300046542 | Bacteria | 15338 |
| 294 | Ga0495597_0004571 | 3300046542 | Bacteria | 7564 |
| 295 | Ga0495597_0088340 | 3300046542 | Bacteria | 1318 |
| 296 | Ga0495597_0116760 | 3300046542 | Bacteria | 1115 |
| 297 | Ga0495645_0023911 | 3300046543 | Bacteria | 4429 |
| 298 | Ga0495622_0000393 | 3300046557 | Bacteria | 29591 |
| 299 | Ga0495622_0000554 | 3300046557 | Bacteria | 22441 |
| 300 | Ga0495622_0025651 | 3300046557 | Bacteria | 2753 |
| 301 | Ga0495622_0030866 | 3300046557 | Bacteria | 2505 |
| 302 | Ga0495633_0000914 | 3300046558 | Bacteria | 25035 |
| 303 | Ga0495633_0001052 | 3300046558 | Bacteria | 22514 |
| 304 | Ga0495633_0001946 | 3300046558 | Bacteria | 15002 |
| 305 | Ga0495633_0003562 | 3300046558 | Bacteria | 10297 |
| 306 | Ga0495633_0004089 | 3300046558 | Bacteria | 9413 |
| 307 | Ga0495633_0004106 | 3300046558 | Bacteria | 9394 |
| 308 | Ga0495633_0037619 | 3300046558 | Bacteria | 2314 |
| 309 | Ga0495668_0001481 | 3300046616 | Bacteria | 22492 |
| 310 | Ga0495668_0001997 | 3300046616 | Bacteria | 17831 |
| 311 | Ga0495668_0002082 | 3300046616 | Bacteria | 17326 |
| 312 | Ga0495668_0010757 | 3300046616 | Bacteria | 5525 |
| 313 | Ga0495668_0017201 | 3300046616 | Bacteria | 4198 |
| 314 | Ga0495668_0021967 | 3300046616 | Bacteria | 3651 |
| 315 | Ga0495668_0091327 | 3300046616 | Bacteria | 1668 |
| 316 | Ga0495634_0120477 | 3300046642 | Bacteria | 1680 |
| 317 | Ga0495611_0001011 | 3300046648 | Bacteria | 14895 |
| 318 | Ga0495611_0001330 | 3300046648 | Bacteria | 12528 |
| 319 | Ga0495611_0007478 | 3300046648 | Bacteria | 4635 |
| 320 | Ga0495611_0013892 | 3300046648 | Bacteria | 3434 |
| 321 | Ga0495611_0067994 | 3300046648 | Bacteria | 1625 |
| 322 | Ga0495625_0002013 | 3300046660 | Bacteria | 22900 |
| 323 | Ga0495625_0002064 | 3300046660 | Bacteria | 22515 |
| 324 | Ga0495625_0016595 | 3300046660 | Bacteria | 5788 |
| 325 | Ga0495625_0029026 | 3300046660 | Bacteria | 4141 |
| 326 | Ga0495625_0038356 | 3300046660 | Bacteria | 3508 |
| 327 | Ga0495625_0234217 | 3300046660 | Bacteria | 1198 |
| 328 | Ga0495635_0037937 | 3300046663 | Bacteria | 3335 |
| 329 | Ga0495659_0000322 | 3300046664 | Bacteria | 18883 |
| 330 | Ga0495659_0000611 | 3300046664 | Bacteria | 13148 |
| 331 | Ga0495659_0003392 | 3300046664 | Bacteria | 5093 |
| 332 | Ga0495661_0008427 | 3300046665 | Bacteria | 7128 |
| 333 | Ga0495661_0048553 | 3300046665 | Bacteria | 2578 |
| 334 | Ga0495661_0065370 | 3300046665 | Bacteria | 2143 |
| 335 | Ga0495661_0090815 | 3300046665 | Bacteria | 1737 |
| 336 | Ga0495661_0128241 | 3300046665 | Bacteria | 1393 |
| 337 | Ga0495661_0159823 | 3300046665 | Bacteria | 1210 |
| 338 | Ga0495661_0188647 | 3300046665 | Bacteria | 1087 |
| 339 | Ga0495657_0036839 | 3300046675 | Bacteria | 3377 |
| 340 | Ga0495599_0051786 | 3300046678 | Bacteria | 2572 |
| 341 | Ga0495623_0056669 | 3300046679 | Bacteria | 2466 |
| 342 | Ga0495646_0017430 | 3300046680 | Bacteria | 4556 |
| 343 | Ga0495669_0000656 | 3300046684 | Bacteria | 15037 |
| 344 | Ga0495669_0084770 | 3300046684 | Bacteria | 1457 |
| 345 | Ga0495624_0106093 | 3300046690 | Bacteria | 1729 |
| 346 | Ga0495670_0002302 | 3300046691 | Bacteria | 9439 |
| 347 | Ga0495670_0045650 | 3300046691 | Bacteria | 2187 |
| 348 | Ga0495670_0097669 | 3300046691 | Bacteria | 1509 |
| 349 | Ga0495670_0110264 | 3300046691 | Bacteria | 1423 |
| 350 | Ga0495671_0001117 | 3300046692 | Bacteria | 18541 |
| 351 | Ga0495671_0002076 | 3300046692 | Bacteria | 12852 |
| 352 | Ga0495671_0008181 | 3300046692 | Bacteria | 5902 |
| 353 | Ga0495671_0048794 | 3300046692 | Bacteria | 2111 |
| 354 | Ga0495671_0054921 | 3300046692 | Bacteria | 1973 |
| 355 | Ga0495671_0068975 | 3300046692 | Bacteria | 1738 |
| 356 | Ga0495671_0177249 | 3300046692 | Bacteria | 1035 |
| 357 | Ga0495671_0179187 | 3300046692 | Bacteria | 1029 |
| 358 | Ga0495649_0001876 | 3300046694 | Bacteria | 15366 |
| 359 | Ga0495649_0030002 | 3300046694 | Bacteria | 3004 |
| 360 | Ga0495649_0058506 | 3300046694 | Bacteria | 2076 |
| 361 | Ga0495649_0105591 | 3300046694 | Bacteria | 1495 |
| 362 | Ga0495649_0231670 | 3300046694 | Bacteria | 953 |
| 363 | Ga0495589_0004107 | 3300046794 | Bacteria | 7796 |
| 364 | Ga0495589_0005713 | 3300046794 | Bacteria | 6560 |
| 365 | Ga0495589_0006715 | 3300046794 | Bacteria | 6060 |
| 366 | Ga0495589_0181650 | 3300046794 | Bacteria | 997 |
| 367 | Ga0495600_0070127 | 3300046809 | Bacteria | 2290 |
| 368 | Ga0495660_0001178 | 3300046810 | Bacteria | 18436 |
| 369 | Ga0495660_0004244 | 3300046810 | Bacteria | 8700 |
| 370 | Ga0495660_0004344 | 3300046810 | Bacteria | 8583 |
| 371 | Ga0495660_0006519 | 3300046810 | Bacteria | 6894 |
| 372 | Ga0495660_0011430 | 3300046810 | Bacteria | 5151 |
| 373 | Ga0495660_0012016 | 3300046810 | Bacteria | 5022 |
| 374 | Ga0495660_0023901 | 3300046810 | Bacteria | 3483 |
| 375 | Ga0495660_0035465 | 3300046810 | Bacteria | 2786 |
| 376 | Ga0495660_0072075 | 3300046810 | Bacteria | 1830 |
| 377 | Ga0495581_0335702 | 3300047315 | Bacteria | 882 |
| 378 | Ga0495604_0174693 | 3300047317 | Bacteria | 1507 |
| 379 | Ga0495636_0000622 | 3300047318 | Bacteria | 12995 |
| 380 | Ga0495636_0001889 | 3300047318 | Bacteria | 7997 |
| 381 | Ga0495636_0061519 | 3300047318 | Bacteria | 1588 |
| 382 | Ga0495672_0002076 | 3300047320 | Bacteria | 18808 |
| 383 | Ga0495672_0003190 | 3300047320 | Bacteria | 14258 |
| 384 | Ga0495672_0003721 | 3300047320 | Bacteria | 12860 |
| 385 | Ga0495672_0003834 | 3300047320 | Bacteria | 12653 |
| 386 | Ga0495672_0033972 | 3300047320 | Bacteria | 3155 |
| 387 | Ga0495676_0253599 | 3300047321 | Bacteria | 1199 |
| 388 | Ga0495680_0106085 | 3300047322 | Bacteria | 2088 |
| 389 | Ga0495683_0003077 | 3300047323 | Bacteria | 9784 |
| 390 | Ga0495683_0003094 | 3300047323 | Bacteria | 9754 |
| 391 | Ga0495683_0019247 | 3300047323 | Bacteria | 3524 |
| 392 | Ga0495683_0026636 | 3300047323 | Bacteria | 2958 |
| 393 | Ga0495683_0241521 | 3300047323 | Bacteria | 796 |
| 394 | Ga0495687_001871 | 3300047443 | Bacteria | 18235 |
| 395 | Ga0495687_001987 | 3300047443 | Bacteria | 17397 |
| 396 | Ga0495687_002610 | 3300047443 | Bacteria | 14164 |
| 397 | Ga0495687_004208 | 3300047443 | Bacteria | 9868 |
| 398 | Ga0495687_026733 | 3300047443 | Bacteria | 2711 |
| 399 | Ga0495675_0183160 | 3300047444 | Bacteria | 1281 |
| 400 | Ga0495677_0001296 | 3300047445 | Bacteria | 9985 |
| 401 | Ga0495677_0004991 | 3300047445 | Bacteria | 5060 |
| 402 | Ga0495677_0011368 | 3300047445 | Bacteria | 3258 |
| 403 | Ga0495677_0013081 | 3300047445 | Bacteria | 3019 |
| 404 | Ga0495677_0044301 | 3300047445 | Bacteria | 1631 |
| 405 | Ga0495677_0093519 | 3300047445 | Bacteria | 1134 |
| 406 | Ga0495679_007668 | 3300047446 | Bacteria | 4475 |
| 407 | Ga0495679_033743 | 3300047446 | Bacteria | 1632 |
| 408 | Ga0495679_034198 | 3300047446 | Bacteria | 1619 |
| 409 | Ga0495685_001257 | 3300047447 | Bacteria | 7759 |
| 410 | Ga0495685_003331 | 3300047447 | Bacteria | 5111 |
| 411 | Ga0495685_106295 | 3300047447 | Bacteria | 925 |
| 412 | Ga0495673_0001145 | 3300047469 | Bacteria | 22673 |
| 413 | Ga0495673_0001156 | 3300047469 | Bacteria | 22410 |
| 414 | Ga0495681_0000433 | 3300047470 | Bacteria | 32077 |
| 415 | Ga0495681_0067497 | 3300047470 | Bacteria | 1629 |
| 416 | Ga0495681_0097490 | 3300047470 | Bacteria | 1289 |
| 417 | Ga0495681_0137760 | 3300047470 | Bacteria | 1033 |
| 418 | Ga0495686_0002901 | 3300047472 | Bacteria | 15394 |
| 419 | Ga0495686_0003304 | 3300047472 | Bacteria | 14076 |
| 420 | Ga0495686_0037903 | 3300047472 | Bacteria | 3086 |
| 421 | Ga0495686_0060146 | 3300047472 | Bacteria | 2362 |
| 422 | Ga0495593_0027288 | 3300047673 | Bacteria | 3144 |
| 423 | Ga0495602_0037499 | 3300048088 | Bacteria | 4497 |
| 424 | Ga0495626_0002174 | 3300048091 | Bacteria | 14104 |
| 425 | Ga0495626_0005185 | 3300048091 | Bacteria | 7717 |
| 426 | Ga0495626_0009078 | 3300048091 | Bacteria | 5393 |
| 427 | Ga0496100_0321329 | 3300048903 | Bacteria | 1163 |
| 428 | Ga0496102_0024797 | 3300048905 | Bacteria | 5335 |
| 429 | Ga0496102_0516224 | 3300048905 | Bacteria | 1117 |
| 430 | Ga0496103_0217815 | 3300048906 | Bacteria | 1228 |
| 431 | Ga0496104_0002205 | 3300048907 | Bacteria | 16852 |
| 432 | Ga0496104_0005460 | 3300048907 | Bacteria | 11131 |
| 433 | Ga0496104_0462434 | 3300048907 | Bacteria | 1180 |
| 434 | Ga0496104_1379429 | 3300048907 | Bacteria | 608 |
| 435 | Ga0496107_0139193 | 3300048910 | Bacteria | 1794 |
| 436 | Ga0496108_0203453 | 3300048911 | Bacteria | 1718 |
| 437 | Ga0496109_0159252 | 3300048912 | Bacteria | 2115 |
| 438 | Ga0496112_0192563 | 3300048915 | Bacteria | 2000 |
| 439 | Ga0496112_0819221 | 3300048915 | Bacteria | 855 |
| 440 | Ga0496113_0366211 | 3300048916 | Bacteria | 1157 |
| 441 | Ga0496113_0497950 | 3300048916 | Bacteria | 978 |
| 442 | Ga0496114_0527602 | 3300048917 | Bacteria | 1044 |
| 443 | Ga0496115_0039687 | 3300048918 | Bacteria | 3740 |
| 444 | Ga0496116_0034676 | 3300048919 | Bacteria | 3556 |
| 445 | Ga0496116_0076355 | 3300048919 | Bacteria | 2099 |
| 446 | Ga0496116_0150994 | 3300048919 | Bacteria | 1290 |
| 447 | Ga0496117_0000056 | 3300048920 | Bacteria | 271417 |
| 448 | Ga0496118_0000047 | 3300048921 | Bacteria | 271417 |
| 449 | Ga0496118_0017403 | 3300048921 | Bacteria | 6544 |
| 450 | Ga0496118_0160384 | 3300048921 | Bacteria | 1392 |
| 451 | Ga0496119_0051673 | 3300048922 | Bacteria | 2524 |
| 452 | Ga0496120_0290989 | 3300048923 | Bacteria | 751 |
| 453 | Ga0496121_0015798 | 3300048924 | Bacteria | 7861 |
| 454 | Ga0496121_0033980 | 3300048924 | Bacteria | 4600 |
| 455 | Ga0496121_0158234 | 3300048924 | Bacteria | 1659 |
| 456 | Ga0496121_0232196 | 3300048924 | Bacteria | 1291 |
| 457 | Ga0496122_0005330 | 3300048925 | Bacteria | 15377 |
| 458 | Ga0496122_0015447 | 3300048925 | Bacteria | 7299 |
| 459 | Ga0496122_0054453 | 3300048925 | Bacteria | 3004 |
| 460 | Ga0496122_0066320 | 3300048925 | Bacteria | 2609 |
| 461 | Ga0496122_0287932 | 3300048925 | Bacteria | 894 |
| 462 | Ga0496123_0001547 | 3300048926 | Bacteria | 31705 |
| 463 | Ga0496123_0043336 | 3300048926 | Bacteria | 3092 |
| 464 | Ga0496123_0227661 | 3300048926 | Bacteria | 935 |
| 465 | Ga0496124_0035769 | 3300048927 | Bacteria | 4341 |
| 466 | Ga0496124_0092390 | 3300048927 | Bacteria | 2465 |
| 467 | Ga0496124_0161147 | 3300048927 | Bacteria | 1748 |
| 468 | Ga0496124_0179325 | 3300048927 | Bacteria | 1632 |
| 469 | Ga0496124_0257646 | 3300048927 | Bacteria | 1286 |
| 470 | Ga0496125_0223970 | 3300048928 | Bacteria | 1209 |
| 471 | Ga0496125_0443761 | 3300048928 | Bacteria | 745 |
| 472 | Ga0496126_0119612 | 3300048929 | Bacteria | 2286 |
| 473 | Ga0496126_0316141 | 3300048929 | Bacteria | 1285 |
| 474 | Ga0495678_001109 | 3300049459 | Bacteria | 22514 |
| 475 | Ga0495678_001873 | 3300049459 | Bacteria | 15296 |
| 476 | Ga0495678_001982 | 3300049459 | Bacteria | 14750 |
| 477 | Ga0495678_002649 | 3300049459 | Bacteria | 11881 |
| 478 | Ga0495682_0000880 | 3300049460 | Bacteria | 18619 |
| 479 | Ga0495682_0000885 | 3300049460 | Bacteria | 18555 |
| 480 | Ga0495682_0001690 | 3300049460 | Bacteria | 11247 |
| 481 | Ga0495682_0008049 | 3300049460 | Bacteria | 4169 |
| 482 | Ga0495682_0050988 | 3300049460 | Bacteria | 1505 |
| 483 | Ga0501033_0000167 | 3300049570 | Bacteria | 63051 |
| 484 | Ga0501034_0002707 | 3300049571 | Bacteria | 20879 |
| 485 | Ga0501034_0008079 | 3300049571 | Bacteria | 11159 |
| 486 | Ga0501034_0788799 | 3300049571 | Bacteria | 843 |
| 487 | Ga0501034_1035999 | 3300049571 | Bacteria | 703 |
| 488 | Ga0501043_0647170 | 3300049579 | Bacteria | 777 |
| 489 | Ga0501046_0000063 | 3300049580 | Bacteria | 117905 |
| 490 | Ga0501068_0008036 | 3300049584 | Bacteria | 5849 |
| 491 | Ga0501070_0258053 | 3300049586 | Bacteria | 1425 |
| 492 | Ga0501070_0398338 | 3300049586 | Bacteria | 1113 |
| 493 | Ga0501235_010034 | 3300049669 | Bacteria | 2071 |
| 494 | Ga0501238_002483 | 3300049671 | Bacteria | 2211 |
| 495 | Ga0501280_000672 | 3300049776 | Bacteria | 7593 |
| 496 | Ga0501035_0001088 | 3300049822 | Bacteria | 28512 |
| 497 | nmdc:mga03683_1274_c1 | 3300050489 | Bacteria | 7467 |
| 498 | nmdc:mga03n38_517970_c1 | 3300050490 | Bacteria | 671 |
| 499 | nmdc:mga04h51_271981_c1 | 3300050495 | Bacteria | 684 |
| 500 | nmdc:mga08y16_1201784_c1 | 3300050511 | Bacteria | 729 |
| 501 | nmdc:mga08y16_635363_c1 | 3300050511 | Bacteria | 1073 |
| 502 | nmdc:mga0sz30_7300_c1 | 3300050516 | Bacteria | 4141 |
| 503 | Ga0500610_0266600 | 3300053079 | Bacteria | 778 |
| 504 | Ga0500583_0356586 | 3300053092 | Bacteria | 708 |
| 505 | Ga0500641_0001556 | 3300053096 | Bacteria | 8174 |
| 506 | Ga0500618_037162 | 3300053125 | Bacteria | 1126 |
| 507 | Ga0500642_0124065 | 3300053130 | Bacteria | 1209 |
| 508 | Ga0500559_0001422 | 3300053136 | Bacteria | 13576 |
| 509 | Ga0500577_0086742 | 3300053142 | Bacteria | 1258 |
| 510 | Ga0500586_000260 | 3300053145 | Bacteria | 10537 |
| 511 | Ga0500616_0000923 | 3300053153 | Bacteria | 32124 |
| 512 | Ga0500616_0101397 | 3300053153 | Bacteria | 1406 |
| 513 | Ga0500636_0270852 | 3300053177 | Bacteria | 853 |
| 514 | Ga0500601_001468 | 3300053737 | Bacteria | 2586 |
| 515 | Ga0501082_0855940 | 3300060353 | Bacteria | 795 |
| 516 | Ga0466962_0060033 | 3300061719 | Bacteria | 1815 |
| 517 | Ga0466962_0220462 | 3300061719 | Bacteria | 929 |
| 518 | 2509078374 | 2508501114 | Bacteria | 7082538 |
| 519 | 2510840525 | 2510461069 | Bacteria | 5505000 |
| 520 | 2561466472 | 2558860983 | Bacteria | 4133860 |
| 521 | 2601672124 | 2600255292 | Bacteria | 6300551 |
| 522 | 2644252558 | 2643221645 | Bacteria | 7207331 |
| 523 | 2644300277 | 2643221653 | Bacteria | 4569637 |
| 524 | 2644356118 | 2643221664 | Bacteria | 7272945 |
| 525 | 2644658503 | 2643221719 | Bacteria | 4568197 |
| 526 | 2738743006 | 2738541280 | Bacteria | 6630198 |
| 527 | 2738830631 | 2738541297 | Bacteria | 6549566 |
| 528 | 2738847158 | 2738541300 | Bacteria | 6675882 |
| 529 | 2738946111 | 2738541317 | Bacteria | 5340176 |
| 530 | 2739154427 | 2738541357 | Bacteria | 6549408 |
| 531 | 2739196347 | 2738543003 | Bacteria | 6549560 |
| 532 | 2739277937 | 2738543018 | Bacteria | 6718814 |
| 533 | 2739322823 | 2738543026 | Bacteria | 6549408 |
| 534 | 2739341064 | 2738543029 | Bacteria | 6549249 |
| 535 | 2739346980 | 2738543030 | Bacteria | 6719714 |
| 536 | 2776259579 | 2775506901 | Bacteria | 9631051 |
| 537 | 2776913591 | 2775507049 | Bacteria | 6284736 |
| 538 | 2809147760 | 2808606418 | Bacteria | 6724496 |
| 539 | 2819242105 | 2818991272 | Bacteria | 4622173 |
| 540 | 2819720424 | 2818991467 | Bacteria | 5893227 |
| 541 | 2821136530 | 2821131069 | Bacteria | 6108407 |
| 542 | 2828309449 | 2828305725 | Bacteria | 4916900 |
| 543 | 2842695943 | 2842694124 | Bacteria | 4063419 |
| 544 | 2842700964 | 2842698319 | Bacteria | 5190321 |
| 545 | 2842718123 | 2842711865 | Bacteria | 7155354 |
| 546 | 2857552480 | 2857547612 | Bacteria | 6179999 |
| 547 | 2857570414 | 2857564685 | Bacteria | 6290584 |
| 548 | 2885085879 | 2885080285 | Bacteria | 6355622 |
| 549 | 2898798057 | 2898795034 | Bacteria | 4294459 |
| 550 | 2899809061 | 2899803654 | Bacteria | 5577784 |
| 551 | 2913311306 | 2913308742 | Bacteria | 5350706 |
| 552 | 2932415304 | 2932410948 | Bacteria | 6312192 |
| 553 | 2932421048 | 2932416698 | Bacteria | 6315112 |
| 554 | 2989778618 | 2989776772 | Bacteria | 4843317 |
| 555 | 8002288848 | 8002285264 | Bacteria | 6717907 |
| 556 | 8005250883 | 8005246636 | Bacteria | 4933972 |
| 557 | 8005659584 | 8005658619 | Bacteria | 4500593 |
| 558 | 8055435924 | 8055431914 | Bacteria | 4551896 |
| 559 | Ga0070707_100111150 | |||
| 560 | JGI25154J39366_1001374 | |||
| 561 | JGI25150J39212_1012883 | |||
| 562 | rootL2_10048407 | |||
| 563 | JGI25161J50226_1014720 | |||
| 564 | Ga0006562J51391_1058120 | |||
| 565 | Ga0055529_1000829 | |||
| 566 | Ga0055526_1000877 | |||
| 567 | Ga0055526_1000900 | |||
| 568 | Ga0055524_1000840 | |||
| 569 | Ga0055543_1002285 | |||
| 570 | Ga0065165_1002135 | |||
| 571 | Ga0065165_1002855 | |||
| 572 | Ga0065714_10126169 | |||
| 573 | Ga0070677_10071218 | |||
| 574 | Ga0068868_100337024 | |||
| 575 | Ga0070661_100099049 | |||
| 576 | Ga0070713_100731241 | |||
| 577 | Ga0070698_100002900 | |||
| 578 | Ga0070697_100046322 | |||
| 579 | Ga0070665_100088853 | |||
| 580 | Ga0070664_100048956 | |||
| 581 | Ga0070664_100234510 | |||
| 582 | Ga0068856_100103008 | |||
| 583 | Ga0068852_100121126 | |||
| 584 | Ga0068859_100223312 | |||
| 585 | Ga0068863_100140282 | |||
| 586 | Ga0068860_100130310 | |||
| 587 | Ga0081455_10011026 | |||
| 588 | Ga0081538_10089603 | |||
| 589 | Ga0081539_10001936 | |||
| 590 | Ga0081539_10006495 | |||
| 591 | Ga0070717_10765919 | |||
| 592 | Ga0075365_10084979 | |||
| 593 | Ga0075365_10498632 | |||
| 594 | Ga0075368_10099384 | |||
| 595 | Ga0075362_10023742 | |||
| 596 | Ga0075362_10032946 | |||
| 597 | Ga0075367_10003354 | |||
| 598 | Ga0075367_10079454 | |||
| 599 | Ga0075369_10027174 | |||
| 600 | Ga0097621_100360009 | |||
| 601 | Ga0075370_10196208 | |||
| 602 | Ga0097620_100223296 | |||
| 603 | Ga0099826_10000422 | |||
| 604 | Ga0105244_10002702 | |||
| 605 | Ga0105244_10262141 | |||
| 606 | Ga0105250_10040950 | |||
| 607 | Ga0111539_10346368 | |||
| 608 | Ga0111539_11135206 | |||
| 609 | Ga0105247_10154808 | |||
| 610 | Ga0105238_10382951 | |||
| 611 | Ga0105035_102264 | |||
| 612 | Ga0099796_10013125 | |||
| 613 | Ga0105239_10492272 | |||
| 614 | Ga0105239_10682258 | |||
| 615 | Ga0157371_10067128 | |||
| 616 | Ga0157370_10925029 | |||
| 617 | Ga0157378_10252149 | |||
| 618 | Ga0157378_10258042 | |||
| 619 | Ga0163162_11010938 | |||
| 620 | Ga0157375_10535316 | |||
| 621 | Ga0182008_10005542 | |||
| 622 | Ga0182006_1000030 | |||
| 623 | Ga0182007_10000803 | |||
| 624 | Ga0182005_1000021 | |||
| 625 | Ga0163161_10028114 | |||
| 626 | Ga0163161_10101951 | |||
| 627 | Ga0163161_10869812 | |||
| 628 | Ga0213872_10001038 | |||
| 629 | Ga0213871_10012402 | |||
| 630 | Ga0209437_115415 | |||
| 631 | Ga0207425_1001348 | |||
| 632 | Ga0207425_1005129 | |||
| 633 | Ga0209646_1000478 | |||
| 634 | Ga0209677_112116 | |||
| 635 | Ga0209565_1025040 | |||
| 636 | Ga0209455_1000750 | |||
| 637 | Ga0209130_1001230 | |||
| 638 | Ga0209025_1007793 | |||
| 639 | Ga0209564_1001562 | |||
| 640 | Ga0209564_1001592 | |||
| 641 | Ga0209758_1001629 | |||
| 642 | Ga0209256_1001792 | |||
| 643 | Ga0207655_1010380 | |||
| 644 | Ga0207685_10341660 | |||
| 645 | Ga0207705_10479216 | |||
| 646 | Ga0207657_10317950 | |||
| 647 | Ga0207644_10870782 | |||
| 648 | Ga0207679_10103046 | |||
| 649 | Ga0207679_10157232 | |||
| 650 | Ga0207641_10089728 | |||
| 651 | Ga0207674_10478437 | |||
| 652 | Ga0209282_1000454 | |||
| 653 | Ga0207428_10393733 | |||
| 654 | Ga0207428_10413452 | |||
| 655 | Ga0268266_10054432 | |||
| 656 | Ga0268266_11038936 | |||
| 657 | Ga0268264_10222831 | |||
| 658 | Ga0265326_10004572 | |||
| 659 | Ga0265319_1000354 | |||
| 660 | Ga0265334_10001600 | |||
| 661 | Ga0265318_10044567 | |||
| 662 | Ga0265323_10000264 | |||
| 663 | Ga0265336_10000291 | |||
| 664 | Ga0265338_10000317 | |||
| 665 | Ga0265328_10000085 | |||
| 666 | Ga0265328_10009605 | |||
| 667 | Ga0265328_10105938 | |||
| 668 | Ga0265331_10001315 | |||
| 669 | Ga0265331_10005130 | |||
| 670 | Ga0265331_10033172 | |||
| 671 | Ga0265327_10006926 | |||
| 672 | Ga0265327_10015010 | |||
| 673 | Ga0265327_10164576 | |||
| 674 | Ga0265316_10003717 | |||
| 675 | Ga0265316_10083847 | |||
| 676 | Ga0265316_10416639 | |||
| 677 | Ga0265314_10024881 | |||
| 678 | Ga0265342_10055585 | |||
| 679 | Ga0307412_10328646 | |||
| 680 | Ga0307412_10621972 | |||
| 681 | Ga0307416_100130727 | |||
| 682 | Ga0307416_100316552 | |||
| 683 | Ga0373934_0188250 | |||
| 684 | Ga0373953_0087699 | |||
| 685 | Ga0373954_0160605 | |||
| 686 | Ga0373956_0202821 | |||
| 687 | Ga0373955_0011640 | |||
| 688 | Ga0373961_0165219 | |||
| 689 | Ga0373924_0085857 | |||
| 690 | Ga0373927_0000556 | |||
| 691 | Ga0373933_0038986 | |||
| 692 | Ga0373925_0035085 | |||
| 693 | Ga0395899_0084666 | |||
| 694 | Ga0395900_0000020 | |||
| 695 | Ga0395898_0000104 | |||
| 696 | Ga0395898_0123610 | |||
| 697 | Ga0395905_0000019 | |||
| 698 | Ga0395905_0164412 | |||
| 699 | Ga0436364_0233354 | |||
| 700 | Ga0436364_0240121 | |||
| 701 | Ga0395901_0000016 | |||
| 702 | Ga0395901_0027334 | |||
| 703 | Ga0395901_1451681 | |||
| 704 | Ga0436365_0157200 | |||
| 705 | Ga0436360_0276376 | |||
| 706 | Ga0436360_0486597 | |||
| 707 | Ga0436360_1088619 | |||
| 708 | Ga0436360_1204653 | |||
| 709 | Ga0436361_0463751 | |||
| 710 | Ga0436363_1556987 | |||
| 711 | Ga0436362_0083770 | |||
| 712 | Ga0439432_130444 | |||
| 713 | Ga0450904_000471 | |||
| 714 | Ga0439459_0016381 | |||
| 715 | Ga0451577_0054509 | |||
| 716 | Ga0466982_0324581 | |||
| 717 | Ga0466965_0503012 | |||
| 718 | Ga0466964_0042266 | |||
| 719 | Ga0453684_0000048 | |||
| 720 | Ga0466971_0043818 | |||
| 721 | Ga0466968_0070880 | |||
| 722 | Ga0466970_0096986 | |||
| 723 | Ga0466957_0020541 | |||
| 724 | Ga0466957_0189917 | |||
| 725 | Ga0466960_0051188 | |||
| 726 | Ga0466959_0037916 | |||
| 727 | Ga0451576_0171287 | |||
| 728 | Ga0466967_0033352 | |||
| 729 | Ga0495617_000441 | |||
| 730 | Ga0495617_001986 | |||
| 731 | Ga0495627_007918 | |||
| 732 | Ga0495627_053454 | |||
| 733 | Ga0495592_0158648 | |||
| 734 | Ga0495590_0000382 | |||
| 735 | Ga0495590_0000697 | |||
| 736 | Ga0495590_0009717 | |||
| 737 | Ga0495590_0030415 | |||
| 738 | Ga0495591_002965 | |||
| 739 | Ga0495591_010303 | |||
| 740 | Ga0495638_0001370 | |||
| 741 | Ga0495638_0026933 | |||
| 742 | Ga0495638_0036152 | |||
| 743 | Ga0495638_0059303 | |||
| 744 | Ga0495638_0069300 | |||
| 745 | Ga0495638_0106851 | |||
| 746 | Ga0495651_0078255 | |||
| 747 | Ga0495653_0000925 | |||
| 748 | Ga0495653_0311056 | |||
| 749 | Ga0495650_0001486 | |||
| 750 | Ga0495650_0001777 | |||
| 751 | Ga0495650_0001842 | |||
| 752 | Ga0495650_0002555 | |||
| 753 | Ga0495650_0002810 | |||
| 754 | Ga0495650_0020283 | |||
| 755 | Ga0495605_0000802 | |||
| 756 | Ga0495605_0002350 | |||
| 757 | Ga0495605_0016140 | |||
| 758 | Ga0495605_0058189 | |||
| 759 | Ga0495605_0079552 | |||
| 760 | Ga0495605_0194390 | |||
| 761 | Ga0495639_0025932 | |||
| 762 | Ga0495664_0126629 | |||
| 763 | Ga0495584_0000946 | |||
| 764 | Ga0495584_0001277 | |||
| 765 | Ga0495584_0044566 | |||
| 766 | Ga0495585_0003632 | |||
| 767 | Ga0495585_0005643 | |||
| 768 | Ga0495585_0009043 | |||
| 769 | Ga0495585_0009991 | |||
| 770 | Ga0495596_0002084 | |||
| 771 | Ga0495596_0002347 | |||
| 772 | Ga0495596_0002769 | |||
| 773 | Ga0495596_0003972 | |||
| 774 | Ga0495596_0009139 | |||
| 775 | Ga0495596_0020833 | |||
| 776 | Ga0495596_0064875 | |||
| 777 | Ga0495607_0001294 | |||
| 778 | Ga0495607_0005328 | |||
| 779 | Ga0495607_0009636 | |||
| 780 | Ga0495607_0010921 | |||
| 781 | Ga0495607_0019504 | |||
| 782 | Ga0495607_0062908 | |||
| 783 | Ga0495607_0072595 | |||
| 784 | Ga0495607_0141667 | |||
| 785 | Ga0495607_0158027 | |||
| 786 | Ga0495583_0001441 | |||
| 787 | Ga0495583_0001587 | |||
| 788 | Ga0495583_0002012 | |||
| 789 | Ga0495583_0002508 | |||
| 790 | Ga0495583_0010701 | |||
| 791 | Ga0495583_0020901 | |||
| 792 | Ga0495583_0056120 | |||
| 793 | Ga0495583_0075820 | |||
| 794 | Ga0495606_0002177 | |||
| 795 | Ga0495606_0002301 | |||
| 796 | Ga0495606_0002310 | |||
| 797 | Ga0495606_0010860 | |||
| 798 | Ga0495606_0019107 | |||
| 799 | Ga0495608_0224133 | |||
| 800 | Ga0495610_0001281 | |||
| 801 | Ga0495610_0005073 | |||
| 802 | Ga0495610_0016479 | |||
| 803 | Ga0495610_0139233 | |||
| 804 | Ga0495616_0008733 | |||
| 805 | Ga0495616_0014299 | |||
| 806 | Ga0495616_0059386 | |||
| 807 | Ga0495616_0136465 | |||
| 808 | Ga0495616_0274101 | |||
| 809 | Ga0495618_0053893 | |||
| 810 | Ga0495620_0063594 | |||
| 811 | Ga0495628_0354785 | |||
| 812 | Ga0495631_0001506 | |||
| 813 | Ga0495631_0026959 | |||
| 814 | Ga0495631_0101634 | |||
| 815 | Ga0495631_0199965 | |||
| 816 | Ga0495632_0053643 | |||
| 817 | Ga0495637_0001253 | |||
| 818 | Ga0495637_0036976 | |||
| 819 | Ga0495643_0001402 | |||
| 820 | Ga0495643_0082243 | |||
| 821 | Ga0495643_0238159 | |||
| 822 | Ga0495644_0000617 | |||
| 823 | Ga0495644_0000677 | |||
| 824 | Ga0495644_0004334 | |||
| 825 | Ga0495644_0012466 | |||
| 826 | Ga0495644_0037735 | |||
| 827 | Ga0495644_0089648 | |||
| 828 | Ga0495648_0001548 | |||
| 829 | Ga0495648_0003952 | |||
| 830 | Ga0495648_0004671 | |||
| 831 | Ga0495648_0007230 | |||
| 832 | Ga0495648_0018016 | |||
| 833 | Ga0495648_0067123 | |||
| 834 | Ga0495663_0071254 | |||
| 835 | Ga0495642_0001056 | |||
| 836 | Ga0495642_0014163 | |||
| 837 | Ga0495642_0047121 | |||
| 838 | Ga0495642_0062696 | |||
| 839 | Ga0495642_0078709 | |||
| 840 | Ga0495642_0187612 | |||
| 841 | Ga0495652_0338556 | |||
| 842 | Ga0495654_0002902 | |||
| 843 | Ga0495640_0034126 | |||
| 844 | Ga0495586_0190915 | |||
| 845 | Ga0495609_0001195 | |||
| 846 | Ga0495609_0001452 | |||
| 847 | Ga0495609_0003724 | |||
| 848 | Ga0495609_0004604 | |||
| 849 | Ga0495609_0023049 | |||
| 850 | Ga0495597_0000937 | |||
| 851 | Ga0495597_0001684 | |||
| 852 | Ga0495597_0004571 | |||
| 853 | Ga0495597_0088340 | |||
| 854 | Ga0495597_0116760 | |||
| 855 | Ga0495645_0023911 | |||
| 856 | Ga0495622_0000393 | |||
| 857 | Ga0495622_0000554 | |||
| 858 | Ga0495622_0025651 | |||
| 859 | Ga0495622_0030866 | |||
| 860 | Ga0495633_0000914 | |||
| 861 | Ga0495633_0001052 | |||
| 862 | Ga0495633_0001946 | |||
| 863 | Ga0495633_0003562 | |||
| 864 | Ga0495633_0004089 | |||
| 865 | Ga0495633_0004106 | |||
| 866 | Ga0495633_0037619 | |||
| 867 | Ga0495668_0001481 | |||
| 868 | Ga0495668_0001997 | |||
| 869 | Ga0495668_0002082 | |||
| 870 | Ga0495668_0010757 | |||
| 871 | Ga0495668_0017201 | |||
| 872 | Ga0495668_0021967 | |||
| 873 | Ga0495668_0091327 | |||
| 874 | Ga0495634_0120477 | |||
| 875 | Ga0495611_0001011 | |||
| 876 | Ga0495611_0001330 | |||
| 877 | Ga0495611_0007478 | |||
| 878 | Ga0495611_0013892 | |||
| 879 | Ga0495611_0067994 | |||
| 880 | Ga0495625_0002013 | |||
| 881 | Ga0495625_0002064 | |||
| 882 | Ga0495625_0016595 | |||
| 883 | Ga0495625_0029026 | |||
| 884 | Ga0495625_0038356 | |||
| 885 | Ga0495625_0234217 | |||
| 886 | Ga0495635_0037937 | |||
| 887 | Ga0495659_0000322 | |||
| 888 | Ga0495659_0000611 | |||
| 889 | Ga0495659_0003392 | |||
| 890 | Ga0495661_0008427 | |||
| 891 | Ga0495661_0048553 | |||
| 892 | Ga0495661_0065370 | |||
| 893 | Ga0495661_0090815 | |||
| 894 | Ga0495661_0128241 | |||
| 895 | Ga0495661_0159823 | |||
| 896 | Ga0495661_0188647 | |||
| 897 | Ga0495657_0036839 | |||
| 898 | Ga0495599_0051786 | |||
| 899 | Ga0495623_0056669 | |||
| 900 | Ga0495646_0017430 | |||
| 901 | Ga0495669_0000656 | |||
| 902 | Ga0495669_0084770 | |||
| 903 | Ga0495624_0106093 | |||
| 904 | Ga0495670_0002302 | |||
| 905 | Ga0495670_0045650 | |||
| 906 | Ga0495670_0097669 | |||
| 907 | Ga0495670_0110264 | |||
| 908 | Ga0495671_0001117 | |||
| 909 | Ga0495671_0002076 | |||
| 910 | Ga0495671_0008181 | |||
| 911 | Ga0495671_0048794 | |||
| 912 | Ga0495671_0054921 | |||
| 913 | Ga0495671_0068975 | |||
| 914 | Ga0495671_0177249 | |||
| 915 | Ga0495671_0179187 | |||
| 916 | Ga0495649_0001876 | |||
| 917 | Ga0495649_0030002 | |||
| 918 | Ga0495649_0058506 | |||
| 919 | Ga0495649_0105591 | |||
| 920 | Ga0495649_0231670 | |||
| 921 | Ga0495589_0004107 | |||
| 922 | Ga0495589_0005713 | |||
| 923 | Ga0495589_0006715 | |||
| 924 | Ga0495589_0181650 | |||
| 925 | Ga0495600_0070127 | |||
| 926 | Ga0495660_0001178 | |||
| 927 | Ga0495660_0004244 | |||
| 928 | Ga0495660_0004344 | |||
| 929 | Ga0495660_0006519 | |||
| 930 | Ga0495660_0011430 | |||
| 931 | Ga0495660_0012016 | |||
| 932 | Ga0495660_0023901 | |||
| 933 | Ga0495660_0035465 | |||
| 934 | Ga0495660_0072075 | |||
| 935 | Ga0495581_0335702 | |||
| 936 | Ga0495604_0174693 | |||
| 937 | Ga0495636_0000622 | |||
| 938 | Ga0495636_0001889 | |||
| 939 | Ga0495636_0061519 | |||
| 940 | Ga0495672_0002076 | |||
| 941 | Ga0495672_0003190 | |||
| 942 | Ga0495672_0003721 | |||
| 943 | Ga0495672_0003834 | |||
| 944 | Ga0495672_0033972 | |||
| 945 | Ga0495676_0253599 | |||
| 946 | Ga0495680_0106085 | |||
| 947 | Ga0495683_0003077 | |||
| 948 | Ga0495683_0003094 | |||
| 949 | Ga0495683_0019247 | |||
| 950 | Ga0495683_0026636 | |||
| 951 | Ga0495683_0241521 | |||
| 952 | Ga0495687_001871 | |||
| 953 | Ga0495687_001987 | |||
| 954 | Ga0495687_002610 | |||
| 955 | Ga0495687_004208 | |||
| 956 | Ga0495687_026733 | |||
| 957 | Ga0495675_0183160 | |||
| 958 | Ga0495677_0001296 | |||
| 959 | Ga0495677_0004991 | |||
| 960 | Ga0495677_0011368 | |||
| 961 | Ga0495677_0013081 | |||
| 962 | Ga0495677_0044301 | |||
| 963 | Ga0495677_0093519 | |||
| 964 | Ga0495679_007668 | |||
| 965 | Ga0495679_033743 | |||
| 966 | Ga0495679_034198 | |||
| 967 | Ga0495685_001257 | |||
| 968 | Ga0495685_003331 | |||
| 969 | Ga0495685_106295 | |||
| 970 | Ga0495673_0001145 | |||
| 971 | Ga0495673_0001156 | |||
| 972 | Ga0495681_0000433 | |||
| 973 | Ga0495681_0067497 | |||
| 974 | Ga0495681_0097490 | |||
| 975 | Ga0495681_0137760 | |||
| 976 | Ga0495686_0002901 | |||
| 977 | Ga0495686_0003304 | |||
| 978 | Ga0495686_0037903 | |||
| 979 | Ga0495686_0060146 | |||
| 980 | Ga0495593_0027288 | |||
| 981 | Ga0495602_0037499 | |||
| 982 | Ga0495626_0002174 | |||
| 983 | Ga0495626_0005185 | |||
| 984 | Ga0495626_0009078 | |||
| 985 | Ga0496100_0321329 | |||
| 986 | Ga0496102_0024797 | |||
| 987 | Ga0496102_0516224 | |||
| 988 | Ga0496103_0217815 | |||
| 989 | Ga0496104_0002205 | |||
| 990 | Ga0496104_0005460 | |||
| 991 | Ga0496104_0462434 | |||
| 992 | Ga0496104_1379429 | |||
| 993 | Ga0496107_0139193 | |||
| 994 | Ga0496108_0203453 | |||
| 995 | Ga0496109_0159252 | |||
| 996 | Ga0496112_0192563 | |||
| 997 | Ga0496112_0819221 | |||
| 998 | Ga0496113_0366211 | |||
| 999 | Ga0496113_0497950 | |||
| 1000 | Ga0496114_0527602 | |||
| 1001 | Ga0496115_0039687 | |||
| 1002 | Ga0496116_0034676 | |||
| 1003 | Ga0496116_0076355 | |||
| 1004 | Ga0496116_0150994 | |||
| 1005 | Ga0496117_0000056 | |||
| 1006 | Ga0496118_0000047 | |||
| 1007 | Ga0496118_0017403 | |||
| 1008 | Ga0496118_0160384 | |||
| 1009 | Ga0496119_0051673 | |||
| 1010 | Ga0496120_0290989 | |||
| 1011 | Ga0496121_0015798 | |||
| 1012 | Ga0496121_0033980 | |||
| 1013 | Ga0496121_0158234 | |||
| 1014 | Ga0496121_0232196 | |||
| 1015 | Ga0496122_0005330 | |||
| 1016 | Ga0496122_0015447 | |||
| 1017 | Ga0496122_0054453 | |||
| 1018 | Ga0496122_0066320 | |||
| 1019 | Ga0496122_0287932 | |||
| 1020 | Ga0496123_0001547 | |||
| 1021 | Ga0496123_0043336 | |||
| 1022 | Ga0496123_0227661 | |||
| 1023 | Ga0496124_0035769 | |||
| 1024 | Ga0496124_0092390 | |||
| 1025 | Ga0496124_0161147 | |||
| 1026 | Ga0496124_0179325 | |||
| 1027 | Ga0496124_0257646 | |||
| 1028 | Ga0496125_0223970 | |||
| 1029 | Ga0496125_0443761 | |||
| 1030 | Ga0496126_0119612 | |||
| 1031 | Ga0496126_0316141 | |||
| 1032 | Ga0495678_001109 | |||
| 1033 | Ga0495678_001873 | |||
| 1034 | Ga0495678_001982 | |||
| 1035 | Ga0495678_002649 | |||
| 1036 | Ga0495682_0000880 | |||
| 1037 | Ga0495682_0000885 | |||
| 1038 | Ga0495682_0001690 | |||
| 1039 | Ga0495682_0008049 | |||
| 1040 | Ga0495682_0050988 | |||
| 1041 | Ga0501033_0000167 | |||
| 1042 | Ga0501034_0002707 | |||
| 1043 | Ga0501034_0008079 | |||
| 1044 | Ga0501034_0788799 | |||
| 1045 | Ga0501034_1035999 | |||
| 1046 | Ga0501043_0647170 | |||
| 1047 | Ga0501046_0000063 | |||
| 1048 | Ga0501068_0008036 | |||
| 1049 | Ga0501070_0258053 | |||
| 1050 | Ga0501070_0398338 | |||
| 1051 | Ga0501235_010034 | |||
| 1052 | Ga0501238_002483 | |||
| 1053 | Ga0501280_000672 | |||
| 1054 | Ga0501035_0001088 | |||
| 1055 | nmdc:mga03683_1274_c1 | |||
| 1056 | nmdc:mga03n38_517970_c1 | |||
| 1057 | nmdc:mga04h51_271981_c1 | |||
| 1058 | nmdc:mga08y16_1201784_c1 | |||
| 1059 | nmdc:mga08y16_635363_c1 | |||
| 1060 | nmdc:mga0sz30_7300_c1 | |||
| 1061 | Ga0500610_0266600 | |||
| 1062 | Ga0500583_0356586 | |||
| 1063 | Ga0500641_0001556 | |||
| 1064 | Ga0500618_037162 | |||
| 1065 | Ga0500642_0124065 | |||
| 1066 | Ga0500559_0001422 | |||
| 1067 | Ga0500577_0086742 | |||
| 1068 | Ga0500586_000260 | |||
| 1069 | Ga0500616_0000923 | |||
| 1070 | Ga0500616_0101397 | |||
| 1071 | Ga0500636_0270852 | |||
| 1072 | Ga0500601_001468 | |||
| 1073 | Ga0501082_0855940 | |||
| 1074 | Ga0466962_0060033 | |||
| 1075 | Ga0466962_0220462 | |||
| 1076 | 2509078374 | |||
| 1077 | 2510840525 | |||
| 1078 | 2561466472 | |||
| 1079 | 2601672124 | |||
| 1080 | 2644252558 | |||
| 1081 | 2644300277 | |||
| 1082 | 2644356118 | |||
| 1083 | 2644658503 | |||
| 1084 | 2738743006 | |||
| 1085 | 2738830631 | |||
| 1086 | 2738847158 | |||
| 1087 | 2738946111 | |||
| 1088 | 2739154427 | |||
| 1089 | 2739196347 | |||
| 1090 | 2739277937 | |||
| 1091 | 2739322823 | |||
| 1092 | 2739341064 | |||
| 1093 | 2739346980 | |||
| 1094 | 2776259579 | |||
| 1095 | 2776913591 | |||
| 1096 | 2809147760 | |||
| 1097 | 2819242105 | |||
| 1098 | 2819720424 | |||
| 1099 | 2821136530 | |||
| 1100 | 2828309449 | |||
| 1101 | 2842695943 | |||
| 1102 | 2842700964 | |||
| 1103 | 2842718123 | |||
| 1104 | 2857552480 | |||
| 1105 | 2857570414 | |||
| 1106 | 2885085879 | |||
| 1107 | 2898798057 | |||
| 1108 | 2899809061 | |||
| 1109 | 2913311306 | |||
| 1110 | 2932415304 | |||
| 1111 | 2932421048 | |||
| 1112 | 2989778618 | |||
| 1113 | 8002288848 | |||
| 1114 | 8005250883 | |||
| 1115 | 8005659584 | |||
| 1116 | 8055435924 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hut-assembly1.cif.gz_B | structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp | 0.8876 | 43 | 193 |
| 1g5r-assembly1.cif.gz_A | the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form | 0.8798 | 43 | 183 |
| 4hut-assembly1.cif.gz_B | structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp | 0.785 | 43 | 193 |
| 1g5r-assembly1.cif.gz_A | the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form | 0.781 | 43 | 183 |
| 1g64-assembly1.cif.gz_B | the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex | 0.7727 | 23 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1g5rA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8743 | 43 | 183 | 3.40.50.300 |
| 1g64A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8502 | 38 | 196 | 3.40.50.300 |
| af_I6Y1V6_9_207_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8254 | 43 | 196 | 3.40.50.300 |
| 1g64A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.791 | 38 | 196 | 3.40.50.300 |
| 1g5rA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7732 | 43 | 183 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V9PFW6-F1-model_v4 | corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9446 | 43 | 172 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A3D1XR81-F1-model_v4 | Cob(I)yrinic acid a,c-diamide adenosyltransferase | 0.9392 | 44 | 151 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A227J7G0-F1-model_v4 | corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9384 | 43 | 151 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A528N548-F1-model_v4 | corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9376 | 48 | 143 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A2X4TV31-F1-model_v4 | corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9272 | 55 | 170 |
GO:0005524
GO:0008817 GO:0009236 |