metagRoot

F463399

General Info

Members	Datasets	Scaffolds	Average Seq Length
558	352	519	148

Family's Representative Sequence

Representative Sequence	3300005331\|Ga0070670_100191397\|Ga0070670_1001913972
Length	163
Sequence	MGPLGRIYNACGQALAFSMKTVHKSVLIWYSAEEMFGLVTDVARYPEFLPWCDHAAVLSQDAQGMNAEIGIAFAGIRQVFRTRNEHVPGREVRMRLVEGPFSQLDGQWKFIPLGDGQRACKVELDLQYGFDNMALGALVGPVFDKIAGSLVDAFVKRAERVFG

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
3	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
4	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
5	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
6	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
7	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
8	2643221658	Variovorax sp. Root411	Isolate	Unclassified
9	2643221672	Variovorax sp. Root434	Isolate	Unclassified
10	2643221683	Variovorax sp. Root473	Isolate	Unclassified
11	2738541277	Variovorax sp. GV051	Isolate	Unclassified
12	2738541307	Variovorax sp. GV008	Isolate	Unclassified
13	2738543013	Variovorax sp. BT01	Isolate	Unclassified
14	2738543019	Variovorax sp. GV040	Isolate	Unclassified
15	2818991446	Variovorax sp. 1180	Isolate	Unclassified
16	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
17	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
18	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
19	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
20	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
21	2885198086	Variovorax sp. 679	Isolate	Unclassified
22	2885211737	Variovorax sp. 553	Isolate	Unclassified
23	2899924645	Variovorax sp. 369	Isolate	Unclassified
24	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
25	2904456579	Variovorax sp. 2002	Isolate	Unclassified
26	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
27	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
28	2928037797	Variovorax sp. 1126	Isolate	Unclassified
29	2928044640	Variovorax sp. 1128	Isolate	Unclassified
30	2928051484	Variovorax sp. 1133	Isolate	Unclassified
31	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
32	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
33	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
34	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
35	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
36	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
37	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
38	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
39	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
40	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
41	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
42	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
43	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
44	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
45	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
46	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
47	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
48	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
49	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
50	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
51	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
52	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
53	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
54	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
55	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
56	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
57	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
58	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
59	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
60	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
61	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
62	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
63	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
64	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
65	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
66	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
67	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
68	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
69	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
70	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
71	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
72	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
73	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
74	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
75	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
76	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
77	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
78	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
79	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
80	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
81	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
82	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
83	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
84	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
85	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
86	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
87	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
88	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
89	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
90	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
91	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
92	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
93	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
94	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
95	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
97	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
98	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
99	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
100	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
101	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
102	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
103	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
104	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
105	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
106	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
107	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
108	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
109	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
110	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
111	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
112	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
113	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
114	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
115	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
116	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
117	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
118	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
119	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
120	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
121	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
122	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
123	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
128	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
130	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
131	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
132	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
134	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
137	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
140	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
173	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
174	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
178	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
179	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
180	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
181	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
182	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
183	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
184	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
185	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
186	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
187	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
188	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
189	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
190	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
191	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
192	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
193	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
194	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
195	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
196	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
197	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
198	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
199	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
200	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
201	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
202	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
203	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
204	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
205	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
206	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
207	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
208	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
209	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
210	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
211	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
212	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
213	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
214	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
215	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
216	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
217	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
218	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
219	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
220	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
221	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
222	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
223	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
224	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
225	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
226	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
227	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
228	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
229	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
230	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
231	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
232	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
233	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
234	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
235	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
236	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
237	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
238	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
239	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
240	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
241	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
242	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
243	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
244	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
245	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
246	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
247	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
248	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
249	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
250	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
251	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
252	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
253	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
254	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
255	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
256	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
257	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
258	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
259	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
260	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
261	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
262	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
263	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
264	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
265	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
266	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
267	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
268	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
269	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
270	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
271	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
272	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
273	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
274	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
275	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
276	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
277	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
278	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
279	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
280	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
281	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
282	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
283	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
284	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
285	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
286	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
287	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
288	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
289	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
290	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
291	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
292	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
293	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
294	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
295	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
296	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
297	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
298	3300049526	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control	Metagenome	Rhizosphere
299	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
300	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
301	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
302	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
303	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
304	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
305	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
306	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
307	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
308	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
309	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
310	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
311	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
312	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
313	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
314	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
315	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
316	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
317	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
318	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
319	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
320	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
321	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
322	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
323	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
324	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
325	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
326	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
327	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
328	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
329	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
330	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
331	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
332	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
333	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
334	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
335	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
336	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
337	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
338	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
339	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
340	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
341	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
342	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
343	3300053152	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere	Metagenome	Endosphere
344	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
345	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
346	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
347	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
348	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
349	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
350	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
351	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
352	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.65
Metatranscriptomes	0.18
Isolates	7.17

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	27.24
Nodule	0.54
Rhizoplane	5.02
Rhizosphere	57.71
Stem	0
Stem Tuber	0
Unclassified	9.5

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_2570715	2162886007	Bacteria	1321
2	JGI25158J39367_1011650	3300002739	Bacteria	1170
3	JGI25150J39212_1000968	3300002774	Bacteria	9050
4	JGI25150J39212_1009542	3300002774	Bacteria	1839
5	JGI25151J46595_10001150	3300003187	Bacteria	19162
6	JGI25151J46595_10006674	3300003187	Bacteria	5756
7	rootH1_10049748	3300003316	Bacteria	3121
8	rootL2_10008299	3300003322	Bacteria	2047
9	rootL2_10121275	3300003322	Bacteria	1803
10	rootH1_10018555	3300003316	Bacteria	9158
11	rootH1_10018555	3300003323	Bacteria	2990
12	Ga0006562J51391_1088752	3300003578	Bacteria	3398
13	Ga0055532_1008517	3300003758	Bacteria	1277
14	Ga0055535_1000194	3300003761	Bacteria	64563
15	Ga0055535_1000937	3300003761	Bacteria	19471
16	Ga0055542_1000039	3300003762	Bacteria	215126
17	Ga0055537_1000068	3300003773	Bacteria	75642
18	Ga0055534_1000080	3300003784	Bacteria	75642
19	Ga0055534_1001964	3300003784	Bacteria	7528
20	Ga0055534_1006830	3300003784	Bacteria	2814
21	Ga0055528_1004897	3300003790	Bacteria	6323
22	Ga0055528_1021312	3300003790	Bacteria	2061
23	Ga0055530_10011056	3300003791	Bacteria	3274
24	Ga0055540_1004295	3300003792	Bacteria	6505
25	Ga0055540_1013718	3300003792	Bacteria	2458
26	Ga0055531_10016087	3300003794	Bacteria	3251
27	Ga0055531_10036269	3300003794	Bacteria	1525
28	Ga0065165_1077319	3300005262	Bacteria	871
29	Ga0065714_10302700	3300005288	Bacteria	675
30	Ga0065704_10139325	3300005289	Bacteria	1534
31	Ga0065707_10219893	3300005295	Bacteria	1228
32	Ga0070658_10122031	3300005327	Bacteria	2166
33	Ga0070658_10284960	3300005327	Bacteria	1407
34	Ga0070670_100191397	3300005331	Bacteria	1777
35	Ga0068869_100050289	3300005334	Bacteria	3021
36	Ga0070661_100710515	3300005344	Bacteria	819
37	Ga0070674_100528144	3300005356	Bacteria	987
38	Ga0070673_100025732	3300005364	Bacteria	4336
39	Ga0070673_100224869	3300005364	Bacteria	1626
40	Ga0070667_100106599	3300005367	Bacteria	2426
41	Ga0070714_100477531	3300005435	Bacteria	1187
42	Ga0070678_100150523	3300005456	Bacteria	1874
43	Ga0070678_100348413	3300005456	Bacteria	1273
44	Ga0070662_100030106	3300005457	Bacteria	3794
45	Ga0068867_100433483	3300005459	Bacteria	1116
46	Ga0070679_100196496	3300005530	Bacteria	1984
47	Ga0070672_100158553	3300005543	Bacteria	1876
48	Ga0070665_100098307	3300005548	Bacteria	2931
49	Ga0070665_100206360	3300005548	Bacteria	1965
50	Ga0068855_100236851	3300005563	Bacteria	2041
51	Ga0068855_100309909	3300005563	Bacteria	1747
52	Ga0070664_100050494	3300005564	Bacteria	3520
53	Ga0068857_100060422	3300005577	Bacteria	3366
54	Ga0068856_100395696	3300005614	Bacteria	1401
55	Ga0068864_100042962	3300005618	Bacteria	3869
56	Ga0068851_10057813	3300005834	Bacteria	1981
57	Ga0068858_101034455	3300005842	Bacteria	805
58	Ga0075365_10084865	3300006038	Bacteria	2150
59	Ga0075364_10092888	3300006051	Bacteria	2003
60	Ga0075364_10470029	3300006051	Bacteria	859
61	Ga0075432_10037951	3300006058	Bacteria	1677
62	Ga0070716_101470761	3300006173	Unclassified	556
63	Ga0075362_10044445	3300006177	Bacteria	1970
64	Ga0075362_10138978	3300006177	Bacteria	1160
65	Ga0075367_10103359	3300006178	Bacteria	1743
66	Ga0075367_10159162	3300006178	Bacteria	1404
67	Ga0075366_10004920	3300006195	Bacteria	7206
68	Ga0075366_10015121	3300006195	Bacteria	4417
69	Ga0075366_10076309	3300006195	Bacteria	2000
70	Ga0075366_10085278	3300006195	Bacteria	1889
71	Ga0075366_10113841	3300006195	Bacteria	1628
72	Ga0075370_10000091	3300006353	Bacteria	27943
73	Ga0075370_10000474	3300006353	Bacteria	15087
74	Ga0075370_10059335	3300006353	Bacteria	2177
75	Ga0075370_10133653	3300006353	Bacteria	1448
76	Ga0068871_100091870	3300006358	Bacteria	2530
77	Ga0099826_10000121	3300006948	Bacteria	35285
78	Ga0105244_10022711	3300009036	Bacteria	3449
79	Ga0105240_10119365	3300009093	Bacteria	3176
80	Ga0105240_11490735	3300009093	Bacteria	709
81	Ga0111539_11514388	3300009094	Bacteria	778
82	Ga0105245_10144980	3300009098	Bacteria	2240
83	Ga0105243_10016877	3300009148	Bacteria	5520
84	Ga0105243_10059780	3300009148	Bacteria	3043
85	Ga0105237_10615589	3300009545	Bacteria	1093
86	Ga0105237_11468712	3300009545	Bacteria	688
87	Ga0105238_10151854	3300009551	Bacteria	2291
88	Ga0105249_11801186	3300009553	Bacteria	685
89	Ga0105239_10878134	3300010375	Bacteria	1029
90	Ga0105239_10926778	3300010375	Bacteria	1000
91	Ga0105239_11718049	3300010375	Bacteria	727
92	Ga0105246_10079849	3300011119	Bacteria	2327
93	Ga0105246_10180526	3300011119	Bacteria	1625
94	Ga0157347_1036869	3300012502	Bacteria	633
95	Ga0157327_1004049	3300012512	Bacteria	1115
96	Ga0157373_10016087	3300013100	Bacteria	5461
97	Ga0157371_10536711	3300013102	Bacteria	866
98	Ga0157370_10016574	3300013104	Bacteria	7454
99	Ga0157370_10477046	3300013104	Bacteria	1146
100	Ga0157369_10022998	3300013105	Bacteria	6948
101	Ga0157369_10458604	3300013105	Bacteria	1320
102	Ga0157374_12441414	3300013296	Bacteria	550
103	Ga0157378_10573472	3300013297	Bacteria	1137
104	Ga0163162_11123792	3300013306	Bacteria	891
105	Ga0163162_11974017	3300013306	Bacteria	668
106	Ga0157372_10315160	3300013307	Bacteria	1821
107	Ga0157375_10675741	3300013308	Bacteria	1187
108	Ga0157375_13145916	3300013308	Bacteria	551
109	Ga0157380_10543392	3300014326	Bacteria	1138
110	Ga0157380_11697062	3300014326	Bacteria	689
111	Ga0182008_10004652	3300014497	Bacteria	7983
112	Ga0182008_10005023	3300014497	Bacteria	7607
113	Ga0182008_10005485	3300014497	Bacteria	7221
114	Ga0182008_10018008	3300014497	Bacteria	3659
115	Ga0182008_10097416	3300014497	Bacteria	1452
116	Ga0182008_10287258	3300014497	Bacteria	857
117	Ga0157379_11142182	3300014968	Bacteria	747
118	Ga0157376_10301566	3300014969	Bacteria	1517
119	Ga0157376_10516757	3300014969	Bacteria	1176
120	Ga0157376_12205516	3300014969	Bacteria	590
121	Ga0182006_1003622	3300015261	Bacteria	7846
122	Ga0182006_1015189	3300015261	Bacteria	3303
123	Ga0182007_10004599	3300015262	Bacteria	6234
124	Ga0182007_10005832	3300015262	Bacteria	5353
125	Ga0182005_1193110	3300015265	Bacteria	609
126	Ga0183362_10001	3300015683	Bacteria	2046624
127	Ga0163161_10005661	3300017792	Bacteria	8664
128	Ga0163161_10036358	3300017792	Bacteria	3527
129	Ga0163161_10080821	3300017792	Bacteria	2393
130	Ga0163161_10089727	3300017792	Bacteria	2274
131	Ga0163161_10093372	3300017792	Bacteria	2229
132	Ga0209436_115229	3300025208	Bacteria	1196
133	Ga0209672_100687	3300025228	Bacteria	16993
134	Ga0209147_101482	3300025229	Bacteria	8356
135	Ga0209258_100099	3300025242	Bacteria	214924
136	Ga0207425_1002406	3300025245	Bacteria	6594
137	Ga0207425_1003931	3300025245	Bacteria	4600
138	Ga0209148_1000103	3300025254	Bacteria	215356
139	Ga0209129_1000007	3300025258	Bacteria	771325
140	Ga0209129_1003184	3300025258	Bacteria	7344
141	Ga0209129_1036987	3300025258	Bacteria	788
142	Ga0209565_1000038	3300025263	Bacteria	286433
143	Ga0209565_1000073	3300025263	Bacteria	164695
144	Ga0209673_1000127	3300025273	Bacteria	164695
145	Ga0209673_1000128	3300025273	Bacteria	164482
146	Ga0209673_1002300	3300025273	Bacteria	13604
147	Ga0209673_1006250	3300025273	Bacteria	5804
148	Ga0209130_1000076	3300025284	Bacteria	170259
149	Ga0209130_1000590	3300025284	Bacteria	35406
150	Ga0209675_1000029	3300025291	Bacteria	281053
151	Ga0209675_1000194	3300025291	Bacteria	66431
152	Ga0209675_1000734	3300025291	Bacteria	22237
153	Ga0209675_1044115	3300025291	Bacteria	955
154	Ga0209676_1000205	3300025292	Bacteria	132469
155	Ga0209676_1000383	3300025292	Bacteria	81259
156	Ga0209676_1001009	3300025292	Bacteria	32956
157	Ga0209676_1002941	3300025292	Bacteria	11122
158	Ga0209025_1000056	3300025294	Bacteria	316188
159	Ga0209025_1000088	3300025294	Bacteria	255087
160	Ga0209025_1001878	3300025294	Bacteria	24555
161	Ga0209025_1007177	3300025294	Bacteria	8410
162	Ga0209025_1010860	3300025294	Bacteria	6103
163	Ga0209025_1012639	3300025294	Bacteria	5391
164	Ga0209025_1042001	3300025294	Bacteria	1949
165	Ga0209564_1000073	3300025295	Bacteria	288080
166	Ga0209564_1000099	3300025295	Bacteria	225256
167	Ga0209758_1000044	3300025297	Bacteria	398448
168	Ga0209758_1012502	3300025297	Bacteria	4744
169	Ga0209050_1000007	3300025298	Bacteria	1187891
170	Ga0209050_1000952	3300025298	Bacteria	37637
171	Ga0209050_1004011	3300025298	Bacteria	10377
172	Ga0209256_1000020	3300025299	Bacteria	542402
173	Ga0209256_1000022	3300025299	Bacteria	481843
174	Ga0207426_1000001	3300025302	Bacteria	1341301
175	Ga0209051_1000103	3300025303	Bacteria	162029
176	Ga0209051_1000259	3300025303	Bacteria	88311
177	Ga0209051_1001166	3300025303	Bacteria	23873
178	Ga0209051_1004582	3300025303	Bacteria	8443
179	Ga0209051_1007889	3300025303	Bacteria	5741
180	Ga0209257_1000116	3300025304	Bacteria	228733
181	Ga0209257_1000491	3300025304	Bacteria	71177
182	Ga0209257_1004550	3300025304	Bacteria	10619
183	Ga0209257_1011557	3300025304	Bacteria	4231
184	Ga0209257_1021109	3300025304	Bacteria	2378
185	Ga0207656_10028052	3300025321	Bacteria	2308
186	Ga0207655_1020361	3300025728	Bacteria	3414
187	Ga0207688_10092921	3300025901	Bacteria	1734
188	Ga0207688_10415896	3300025901	Bacteria	835
189	Ga0207647_10385861	3300025904	Bacteria	790
190	Ga0207705_10300556	3300025909	Bacteria	1231
191	Ga0207705_10375375	3300025909	Bacteria	1098
192	Ga0207671_10446758	3300025914	Bacteria	1030
193	Ga0207649_10125580	3300025920	Bacteria	1736
194	Ga0207652_10438069	3300025921	Bacteria	1178
195	Ga0207694_10881709	3300025924	Bacteria	756
196	Ga0207650_10158774	3300025925	Bacteria	1790
197	Ga0207659_10696236	3300025926	Bacteria	870
198	Ga0207659_11183878	3300025926	Bacteria	657
199	Ga0207687_10215895	3300025927	Bacteria	1507
200	Ga0207709_10004077	3300025935	Bacteria	8503
201	Ga0207709_10019765	3300025935	Bacteria	3792
202	Ga0207665_10031362	3300025939	Bacteria	3516
203	Ga0207691_10162635	3300025940	Bacteria	1958
204	Ga0207689_10094396	3300025942	Bacteria	2457
205	Ga0207679_10035277	3300025945	Bacteria	3537
206	Ga0207667_10546357	3300025949	Bacteria	1172
207	Ga0207651_10211019	3300025960	Bacteria	1563
208	Ga0207651_10539285	3300025960	Bacteria	1013
209	Ga0207640_10558816	3300025981	Bacteria	963
210	Ga0207658_10435955	3300025986	Bacteria	1158
211	Ga0207639_10138532	3300026041	Bacteria	2024
212	Ga0207678_10372706	3300026067	Bacteria	1233
213	Ga0207702_10757582	3300026078	Bacteria	959
214	Ga0207641_10349074	3300026088	Bacteria	1410
215	Ga0207648_10179302	3300026089	Bacteria	1875
216	Ga0207648_10711677	3300026089	Bacteria	931
217	Ga0207676_10086079	3300026095	Bacteria	2566
218	Ga0207674_10246100	3300026116	Bacteria	1735
219	Ga0207683_10048947	3300026121	Bacteria	3699
220	Ga0209282_1000488	3300027666	Bacteria	19243
221	Ga0207428_10028385	3300027907	Bacteria	4649
222	Ga0268266_10200224	3300028379	Bacteria	1827
223	Ga0268266_10572419	3300028379	Bacteria	1083
224	Ga0268265_10060264	3300028380	Bacteria	2908
225	Ga0268264_11093701	3300028381	Bacteria	805
226	Ga0307515_10000628	3300028794	Bacteria	82043
227	Ga0307512_10198908	3300030522	Bacteria	1089
228	Ga0316177_1146803	3300030731	Bacteria	2910
229	Ga0316176_1059428	3300030732	Bacteria	3077
230	Ga0314311_1031246	3300030733	Bacteria	5147
231	Ga0316178_1111916	3300030735	Bacteria	4801
232	Ga0316180_1190288	3300030736	Bacteria	2391
233	Ga0316183_1212063	3300030742	Bacteria	4395
234	Ga0316182_1166328	3300030745	Bacteria	4044
235	Ga0265332_10013086	3300031238	Bacteria	3677
236	Ga0265327_10011171	3300031251	Bacteria	6222
237	Ga0307513_10217392	3300031456	Bacteria	1736
238	Ga0307408_100150147	3300031548	Bacteria	1838
239	Ga0307408_100193229	3300031548	Bacteria	1641
240	Ga0307514_10047780	3300031649	Bacteria	3339
241	Ga0307405_10129996	3300031731	Bacteria	1738
242	Ga0307405_10130681	3300031731	Bacteria	1734
243	Ga0307405_10452766	3300031731	Bacteria	1018
244	Ga0307405_10619793	3300031731	Bacteria	885
245	Ga0307413_10104973	3300031824	Bacteria	1877
246	Ga0307406_10003876	3300031901	Bacteria	8146
247	Ga0307406_10479092	3300031901	Bacteria	1004
248	Ga0307407_10116129	3300031903	Bacteria	1688
249	Ga0307412_10105124	3300031911	Bacteria	2004
250	Ga0307412_10136093	3300031911	Bacteria	1792
251	Ga0307412_10150893	3300031911	Bacteria	1714
252	Ga0307412_10306683	3300031911	Bacteria	1257
253	Ga0307409_100451339	3300031995	Bacteria	1241
254	Ga0307416_100215742	3300032002	Bacteria	1835
255	Ga0307416_100358133	3300032002	Bacteria	1480
256	Ga0307416_101291943	3300032002	Bacteria	835
257	Ga0307416_101663776	3300032002	Bacteria	743
258	Ga0307414_10737499	3300032004	Bacteria	894
259	Ga0307411_10063724	3300032005	Bacteria	2464
260	Ga0307411_10635683	3300032005	Bacteria	922
261	Ga0373925_0882560	3300037068	Unclassified	737
262	Ga0395900_0345177	3300037418	Bacteria	1463
263	Ga0395905_0345312	3300037471	Bacteria	1380
264	Ga0395905_0358647	3300037471	Bacteria	1350
265	Ga0395905_0681056	3300037471	Bacteria	930
266	Ga0395905_0818735	3300037471	Bacteria	834
267	Ga0395901_0090542	3300038443	Bacteria	3202
268	Ga0395901_0101252	3300038443	Bacteria	3023
269	Ga0395901_0164471	3300038443	Bacteria	2330
270	Ga0436361_0968351	3300039447	Bacteria	1268
271	Ga0439436_0002082	3300041404	Bacteria	5969
272	Ga0439436_0025063	3300041404	Bacteria	1755
273	Ga0439439_0013823	3300041406	Bacteria	1959
274	Ga0439439_0077800	3300041406	Bacteria	894
275	Ga0439447_024968	3300041407	Bacteria	1543
276	Ga0439447_045899	3300041407	Bacteria	1053
277	Ga0439461_0008900	3300041410	Bacteria	1811
278	Ga0439461_0029046	3300041410	Bacteria	1142
279	Ga0439461_0126574	3300041410	Bacteria	643
280	Ga0439466_0019659	3300041411	Bacteria	2416
281	Ga0439466_0022992	3300041411	Bacteria	2195
282	Ga0439466_0105552	3300041411	Bacteria	876
283	Ga0439465_0000776	3300041413	Bacteria	9955
284	Ga0439465_0043783	3300041413	Bacteria	1453
285	Ga0451791_0112917	3300041451	Bacteria	651
286	Ga0451797_0305433	3300041453	Bacteria	1057
287	Ga0451795_1510973	3300041456	Bacteria	1059
288	Ga0451837_0037507	3300041494	Bacteria	654
289	Ga0451841_0414732	3300041498	Bacteria	781
290	Ga0439431_0003869	3300041997	Bacteria	3303
291	Ga0439431_0006040	3300041997	Bacteria	2672
292	Ga0439431_0043437	3300041997	Bacteria	1150
293	Ga0439433_0001065	3300041999	Bacteria	5580
294	Ga0439442_002129	3300042002	Bacteria	3895
295	Ga0439442_049256	3300042002	Bacteria	888
296	Ga0439442_083356	3300042002	Bacteria	685
297	Ga0439445_0001549	3300042004	Bacteria	5004
298	Ga0439445_0007002	3300042004	Bacteria	2605
299	Ga0439432_001320	3300042006	Bacteria	9393
300	Ga0439432_026408	3300042006	Bacteria	1901
301	Ga0439449_0000266	3300042007	Bacteria	18812
302	Ga0439449_0001247	3300042007	Bacteria	9978
303	Ga0439449_0039410	3300042007	Bacteria	1756
304	Ga0439449_0105253	3300042007	Bacteria	1044
305	Ga0439452_007264	3300042010	Bacteria	3404
306	Ga0439452_009824	3300042010	Bacteria	2807
307	Ga0439457_002895	3300042014	Bacteria	4785
308	Ga0439457_021962	3300042014	Bacteria	1413
309	Ga0439462_0001251	3300042015	Bacteria	5564
310	Ga0439462_0019071	3300042015	Bacteria	1783
311	Ga0450920_011530	3300042122	Bacteria	1649
312	Ga0450923_000384	3300042125	Bacteria	4674
313	Ga0450923_007453	3300042125	Bacteria	1852
314	Ga0450896_001037	3300042133	Bacteria	3258
315	Ga0450898_007197	3300042134	Bacteria	1729
316	Ga0450906_013074	3300042145	Bacteria	1534
317	Ga0450910_017575	3300042147	Bacteria	1065
318	Ga0450910_022532	3300042147	Bacteria	958
319	Ga0439446_0025365	3300042156	Bacteria	1694
320	Ga0439446_0025819	3300042156	Bacteria	1680
321	Ga0439446_0033419	3300042156	Bacteria	1494
322	Ga0450908_006751	3300042184	Bacteria	2172
323	Ga0439434_0007537	3300042435	Bacteria	3190
324	Ga0439434_0039535	3300042435	Bacteria	1447
325	Ga0439434_0178619	3300042435	Bacteria	710
326	Ga0450918_006518	3300042531	Bacteria	2078
327	Ga0451577_0006257	3300042876	Bacteria	11928
328	Ga0451577_0042046	3300042876	Bacteria	4100
329	Ga0451577_0255441	3300042876	Bacteria	1587
330	Ga0451577_0753814	3300042876	Bacteria	880
331	Ga0453683_0157035	3300044673	Bacteria	1438
332	Ga0453683_0482960	3300044673	Bacteria	803
333	Ga0466965_0048397	3300044683	Bacteria	2106
334	Ga0453684_0000005	3300044712	Bacteria	1431632
335	Ga0453684_0000512	3300044712	Bacteria	150627
336	Ga0453684_0000692	3300044712	Bacteria	120085
337	Ga0453684_1663067	3300044712	Bacteria	653
338	Ga0466960_0125779	3300044901	Bacteria	1347
339	Ga0451576_0000461	3300045051	Bacteria	92083
340	Ga0451576_0001147	3300045051	Bacteria	47866
341	Ga0451576_0210371	3300045051	Bacteria	2031
342	Ga0451576_0393855	3300045051	Bacteria	1452
343	Ga0451576_0615052	3300045051	Bacteria	1142
344	Ga0451576_0778998	3300045051	Bacteria	1004
345	Ga0495627_018930	3300046453	Bacteria	2315
346	Ga0495629_0250106	3300046459	Bacteria	1220
347	Ga0495629_0375172	3300046459	Bacteria	968
348	Ga0495638_0132484	3300046460	Bacteria	1463
349	Ga0495639_0002601	3300046475	Bacteria	7854
350	Ga0495610_0035135	3300046512	Bacteria	2576
351	Ga0495610_0215951	3300046512	Bacteria	777
352	Ga0495616_0004736	3300046513	Bacteria	8531
353	Ga0495631_0002450	3300046518	Bacteria	10461
354	Ga0495637_0013851	3300046520	Bacteria	3818
355	Ga0495637_0183422	3300046520	Bacteria	775
356	Ga0495663_0024492	3300046525	Bacteria	1755
357	Ga0495663_0055153	3300046525	Bacteria	1239
358	Ga0495642_0107701	3300046528	Bacteria	1190
359	Ga0495654_0376549	3300046530	Bacteria	567
360	Ga0495665_0617052	3300046531	Bacteria	541
361	Ga0495587_0272341	3300046536	Bacteria	950
362	Ga0495609_0068373	3300046538	Bacteria	1563
363	Ga0495621_0006742	3300046539	Bacteria	3368
364	Ga0495621_0182937	3300046539	Bacteria	837
365	Ga0495621_0434779	3300046539	Bacteria	560
366	Ga0495622_0144986	3300046557	Bacteria	1076
367	Ga0495656_0001663	3300046615	Bacteria	7264
368	Ga0495656_0027102	3300046615	Bacteria	2287
369	Ga0495656_0029722	3300046615	Bacteria	2202
370	Ga0495668_0217563	3300046616	Bacteria	1046
371	Ga0495625_0000301	3300046660	Bacteria	76108
372	Ga0495625_0038284	3300046660	Bacteria	3512
373	Ga0495659_0286751	3300046664	Bacteria	693
374	Ga0495659_0425828	3300046664	Bacteria	575
375	Ga0495661_0216629	3300046665	Bacteria	994
376	Ga0495661_0520113	3300046665	Bacteria	566
377	Ga0495588_0017990	3300046674	Bacteria	3441
378	Ga0495588_0040267	3300046674	Bacteria	2382
379	Ga0495646_0357169	3300046680	Bacteria	765
380	Ga0495658_0099032	3300046683	Bacteria	1737
381	Ga0495613_0862978	3300046689	Bacteria	588
382	Ga0495624_0108584	3300046690	Bacteria	1707
383	Ga0495670_0132105	3300046691	Bacteria	1302
384	Ga0495670_0279023	3300046691	Bacteria	893
385	Ga0495671_0008696	3300046692	Bacteria	5703
386	Ga0495676_0397141	3300047321	Bacteria	915
387	Ga0495687_252198	3300047443	Bacteria	526
388	Ga0495685_154976	3300047447	Bacteria	743
389	Ga0495593_0003865	3300047673	Bacteria	8948
390	Ga0495593_0288355	3300047673	Bacteria	821
391	Ga0495602_0287039	3300048088	Bacteria	1210
392	Ga0495602_0742866	3300048088	Bacteria	663
393	Ga0495614_0088271	3300048089	Bacteria	1347
394	Ga0495615_0018457	3300048090	Bacteria	1535
395	Ga0496100_0123364	3300048903	Bacteria	1815
396	Ga0496101_0020349	3300048904	Bacteria	4540
397	Ga0496101_0134464	3300048904	Bacteria	1880
398	Ga0496102_0108629	3300048905	Bacteria	2584
399	Ga0496103_0109274	3300048906	Bacteria	1755
400	Ga0496104_0066302	3300048907	Bacteria	3427
401	Ga0496105_0046143	3300048908	Bacteria	3596
402	Ga0496105_0475232	3300048908	Bacteria	984
403	Ga0496107_0169484	3300048910	Bacteria	1620
404	Ga0496107_0229457	3300048910	Bacteria	1381
405	Ga0496108_0273156	3300048911	Bacteria	1471
406	Ga0496108_1096841	3300048911	Bacteria	676
407	Ga0496109_0249204	3300048912	Bacteria	1672
408	Ga0496109_0420257	3300048912	Bacteria	1263
409	Ga0496110_0056262	3300048913	Bacteria	3461
410	Ga0496110_0378569	3300048913	Bacteria	1290
411	Ga0496111_0044719	3300048914	Bacteria	3183
412	Ga0496111_0073525	3300048914	Bacteria	2489
413	Ga0496112_0525217	3300048915	Bacteria	1118
414	Ga0496113_0162488	3300048916	Bacteria	1766
415	Ga0496113_1141412	3300048916	Bacteria	610
416	Ga0496114_0145055	3300048917	Bacteria	2057
417	Ga0496116_0043676	3300048919	Bacteria	3051
418	Ga0496116_0049089	3300048919	Bacteria	2826
419	Ga0496116_0097410	3300048919	Bacteria	1768
420	Ga0496117_0028570	3300048920	Bacteria	4316
421	Ga0496117_0079130	3300048920	Bacteria	2167
422	Ga0496118_0013068	3300048921	Bacteria	7894
423	Ga0496118_0015078	3300048921	Bacteria	7182
424	Ga0496118_0174127	3300048921	Bacteria	1310
425	Ga0496122_0002359	3300048925	Bacteria	27157
426	Ga0496122_0059758	3300048925	Bacteria	2812
427	Ga0496122_0343654	3300048925	Bacteria	782
428	Ga0496123_0000108	3300048926	Bacteria	166102
429	Ga0496123_0032805	3300048926	Bacteria	3750
430	Ga0496123_0070875	3300048926	Bacteria	2178
431	Ga0496124_0018958	3300048927	Bacteria	6423
432	Ga0496124_0121614	3300048927	Bacteria	2085
433	Ga0496125_0037281	3300048928	Bacteria	4228
434	Ga0496125_0041569	3300048928	Bacteria	3928
435	Ga0496126_0038986	3300048929	Bacteria	4415
436	Ga0496126_0105952	3300048929	Bacteria	2454
437	Ga0501303_013928	3300049526	Bacteria	790
438	Ga0501034_0029804	3300049571	Bacteria	5547
439	Ga0501034_1441701	3300049571	Bacteria	563
440	Ga0501034_1675817	3300049571	Bacteria	508
441	Ga0501036_0941788	3300049572	Bacteria	708
442	Ga0501038_0885926	3300049574	Bacteria	659
443	Ga0501043_0033425	3300049579	Bacteria	4047
444	Ga0501047_0033428	3300049581	Bacteria	4964
445	Ga0501047_0099448	3300049581	Bacteria	2788
446	Ga0501199_016158	3300049650	Bacteria	840
447	Ga0501238_059044	3300049671	Bacteria	584
448	Ga0501249_018281	3300049679	Bacteria	1515
449	Ga0501257_074681	3300049686	Bacteria	869
450	Ga0501225_0014624	3300049705	Bacteria	2190
451	Ga0501080_0054648	3300049742	Bacteria	3718
452	Ga0501241_068699	3300049758	Bacteria	721
453	Ga0501262_002081	3300049759	Bacteria	2260
454	Ga0501035_0303661	3300049822	Bacteria	1344
455	Ga0501044_0130321	3300049823	Bacteria	2509
456	nmdc:mga03683_112023_c1	3300050489	Bacteria	1207
457	nmdc:mga03683_134253_c1	3300050489	Bacteria	1109
458	nmdc:mga03683_282570_c1	3300050489	Bacteria	776
459	nmdc:mga03683_294835_c1	3300050489	Bacteria	760
460	nmdc:mga03n38_11423_c1	3300050490	Bacteria	3309
461	nmdc:mga03n38_261404_c1	3300050490	Bacteria	918
462	nmdc:mga03n38_430718_c1	3300050490	Bacteria	731
463	nmdc:mga03n38_467544_c1	3300050490	Bacteria	703
464	nmdc:mga00v17_319066_c1	3300050491	Bacteria	1010
465	nmdc:mga00v17_369683_c1	3300050491	Bacteria	932
466	nmdc:mga0yw44_1416_c1	3300050492	Bacteria	9515
467	nmdc:mga0yw44_437468_c1	3300050492	Bacteria	886
468	nmdc:mga0yw44_771356_c1	3300050492	Bacteria	653
469	nmdc:mga0k408_119561_c2	3300050493	Bacteria	1088
470	nmdc:mga0k408_11989_c1	3300050493	Bacteria	4730
471	nmdc:mga0k408_2947_c1	3300050493	Bacteria	9023
472	nmdc:mga0k408_35564_c1	3300050493	Bacteria	2856
473	nmdc:mga0k408_4556_c1	3300050493	Bacteria	7360
474	nmdc:mga06z11_430659_c1	3300050494	Bacteria	796
475	nmdc:mga06z11_44791_c1	3300050494	Bacteria	2233
476	nmdc:mga06z11_66220_c1	3300050494	Bacteria	1898
477	nmdc:mga07m45_2006_c1	3300050496	Bacteria	9433
478	nmdc:mga07m45_355601_c1	3300050496	Bacteria	851
479	nmdc:mga07m45_376929_c1	3300050496	Bacteria	824
480	nmdc:mga07m45_536509_c1	3300050496	Bacteria	677
481	nmdc:mga07m45_584_c1	3300050496	Bacteria	15526
482	nmdc:mga07m45_675673_c1	3300050496	Bacteria	595
483	nmdc:mga07m45_8721_c1	3300050496	Bacteria	5224
484	Ga0495612_0258950	3300053078	Bacteria	775
485	Ga0500610_0153510	3300053079	Bacteria	1151
486	Ga0495655_0032721	3300053083	Bacteria	1275
487	Ga0500643_017525	3300053087	Bacteria	2397
488	Ga0500646_0058129	3300053090	Bacteria	1131
489	Ga0500651_0018395	3300053093	Bacteria	4324
490	Ga0500566_0107312	3300053094	Bacteria	1522
491	Ga0500562_018162	3300053108	Bacteria	1815
492	Ga0500569_046125	3300053109	Bacteria	1297
493	Ga0500571_002013	3300053110	Bacteria	9929
494	Ga0500593_003991	3300053117	Bacteria	5662
495	Ga0500594_0005406	3300053118	Bacteria	2833
496	Ga0500607_007699	3300053121	Bacteria	6627
497	Ga0500607_050269	3300053121	Bacteria	2222
498	Ga0500608_002571	3300053122	Bacteria	6633
499	Ga0500608_145172	3300053122	Bacteria	1047
500	Ga0500618_029137	3300053125	Bacteria	1304
501	Ga0500618_046308	3300053125	Bacteria	991
502	Ga0500626_048905	3300053128	Bacteria	1905
503	Ga0500655_001394	3300053133	Bacteria	4581
504	Ga0500658_0002731	3300053134	Bacteria	6788
505	Ga0500559_0002713	3300053136	Bacteria	8990
506	Ga0500559_0042177	3300053136	Bacteria	1990
507	Ga0500561_0125799	3300053137	Bacteria	785
508	Ga0500568_0014438	3300053139	Bacteria	3566
509	Ga0500573_0040290	3300053140	Bacteria	2698
510	Ga0500606_238270	3300053152	Bacteria	536
511	Ga0500616_0020004	3300053153	Bacteria	3764
512	Ga0500622_0130021	3300053156	Bacteria	1211
513	Ga0500627_0003025	3300053158	Bacteria	5117
514	Ga0500634_0051880	3300053161	Bacteria	2205
515	Ga0500638_055444	3300053162	Bacteria	1911
516	Ga0500636_0008456	3300053177	Bacteria	5970
517	Ga0500625_152518	3300053729	Bacteria	866
518	Ga0500596_010632	3300053735	Bacteria	1418
519	Ga0501082_0533094	3300060353	Bacteria	1027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025939	Ga0207665_10031362	Ga0207665_100313623	138
2	3300005459	Ga0068867_100433483	Ga0068867_1004334832	143
3	3300026089	Ga0207648_10179302	Ga0207648_101793024	143
4	3300042876	Ga0451577_0006257	Ga0451577_0006257_3245_3676	143
5	3300042876	Ga0451577_0042046	Ga0451577_0042046_2903_3334	143
6	3300042876	Ga0451577_0255441	Ga0451577_0255441_137_568	143
7	3300042876	Ga0451577_0753814	Ga0451577_0753814_17_511	143
8	3300044673	Ga0453683_0157035	Ga0453683_0157035_145_576	143
9	3300044712	Ga0453684_0000005	Ga0453684_0000005_402070_402501	143
10	3300044712	Ga0453684_0000512	Ga0453684_0000512_27457_27888	143
11	3300044712	Ga0453684_0000692	Ga0453684_0000692_119008_119439	143
12	3300044712	Ga0453684_1663067	Ga0453684_1663067_173_604	143
13	3300045051	Ga0451576_0000461	Ga0451576_0000461_90688_91119	143
14	3300045051	Ga0451576_0001147	Ga0451576_0001147_15974_16405	143
15	3300045051	Ga0451576_0210371	Ga0451576_0210371_22_453	143
16	3300045051	Ga0451576_0393855	Ga0451576_0393855_200_631	143
17	3300045051	Ga0451576_0615052	Ga0451576_0615052_258_689	143
18	3300045051	Ga0451576_0778998	Ga0451576_0778998_47_478	143
19	3300049571	Ga0501034_1441701	Ga0501034_1441701_91_528	144
20	iso_pu_bacteria	2513020051	2513228691	144
21	iso_pu_bacteria	2599185214	2599623749	144
22	iso_pu_bacteria	2599185226	2599671632	144
23	iso_pu_bacteria	2599185227	2599681355	144
24	iso_pu_bacteria	2599185229	2599693242	144
25	iso_pu_bacteria	2643221628	2644159662	144
26	iso_pu_bacteria	2643221658	2644327688	144
27	iso_pu_bacteria	2643221672	2644400363	144
28	iso_pu_bacteria	2643221683	2644468235	144
29	iso_pu_bacteria	2738541277	2738717803	144
30	iso_pu_bacteria	2738541307	2738879418	144
31	iso_pu_bacteria	2738543013	2739251362	144
32	iso_pu_bacteria	2738543019	2739278489	144
33	iso_pu_bacteria	2818991446	2819597292	144
34	iso_pu_bacteria	2831265667	2831266417	144
35	iso_pu_bacteria	2838054893	2838057461	144
36	iso_pu_bacteria	2842677519	2842679983	144
37	iso_pu_bacteria	2842747753	2842747789	144
38	iso_pu_bacteria	2885192300	2885192628	144
39	iso_pu_bacteria	2885198086	2885204553	144
40	iso_pu_bacteria	2885211737	2885218206	144
41	iso_pu_bacteria	2899924645	2899924799	144
42	iso_pu_bacteria	2904449895	2904454364	144
43	iso_pu_bacteria	2904456579	2904461193	144
44	iso_pu_bacteria	2904541872	2904548313	144
45	iso_pu_bacteria	2919462493	2919466102	144
46	iso_pu_bacteria	2928037797	2928039075	144
47	iso_pu_bacteria	2928044640	2928045320	144
48	iso_pu_bacteria	2928051484	2928053125	144
49	iso_pu_bacteria	2928064002	2928064204	144
50	iso_pu_bacteria	2928070936	2928071632	144
51	iso_pu_bacteria	2928084124	2928084417	144
52	iso_pu_bacteria	2928115317	2928116452	144
53	iso_pu_bacteria	2929160207	2929163303	144
54	iso_pu_bacteria	2929520902	2929527076	144
55	iso_pu_bacteria	2945909444	2945911735	144
56	iso_pu_bacteria	2945945610	2945948072	144
57	iso_pu_bacteria	2945972063	2945977261	144
58	iso_pu_bacteria	2945984333	2945985974	144
59	iso_pu_bacteria	2954767861	2954772238	144
60	3300005295	Ga0065707_10219893	Ga0065707_102198932	145
61	3300005331	Ga0070670_100191397	Ga0070670_1001913972	145
62	3300005435	Ga0070714_100477531	Ga0070714_1004775312	145
63	3300005530	Ga0070679_100196496	Ga0070679_1001964963	145
64	3300005618	Ga0068864_100042962	Ga0068864_1000429626	145
65	3300006173	Ga0070716_101470761	Ga0070716_1014707612	145
66	3300014326	Ga0157380_11697062	Ga0157380_116970622	145
67	3300025921	Ga0207652_10438069	Ga0207652_104380692	145
68	3300025925	Ga0207650_10158774	Ga0207650_101587743	145
69	3300026095	Ga0207676_10086079	Ga0207676_100860795	145
70	3300031238	Ga0265332_10013086	Ga0265332_100130865	145
71	3300037068	Ga0373925_0882560	Ga0373925_0882560_98_535	145
72	3300037471	Ga0395905_0358647	Ga0395905_0358647_409_849	145
73	3300037471	Ga0395905_0681056	Ga0395905_0681056_71_511	145
74	3300037471	Ga0395905_0818735	Ga0395905_0818735_203_640	145
75	3300038443	Ga0395901_0090542	Ga0395901_0090542_2428_2865	145
76	3300041404	Ga0439436_0025063	Ga0439436_0025063_1157_1594	145
77	3300044673	Ga0453683_0482960	Ga0453683_0482960_12_449	145
78	3300048929	Ga0496126_0038986	Ga0496126_0038986_2866_3309	145
79	3300049572	Ga0501036_0941788	Ga0501036_0941788_97_537	145
80	3300049574	Ga0501038_0885926	Ga0501038_0885926_115_555	145
81	3300049581	Ga0501047_0099448	Ga0501047_0099448_1563_2003	145
82	3300049823	Ga0501044_0130321	Ga0501044_0130321_633_1073	145
83	3300005327	Ga0070658_10122031	Ga0070658_101220312	146
84	3300005563	Ga0068855_100236851	Ga0068855_1002368513	146
85	3300005563	Ga0068855_100309909	Ga0068855_1003099092	146
86	3300005614	Ga0068856_100395696	Ga0068856_1003956963	146
87	3300005842	Ga0068858_101034455	Ga0068858_1010344552	146
88	3300006177	Ga0075362_10044445	Ga0075362_100444452	146
89	3300006195	Ga0075366_10004920	Ga0075366_100049207	146
90	3300006195	Ga0075366_10085278	Ga0075366_100852782	146
91	3300006353	Ga0075370_10000474	Ga0075370_100004749	146
92	3300009094	Ga0111539_11514388	Ga0111539_115143882	146
93	3300009553	Ga0105249_11801186	Ga0105249_118011861	146
94	3300025909	Ga0207705_10375375	Ga0207705_103753752	146
95	3300025949	Ga0207667_10546357	Ga0207667_105463571	146
96	3300031548	Ga0307408_100150147	Ga0307408_1001501471	146
97	3300031731	Ga0307405_10129996	Ga0307405_101299962	146
98	3300031911	Ga0307412_10136093	Ga0307412_101360933	146
99	3300031911	Ga0307412_10306683	Ga0307412_103066832	146
100	3300032002	Ga0307416_100215742	Ga0307416_1002157422	146
101	3300032002	Ga0307416_100358133	Ga0307416_1003581332	146
102	3300037418	Ga0395900_0345177	Ga0395900_0345177_21_464	146
103	3300037471	Ga0395905_0345312	Ga0395905_0345312_16_480	146
104	3300038443	Ga0395901_0101252	Ga0395901_0101252_1637_2080	146
105	3300038443	Ga0395901_0164471	Ga0395901_0164471_749_1189	146
106	3300041406	Ga0439439_0013823	Ga0439439_0013823_390_857	146
107	3300041407	Ga0439447_045899	Ga0439447_045899_29_496	146
108	3300041410	Ga0439461_0029046	Ga0439461_0029046_147_614	146
109	3300041997	Ga0439431_0003869	Ga0439431_0003869_354_821	146
110	3300042002	Ga0439442_049256	Ga0439442_049256_198_665	146
111	3300042004	Ga0439445_0007002	Ga0439445_0007002_2008_2475	146
112	3300042006	Ga0439432_026408	Ga0439432_026408_222_689	146
113	3300042007	Ga0439449_0001247	Ga0439449_0001247_4720_5187	146
114	3300042010	Ga0439452_007264	Ga0439452_007264_1470_1937	146
115	3300042014	Ga0439457_002895	Ga0439457_002895_3483_3950	146
116	3300042015	Ga0439462_0019071	Ga0439462_0019071_689_1156	146
117	3300042125	Ga0450923_000384	Ga0450923_000384_3121_3645	146
118	3300042133	Ga0450896_001037	Ga0450896_001037_2594_3061	146
119	3300042134	Ga0450898_007197	Ga0450898_007197_52_519	146
120	3300042147	Ga0450910_022532	Ga0450910_022532_342_809	146
121	3300042156	Ga0439446_0033419	Ga0439446_0033419_42_509	146
122	3300042435	Ga0439434_0007537	Ga0439434_0007537_1386_1853	146
123	3300046525	Ga0495663_0055153	Ga0495663_0055153_428_868	146
124	3300046539	Ga0495621_0434779	Ga0495621_0434779_44_484	146
125	3300046615	Ga0495656_0029722	Ga0495656_0029722_925_1365	146
126	3300046665	Ga0495661_0520113	Ga0495661_0520113_45_485	146
127	3300047447	Ga0495685_154976	Ga0495685_154976_134_574	146
128	3300048912	Ga0496109_0420257	Ga0496109_0420257_348_794	146
129	3300049571	Ga0501034_0029804	Ga0501034_0029804_3254_3694	146
130	3300049579	Ga0501043_0033425	Ga0501043_0033425_1380_1820	146
131	3300049581	Ga0501047_0033428	Ga0501047_0033428_240_680	146
132	3300049742	Ga0501080_0054648	Ga0501080_0054648_3189_3629	146
133	3300049822	Ga0501035_0303661	Ga0501035_0303661_439_879	146
134	3300050489	nmdc:mga03683_282570_c1	nmdc:mga03683_282570_c1_188_628	146
135	3300050490	nmdc:mga03n38_467544_c1	nmdc:mga03n38_467544_c1_19_459	146
136	3300050492	nmdc:mga0yw44_437468_c1	nmdc:mga0yw44_437468_c1_36_503	146
137	3300050493	nmdc:mga0k408_119561_c2	nmdc:mga0k408_119561_c2_372_812	146
138	3300050493	nmdc:mga0k408_4556_c1	nmdc:mga0k408_4556_c1_6112_6552	146
139	3300050496	nmdc:mga07m45_2006_c1	nmdc:mga07m45_2006_c1_3564_4004	146
140	3300053083	Ga0495655_0032721	Ga0495655_0032721_764_1204	146
141	3300060353	Ga0501082_0533094	Ga0501082_0533094_173_613	146
142	3300006177	Ga0075362_10138978	Ga0075362_101389783	147
143	3300006178	Ga0075367_10159162	Ga0075367_101591622	147
144	3300039447	Ga0436361_0968351	Ga0436361_0968351_397_840	147
145	3300050489	nmdc:mga03683_112023_c1	nmdc:mga03683_112023_c1_60_554	147
146	3300050494	nmdc:mga06z11_430659_c1	nmdc:mga06z11_430659_c1_277_771	147
147	3300050496	nmdc:mga07m45_376929_c1	nmdc:mga07m45_376929_c1_130_624	147
148	3300050496	nmdc:mga07m45_536509_c1	nmdc:mga07m45_536509_c1_201_647	147
149	2162886007	SwRhRL2b_contig_2570715	SwRhRL2b_0759.00000920	148
150	3300002739	JGI25158J39367_1011650	JGI25158J39367_10116502	148
151	3300002774	JGI25150J39212_1000968	JGI25150J39212_10009689	148
152	3300002774	JGI25150J39212_1009542	JGI25150J39212_10095424	148
153	3300003187	JGI25151J46595_10001150	JGI25151J46595_100011501	148
154	3300003187	JGI25151J46595_10006674	JGI25151J46595_100066745	148
155	3300003316	rootH1_10049748	rootH1_100497485	148
156	3300003322	rootL2_10008299	rootL2_100082992	148
157	3300003322	rootL2_10121275	rootL2_101212754	148
158	3300003323	rootH1_10018555	rootH1_100185552	148
159	3300003578	Ga0006562J51391_1088752	Ga0006562J51391_10887523	148
160	3300003758	Ga0055532_1008517	Ga0055532_10085172	148
161	3300003761	Ga0055535_1000194	Ga0055535_10001947	148
162	3300003761	Ga0055535_1000937	Ga0055535_100093715	148
163	3300003762	Ga0055542_1000039	Ga0055542_1000039153	148
164	3300003773	Ga0055537_1000068	Ga0055537_100006811	148
165	3300003784	Ga0055534_1000080	Ga0055534_100008011	148
166	3300003784	Ga0055534_1001964	Ga0055534_10019649	148
167	3300003784	Ga0055534_1006830	Ga0055534_10068304	148
168	3300003790	Ga0055528_1004897	Ga0055528_10048974	148
169	3300003790	Ga0055528_1021312	Ga0055528_10213121	148
170	3300003791	Ga0055530_10011056	Ga0055530_100110565	148
171	3300003792	Ga0055540_1004295	Ga0055540_10042954	148
172	3300003792	Ga0055540_1013718	Ga0055540_10137184	148
173	3300003794	Ga0055531_10016087	Ga0055531_100160875	148
174	3300003794	Ga0055531_10036269	Ga0055531_100362691	148
175	3300005262	Ga0065165_1077319	Ga0065165_10773192	148
176	3300005288	Ga0065714_10302700	Ga0065714_103027001	148
177	3300005289	Ga0065704_10139325	Ga0065704_101393252	148
178	3300005327	Ga0070658_10284960	Ga0070658_102849603	148
179	3300005334	Ga0068869_100050289	Ga0068869_1000502894	148
180	3300005344	Ga0070661_100710515	Ga0070661_1007105152	148
181	3300005356	Ga0070674_100528144	Ga0070674_1005281442	148
182	3300005364	Ga0070673_100025732	Ga0070673_1000257323	148
183	3300005364	Ga0070673_100224869	Ga0070673_1002248693	148
184	3300005367	Ga0070667_100106599	Ga0070667_1001065993	148
185	3300005456	Ga0070678_100150523	Ga0070678_1001505233	148
186	3300005456	Ga0070678_100348413	Ga0070678_1003484132	148
187	3300005457	Ga0070662_100030106	Ga0070662_1000301065	148
188	3300005543	Ga0070672_100158553	Ga0070672_1001585533	148
189	3300005548	Ga0070665_100098307	Ga0070665_1000983074	148
190	3300005548	Ga0070665_100206360	Ga0070665_1002063602	148
191	3300005564	Ga0070664_100050494	Ga0070664_1000504945	148
192	3300005577	Ga0068857_100060422	Ga0068857_1000604224	148
193	3300005834	Ga0068851_10057813	Ga0068851_100578133	148
194	3300006038	Ga0075365_10084865	Ga0075365_100848654	148
195	3300006051	Ga0075364_10092888	Ga0075364_100928884	148
196	3300006051	Ga0075364_10470029	Ga0075364_104700292	148
197	3300006058	Ga0075432_10037951	Ga0075432_100379513	148
198	3300006178	Ga0075367_10103359	Ga0075367_101033594	148
199	3300006195	Ga0075366_10015121	Ga0075366_100151214	148
200	3300006195	Ga0075366_10076309	Ga0075366_100763093	148
201	3300006195	Ga0075366_10113841	Ga0075366_101138413	148
202	3300006353	Ga0075370_10000091	Ga0075370_1000009124	148
203	3300006353	Ga0075370_10059335	Ga0075370_100593352	148
204	3300006353	Ga0075370_10133653	Ga0075370_101336533	148
205	3300006358	Ga0068871_100091870	Ga0068871_1000918704	148
206	3300006948	Ga0099826_10000121	Ga0099826_100001218	148
207	3300009036	Ga0105244_10022711	Ga0105244_100227114	148
208	3300009093	Ga0105240_10119365	Ga0105240_101193654	148
209	3300009093	Ga0105240_11490735	Ga0105240_114907352	148
210	3300009098	Ga0105245_10144980	Ga0105245_101449804	148
211	3300009148	Ga0105243_10016877	Ga0105243_100168779	148
212	3300009148	Ga0105243_10059780	Ga0105243_100597802	148
213	3300009545	Ga0105237_10615589	Ga0105237_106155892	148
214	3300009545	Ga0105237_11468712	Ga0105237_114687121	148
215	3300009551	Ga0105238_10151854	Ga0105238_101518544	148
216	3300010375	Ga0105239_10878134	Ga0105239_108781342	148
217	3300010375	Ga0105239_10926778	Ga0105239_109267783	148
218	3300010375	Ga0105239_11718049	Ga0105239_117180492	148
219	3300011119	Ga0105246_10079849	Ga0105246_100798493	148
220	3300011119	Ga0105246_10180526	Ga0105246_101805262	148
221	3300012502	Ga0157347_1036869	Ga0157347_10368691	148
222	3300012512	Ga0157327_1004049	Ga0157327_10040492	148
223	3300013100	Ga0157373_10016087	Ga0157373_100160878	148
224	3300013102	Ga0157371_10536711	Ga0157371_105367112	148
225	3300013104	Ga0157370_10016574	Ga0157370_1001657410	148
226	3300013104	Ga0157370_10477046	Ga0157370_104770462	148
227	3300013105	Ga0157369_10022998	Ga0157369_100229987	148
228	3300013105	Ga0157369_10458604	Ga0157369_104586043	148
229	3300013296	Ga0157374_12441414	Ga0157374_124414141	148
230	3300013297	Ga0157378_10573472	Ga0157378_105734723	148
231	3300013306	Ga0163162_11123792	Ga0163162_111237922	148
232	3300013306	Ga0163162_11974017	Ga0163162_119740172	148
233	3300013307	Ga0157372_10315160	Ga0157372_103151602	148
234	3300013308	Ga0157375_10675741	Ga0157375_106757412	148
235	3300013308	Ga0157375_13145916	Ga0157375_131459161	148
236	3300014326	Ga0157380_10543392	Ga0157380_105433922	148
237	3300014497	Ga0182008_10004652	Ga0182008_100046524	148
238	3300014497	Ga0182008_10005023	Ga0182008_100050237	148
239	3300014497	Ga0182008_10005485	Ga0182008_100054858	148
240	3300014497	Ga0182008_10018008	Ga0182008_100180084	148
241	3300014497	Ga0182008_10097416	Ga0182008_100974163	148
242	3300014497	Ga0182008_10287258	Ga0182008_102872582	148
243	3300014968	Ga0157379_11142182	Ga0157379_111421822	148
244	3300014969	Ga0157376_10301566	Ga0157376_103015663	148
245	3300014969	Ga0157376_10516757	Ga0157376_105167572	148
246	3300014969	Ga0157376_12205516	Ga0157376_122055161	148
247	3300015261	Ga0182006_1003622	Ga0182006_10036227	148
248	3300015261	Ga0182006_1015189	Ga0182006_10151892	148
249	3300015262	Ga0182007_10004599	Ga0182007_100045994	148
250	3300015262	Ga0182007_10005832	Ga0182007_100058324	148
251	3300015265	Ga0182005_1193110	Ga0182005_11931102	148
252	3300015683	Ga0183362_10001	Ga0183362_100011267	148
253	3300017792	Ga0163161_10005661	Ga0163161_100056619	148
254	3300017792	Ga0163161_10036358	Ga0163161_100363584	148
255	3300017792	Ga0163161_10080821	Ga0163161_100808213	148
256	3300017792	Ga0163161_10089727	Ga0163161_100897273	148
257	3300017792	Ga0163161_10093372	Ga0163161_100933724	148
258	3300025208	Ga0209436_115229	Ga0209436_1152293	148
259	3300025228	Ga0209672_100687	Ga0209672_1006877	148
260	3300025229	Ga0209147_101482	Ga0209147_1014829	148
261	3300025242	Ga0209258_100099	Ga0209258_10009960	148
262	3300025245	Ga0207425_1002406	Ga0207425_10024066	148
263	3300025245	Ga0207425_1003931	Ga0207425_10039314	148
264	3300025254	Ga0209148_1000103	Ga0209148_100010360	148
265	3300025258	Ga0209129_1000007	Ga0209129_1000007536	148
266	3300025258	Ga0209129_1003184	Ga0209129_10031848	148
267	3300025258	Ga0209129_1036987	Ga0209129_10369872	148
268	3300025263	Ga0209565_1000038	Ga0209565_1000038263	148
269	3300025263	Ga0209565_1000073	Ga0209565_100007398	148
270	3300025273	Ga0209673_1000127	Ga0209673_100012769	148
271	3300025273	Ga0209673_1000128	Ga0209673_100012814	148
272	3300025273	Ga0209673_1002300	Ga0209673_10023004	148
273	3300025273	Ga0209673_1006250	Ga0209673_10062508	148
274	3300025284	Ga0209130_1000076	Ga0209130_1000076105	148
275	3300025284	Ga0209130_1000590	Ga0209130_100059030	148
276	3300025291	Ga0209675_1000029	Ga0209675_100002969	148
277	3300025291	Ga0209675_1000194	Ga0209675_10001949	148
278	3300025291	Ga0209675_1000734	Ga0209675_10007349	148
279	3300025291	Ga0209675_1044115	Ga0209675_10441152	148
280	3300025292	Ga0209676_1000205	Ga0209676_100020591	148
281	3300025292	Ga0209676_1000383	Ga0209676_100038381	148
282	3300025292	Ga0209676_1001009	Ga0209676_10010094	148
283	3300025292	Ga0209676_1002941	Ga0209676_10029419	148
284	3300025294	Ga0209025_1000056	Ga0209025_100005622	148
285	3300025294	Ga0209025_1000088	Ga0209025_100008816	148
286	3300025294	Ga0209025_1001878	Ga0209025_100187815	148
287	3300025294	Ga0209025_1007177	Ga0209025_10071777	148
288	3300025294	Ga0209025_1010860	Ga0209025_10108604	148
289	3300025294	Ga0209025_1012639	Ga0209025_10126397	148
290	3300025294	Ga0209025_1042001	Ga0209025_10420013	148
291	3300025295	Ga0209564_1000073	Ga0209564_100007358	148
292	3300025295	Ga0209564_1000099	Ga0209564_1000099138	148
293	3300025297	Ga0209758_1000044	Ga0209758_10000449	148
294	3300025297	Ga0209758_1012502	Ga0209758_10125024	148
295	3300025298	Ga0209050_1000007	Ga0209050_10000079	148
296	3300025298	Ga0209050_1000952	Ga0209050_100095237	148
297	3300025298	Ga0209050_1004011	Ga0209050_10040117	148
298	3300025299	Ga0209256_1000020	Ga0209256_100002012	148
299	3300025299	Ga0209256_1000022	Ga0209256_1000022428	148
300	3300025302	Ga0207426_1000001	Ga0207426_1000001647	148
301	3300025303	Ga0209051_1000103	Ga0209051_100010328	148
302	3300025303	Ga0209051_1000259	Ga0209051_100025982	148
303	3300025303	Ga0209051_1001166	Ga0209051_100116622	148
304	3300025303	Ga0209051_1004582	Ga0209051_10045828	148
305	3300025303	Ga0209051_1007889	Ga0209051_10078894	148
306	3300025304	Ga0209257_1000116	Ga0209257_1000116206	148
307	3300025304	Ga0209257_1000491	Ga0209257_100049146	148
308	3300025304	Ga0209257_1004550	Ga0209257_10045506	148
309	3300025304	Ga0209257_1011557	Ga0209257_10115575	148
310	3300025304	Ga0209257_1021109	Ga0209257_10211094	148
311	3300025321	Ga0207656_10028052	Ga0207656_100280523	148
312	3300025728	Ga0207655_1020361	Ga0207655_10203611	148
313	3300025901	Ga0207688_10092921	Ga0207688_100929212	148
314	3300025901	Ga0207688_10415896	Ga0207688_104158962	148
315	3300025904	Ga0207647_10385861	Ga0207647_103858612	148
316	3300025909	Ga0207705_10300556	Ga0207705_103005562	148
317	3300025914	Ga0207671_10446758	Ga0207671_104467582	148
318	3300025920	Ga0207649_10125580	Ga0207649_101255802	148
319	3300025924	Ga0207694_10881709	Ga0207694_108817092	148
320	3300025926	Ga0207659_10696236	Ga0207659_106962361	148
321	3300025926	Ga0207659_11183878	Ga0207659_111838782	148
322	3300025927	Ga0207687_10215895	Ga0207687_102158953	148
323	3300025935	Ga0207709_10004077	Ga0207709_1000407712	148
324	3300025935	Ga0207709_10019765	Ga0207709_100197653	148
325	3300025940	Ga0207691_10162635	Ga0207691_101626353	148
326	3300025942	Ga0207689_10094396	Ga0207689_100943964	148
327	3300025945	Ga0207679_10035277	Ga0207679_100352775	148
328	3300025960	Ga0207651_10211019	Ga0207651_102110194	148
329	3300025960	Ga0207651_10539285	Ga0207651_105392852	148
330	3300025981	Ga0207640_10558816	Ga0207640_105588163	148
331	3300025986	Ga0207658_10435955	Ga0207658_104359552	148
332	3300026041	Ga0207639_10138532	Ga0207639_101385322	148
333	3300026067	Ga0207678_10372706	Ga0207678_103727063	148
334	3300026078	Ga0207702_10757582	Ga0207702_107575821	148
335	3300026088	Ga0207641_10349074	Ga0207641_103490743	148
336	3300026089	Ga0207648_10711677	Ga0207648_107116772	148
337	3300026116	Ga0207674_10246100	Ga0207674_102461002	148
338	3300026121	Ga0207683_10048947	Ga0207683_100489476	148
339	3300027666	Ga0209282_1000488	Ga0209282_100048819	148
340	3300027907	Ga0207428_10028385	Ga0207428_100283857	148
341	3300028379	Ga0268266_10200224	Ga0268266_102002242	148
342	3300028379	Ga0268266_10572419	Ga0268266_105724192	148
343	3300028380	Ga0268265_10060264	Ga0268265_100602644	148
344	3300028381	Ga0268264_11093701	Ga0268264_110937012	148
345	3300028794	Ga0307515_10000628	Ga0307515_100006289	148
346	3300030522	Ga0307512_10198908	Ga0307512_101989082	148
347	3300030731	Ga0316177_1146803	Ga0316177_11468032	148
348	3300030732	Ga0316176_1059428	Ga0316176_10594284	148
349	3300030733	Ga0314311_1031246	Ga0314311_10312464	148
350	3300030735	Ga0316178_1111916	Ga0316178_11119167	148
351	3300030736	Ga0316180_1190288	Ga0316180_11902883	148
352	3300030742	Ga0316183_1212063	Ga0316183_12120634	148
353	3300030745	Ga0316182_1166328	Ga0316182_11663284	148
354	3300031251	Ga0265327_10011171	Ga0265327_100111714	148
355	3300031456	Ga0307513_10217392	Ga0307513_102173923	148
356	3300031548	Ga0307408_100193229	Ga0307408_1001932293	148
357	3300031649	Ga0307514_10047780	Ga0307514_100477803	148
358	3300031731	Ga0307405_10130681	Ga0307405_101306812	148
359	3300031731	Ga0307405_10452766	Ga0307405_104527662	148
360	3300031731	Ga0307405_10619793	Ga0307405_106197932	148
361	3300031824	Ga0307413_10104973	Ga0307413_101049731	148
362	3300031901	Ga0307406_10003876	Ga0307406_100038768	148
363	3300031901	Ga0307406_10479092	Ga0307406_104790922	148
364	3300031903	Ga0307407_10116129	Ga0307407_101161292	148
365	3300031911	Ga0307412_10105124	Ga0307412_101051243	148
366	3300031911	Ga0307412_10150893	Ga0307412_101508931	148
367	3300031995	Ga0307409_100451339	Ga0307409_1004513391	148
368	3300032002	Ga0307416_101291943	Ga0307416_1012919432	148
369	3300032002	Ga0307416_101663776	Ga0307416_1016637762	148
370	3300032004	Ga0307414_10737499	Ga0307414_107374992	148
371	3300032005	Ga0307411_10063724	Ga0307411_100637242	148
372	3300032005	Ga0307411_10635683	Ga0307411_106356832	148
373	3300041404	Ga0439436_0002082	Ga0439436_0002082_3750_4196	148
374	3300041406	Ga0439439_0077800	Ga0439439_0077800_130_576	148
375	3300041407	Ga0439447_024968	Ga0439447_024968_335_781	148
376	3300041410	Ga0439461_0008900	Ga0439461_0008900_426_872	148
377	3300041410	Ga0439461_0126574	Ga0439461_0126574_123_569	148
378	3300041411	Ga0439466_0019659	Ga0439466_0019659_1903_2349	148
379	3300041411	Ga0439466_0022992	Ga0439466_0022992_320_766	148
380	3300041411	Ga0439466_0105552	Ga0439466_0105552_89_535	148
381	3300041413	Ga0439465_0000776	Ga0439465_0000776_2132_2578	148
382	3300041413	Ga0439465_0043783	Ga0439465_0043783_272_718	148
383	3300041451	Ga0451791_0112917	Ga0451791_0112917_139_585	148
384	3300041453	Ga0451797_0305433	Ga0451797_0305433_94_540	148
385	3300041456	Ga0451795_1510973	Ga0451795_1510973_419_865	148
386	3300041494	Ga0451837_0037507	Ga0451837_0037507_195_644	148
387	3300041498	Ga0451841_0414732	Ga0451841_0414732_216_662	148
388	3300041997	Ga0439431_0006040	Ga0439431_0006040_1801_2247	148
389	3300041997	Ga0439431_0043437	Ga0439431_0043437_157_603	148
390	3300041999	Ga0439433_0001065	Ga0439433_0001065_2808_3254	148
391	3300042002	Ga0439442_002129	Ga0439442_002129_3271_3717	148
392	3300042002	Ga0439442_083356	Ga0439442_083356_150_596	148
393	3300042004	Ga0439445_0001549	Ga0439445_0001549_3879_4325	148
394	3300042006	Ga0439432_001320	Ga0439432_001320_5256_5702	148
395	3300042007	Ga0439449_0000266	Ga0439449_0000266_8958_9404	148
396	3300042007	Ga0439449_0039410	Ga0439449_0039410_1163_1609	148
397	3300042007	Ga0439449_0105253	Ga0439449_0105253_513_962	148
398	3300042010	Ga0439452_009824	Ga0439452_009824_1911_2357	148
399	3300042014	Ga0439457_021962	Ga0439457_021962_496_942	148
400	3300042015	Ga0439462_0001251	Ga0439462_0001251_3628_4074	148
401	3300042122	Ga0450920_011530	Ga0450920_011530_521_967	148
402	3300042125	Ga0450923_007453	Ga0450923_007453_108_554	148
403	3300042145	Ga0450906_013074	Ga0450906_013074_931_1377	148
404	3300042147	Ga0450910_017575	Ga0450910_017575_399_845	148
405	3300042156	Ga0439446_0025365	Ga0439446_0025365_1206_1652	148
406	3300042156	Ga0439446_0025819	Ga0439446_0025819_293_742	148
407	3300042184	Ga0450908_006751	Ga0450908_006751_1583_2029	148
408	3300042435	Ga0439434_0039535	Ga0439434_0039535_642_1088	148
409	3300042435	Ga0439434_0178619	Ga0439434_0178619_172_618	148
410	3300042531	Ga0450918_006518	Ga0450918_006518_1117_1563	148
411	3300044683	Ga0466965_0048397	Ga0466965_0048397_240_686	148
412	3300044901	Ga0466960_0125779	Ga0466960_0125779_768_1214	148
413	3300046453	Ga0495627_018930	Ga0495627_018930_1053_1499	148
414	3300046459	Ga0495629_0250106	Ga0495629_0250106_55_501	148
415	3300046459	Ga0495629_0375172	Ga0495629_0375172_500_946	148
416	3300046460	Ga0495638_0132484	Ga0495638_0132484_197_643	148
417	3300046475	Ga0495639_0002601	Ga0495639_0002601_7304_7750	148
418	3300046512	Ga0495610_0035135	Ga0495610_0035135_1562_2008	148
419	3300046512	Ga0495610_0215951	Ga0495610_0215951_169_615	148
420	3300046513	Ga0495616_0004736	Ga0495616_0004736_2402_2848	148
421	3300046518	Ga0495631_0002450	Ga0495631_0002450_4162_4608	148
422	3300046520	Ga0495637_0013851	Ga0495637_0013851_3110_3556	148
423	3300046520	Ga0495637_0183422	Ga0495637_0183422_263_709	148
424	3300046525	Ga0495663_0024492	Ga0495663_0024492_657_1103	148
425	3300046528	Ga0495642_0107701	Ga0495642_0107701_477_923	148
426	3300046530	Ga0495654_0376549	Ga0495654_0376549_98_544	148
427	3300046531	Ga0495665_0617052	Ga0495665_0617052_78_524	148
428	3300046536	Ga0495587_0272341	Ga0495587_0272341_306_752	148
429	3300046538	Ga0495609_0068373	Ga0495609_0068373_35_481	148
430	3300046539	Ga0495621_0006742	Ga0495621_0006742_1594_2040	148
431	3300046539	Ga0495621_0182937	Ga0495621_0182937_186_638	148
432	3300046557	Ga0495622_0144986	Ga0495622_0144986_38_484	148
433	3300046615	Ga0495656_0001663	Ga0495656_0001663_3841_4287	148
434	3300046615	Ga0495656_0027102	Ga0495656_0027102_1737_2183	148
435	3300046616	Ga0495668_0217563	Ga0495668_0217563_13_459	148
436	3300046660	Ga0495625_0000301	Ga0495625_0000301_4785_5231	148
437	3300046660	Ga0495625_0038284	Ga0495625_0038284_725_1171	148
438	3300046664	Ga0495659_0286751	Ga0495659_0286751_60_506	148
439	3300046664	Ga0495659_0425828	Ga0495659_0425828_83_529	148
440	3300046665	Ga0495661_0216629	Ga0495661_0216629_443_889	148
441	3300046674	Ga0495588_0017990	Ga0495588_0017990_1272_1718	148
442	3300046674	Ga0495588_0040267	Ga0495588_0040267_1818_2264	148
443	3300046680	Ga0495646_0357169	Ga0495646_0357169_118_564	148
444	3300046683	Ga0495658_0099032	Ga0495658_0099032_706_1152	148
445	3300046689	Ga0495613_0862978	Ga0495613_0862978_49_495	148
446	3300046690	Ga0495624_0108584	Ga0495624_0108584_726_1172	148
447	3300046691	Ga0495670_0132105	Ga0495670_0132105_185_631	148
448	3300046691	Ga0495670_0279023	Ga0495670_0279023_213_659	148
449	3300046692	Ga0495671_0008696	Ga0495671_0008696_1119_1565	148
450	3300047321	Ga0495676_0397141	Ga0495676_0397141_18_464	148
451	3300047443	Ga0495687_252198	Ga0495687_252198_70_516	148
452	3300047673	Ga0495593_0003865	Ga0495593_0003865_2934_3380	148
453	3300047673	Ga0495593_0288355	Ga0495593_0288355_207_653	148
454	3300048088	Ga0495602_0287039	Ga0495602_0287039_336_782	148
455	3300048088	Ga0495602_0742866	Ga0495602_0742866_164_610	148
456	3300048089	Ga0495614_0088271	Ga0495614_0088271_704_1150	148
457	3300048090	Ga0495615_0018457	Ga0495615_0018457_333_779	148
458	3300048903	Ga0496100_0123364	Ga0496100_0123364_877_1323	148
459	3300048904	Ga0496101_0020349	Ga0496101_0020349_275_721	148
460	3300048904	Ga0496101_0134464	Ga0496101_0134464_407_853	148
461	3300048905	Ga0496102_0108629	Ga0496102_0108629_447_893	148
462	3300048906	Ga0496103_0109274	Ga0496103_0109274_162_608	148
463	3300048907	Ga0496104_0066302	Ga0496104_0066302_2009_2455	148
464	3300048908	Ga0496105_0046143	Ga0496105_0046143_2044_2490	148
465	3300048908	Ga0496105_0475232	Ga0496105_0475232_324_770	148
466	3300048910	Ga0496107_0169484	Ga0496107_0169484_196_642	148
467	3300048910	Ga0496107_0229457	Ga0496107_0229457_128_574	148
468	3300048911	Ga0496108_0273156	Ga0496108_0273156_178_624	148
469	3300048911	Ga0496108_1096841	Ga0496108_1096841_22_468	148
470	3300048912	Ga0496109_0249204	Ga0496109_0249204_492_938	148
471	3300048913	Ga0496110_0056262	Ga0496110_0056262_1103_1549	148
472	3300048913	Ga0496110_0378569	Ga0496110_0378569_450_896	148
473	3300048914	Ga0496111_0044719	Ga0496111_0044719_26_472	148
474	3300048914	Ga0496111_0073525	Ga0496111_0073525_1087_1533	148
475	3300048915	Ga0496112_0525217	Ga0496112_0525217_534_980	148
476	3300048916	Ga0496113_0162488	Ga0496113_0162488_1165_1611	148
477	3300048916	Ga0496113_1141412	Ga0496113_1141412_26_472	148
478	3300048917	Ga0496114_0145055	Ga0496114_0145055_857_1303	148
479	3300048919	Ga0496116_0043676	Ga0496116_0043676_91_537	148
480	3300048919	Ga0496116_0049089	Ga0496116_0049089_1723_2169	148
481	3300048919	Ga0496116_0097410	Ga0496116_0097410_1024_1470	148
482	3300048920	Ga0496117_0028570	Ga0496117_0028570_2948_3394	148
483	3300048920	Ga0496117_0079130	Ga0496117_0079130_201_647	148
484	3300048921	Ga0496118_0013068	Ga0496118_0013068_5814_6260	148
485	3300048921	Ga0496118_0015078	Ga0496118_0015078_691_1137	148
486	3300048921	Ga0496118_0174127	Ga0496118_0174127_829_1275	148
487	3300048925	Ga0496122_0002359	Ga0496122_0002359_4279_4725	148
488	3300048925	Ga0496122_0059758	Ga0496122_0059758_1251_1697	148
489	3300048925	Ga0496122_0343654	Ga0496122_0343654_294_740	148
490	3300048926	Ga0496123_0000108	Ga0496123_0000108_55026_55472	148
491	3300048926	Ga0496123_0032805	Ga0496123_0032805_1680_2126	148
492	3300048926	Ga0496123_0070875	Ga0496123_0070875_408_854	148
493	3300048927	Ga0496124_0018958	Ga0496124_0018958_3004_3450	148
494	3300048927	Ga0496124_0121614	Ga0496124_0121614_1558_2004	148
495	3300048928	Ga0496125_0037281	Ga0496125_0037281_433_879	148
496	3300048928	Ga0496125_0041569	Ga0496125_0041569_1377_1823	148
497	3300048929	Ga0496126_0105952	Ga0496126_0105952_325_771	148
498	3300049526	Ga0501303_013928	Ga0501303_013928_198_647	148
499	3300049571	Ga0501034_1675817	Ga0501034_1675817_38_490	148
500	3300049650	Ga0501199_016158	Ga0501199_016158_293_739	148
501	3300049671	Ga0501238_059044	Ga0501238_059044_88_537	148
502	3300049679	Ga0501249_018281	Ga0501249_018281_431_880	148
503	3300049686	Ga0501257_074681	Ga0501257_074681_408_857	148
504	3300049705	Ga0501225_0014624	Ga0501225_0014624_436_885	148
505	3300049758	Ga0501241_068699	Ga0501241_068699_179_628	148
506	3300049759	Ga0501262_002081	Ga0501262_002081_1584_2033	148
507	3300050489	nmdc:mga03683_134253_c1	nmdc:mga03683_134253_c1_613_1059	148
508	3300050489	nmdc:mga03683_294835_c1	nmdc:mga03683_294835_c1_51_497	148
509	3300050490	nmdc:mga03n38_11423_c1	nmdc:mga03n38_11423_c1_1111_1557	148
510	3300050490	nmdc:mga03n38_261404_c1	nmdc:mga03n38_261404_c1_12_458	148
511	3300050490	nmdc:mga03n38_430718_c1	nmdc:mga03n38_430718_c1_118_567	148
512	3300050491	nmdc:mga00v17_319066_c1	nmdc:mga00v17_319066_c1_309_755	148
513	3300050491	nmdc:mga00v17_369683_c1	nmdc:mga00v17_369683_c1_168_614	148
514	3300050492	nmdc:mga0yw44_1416_c1	nmdc:mga0yw44_1416_c1_5016_5462	148
515	3300050492	nmdc:mga0yw44_771356_c1	nmdc:mga0yw44_771356_c1_116_562	148
516	3300050493	nmdc:mga0k408_11989_c1	nmdc:mga0k408_11989_c1_2180_2629	148
517	3300050493	nmdc:mga0k408_2947_c1	nmdc:mga0k408_2947_c1_5745_6191	148
518	3300050493	nmdc:mga0k408_35564_c1	nmdc:mga0k408_35564_c1_1372_1818	148
519	3300050494	nmdc:mga06z11_44791_c1	nmdc:mga06z11_44791_c1_1755_2201	148
520	3300050494	nmdc:mga06z11_66220_c1	nmdc:mga06z11_66220_c1_1156_1605	148
521	3300050496	nmdc:mga07m45_355601_c1	nmdc:mga07m45_355601_c1_367_813	148
522	3300050496	nmdc:mga07m45_584_c1	nmdc:mga07m45_584_c1_14944_15390	148
523	3300050496	nmdc:mga07m45_675673_c1	nmdc:mga07m45_675673_c1_84_530	148
524	3300050496	nmdc:mga07m45_8721_c1	nmdc:mga07m45_8721_c1_175_621	148
525	3300053078	Ga0495612_0258950	Ga0495612_0258950_306_752	148
526	3300053079	Ga0500610_0153510	Ga0500610_0153510_549_995	148
527	3300053087	Ga0500643_017525	Ga0500643_017525_251_697	148
528	3300053090	Ga0500646_0058129	Ga0500646_0058129_670_1116	148
529	3300053093	Ga0500651_0018395	Ga0500651_0018395_3693_4139	148
530	3300053094	Ga0500566_0107312	Ga0500566_0107312_211_657	148
531	3300053108	Ga0500562_018162	Ga0500562_018162_1133_1579	148
532	3300053109	Ga0500569_046125	Ga0500569_046125_252_698	148
533	3300053110	Ga0500571_002013	Ga0500571_002013_3692_4138	148
534	3300053117	Ga0500593_003991	Ga0500593_003991_4015_4461	148
535	3300053118	Ga0500594_0005406	Ga0500594_0005406_1083_1529	148
536	3300053121	Ga0500607_007699	Ga0500607_007699_4417_4863	148
537	3300053121	Ga0500607_050269	Ga0500607_050269_1604_2050	148
538	3300053122	Ga0500608_002571	Ga0500608_002571_3536_3982	148
539	3300053122	Ga0500608_145172	Ga0500608_145172_565_1011	148
540	3300053125	Ga0500618_029137	Ga0500618_029137_700_1146	148
541	3300053125	Ga0500618_046308	Ga0500618_046308_194_640	148
542	3300053128	Ga0500626_048905	Ga0500626_048905_1178_1624	148
543	3300053133	Ga0500655_001394	Ga0500655_001394_1931_2377	148
544	3300053134	Ga0500658_0002731	Ga0500658_0002731_5267_5713	148
545	3300053136	Ga0500559_0002713	Ga0500559_0002713_4217_4663	148
546	3300053136	Ga0500559_0042177	Ga0500559_0042177_1092_1538	148
547	3300053137	Ga0500561_0125799	Ga0500561_0125799_94_540	148
548	3300053139	Ga0500568_0014438	Ga0500568_0014438_1636_2082	148
549	3300053140	Ga0500573_0040290	Ga0500573_0040290_1335_1781	148
550	3300053152	Ga0500606_238270	Ga0500606_238270_16_462	148
551	3300053153	Ga0500616_0020004	Ga0500616_0020004_2581_3027	148
552	3300053156	Ga0500622_0130021	Ga0500622_0130021_132_578	148
553	3300053158	Ga0500627_0003025	Ga0500627_0003025_2766_3212	148
554	3300053161	Ga0500634_0051880	Ga0500634_0051880_224_670	148
555	3300053162	Ga0500638_055444	Ga0500638_055444_691_1137	148
556	3300053177	Ga0500636_0008456	Ga0500636_0008456_5496_5942	148
557	3300053729	Ga0500625_152518	Ga0500625_152518_156_602	148
558	3300053735	Ga0500596_010632	Ga0500596_010632_948_1394	148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

28

155

0.98 PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

19

163

0.74 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3tfz-assembly1.cif.gz_B	crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128	0.8579	2	143
3tfz-assembly1.cif.gz_B	crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128	0.8208	2	143
7jta-assembly1.cif.gz_A	crystal structure of a putative nuclease with anti-cas9 activity from an uncultured clostridia bacterium	0.8132	34	81
2d4r-assembly1.cif.gz_A	crystal structure of ttha0849 from thermus thermophilus hb8	0.8032	2	148
2d4r-assembly1.cif.gz_A	crystal structure of ttha0849 from thermus thermophilus hb8	0.7983	2	148

ID	Description	Score	Start	End	Superfamily
af_P0AGL5_15_157_3.30.530.20	Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain	0.9855	2	147	3.30.530.20
af_P0AGL5_15_157_3.30.530.20	Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain	0.9787	2	147	3.30.530.20
af_Q304F0_1_147_3.30.530.20	Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain	0.9214	2	145	3.30.530.20
af_Q8MLL3_83_228_3.30.530.20	Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain	0.9032	2	143	3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20	Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain	0.9006	2	146	3.30.530.20

ID	Description	Score	Start	End	GO Terms
AF-A0A3A3G229-F1-model_v4	Type II toxin-antitoxin system RatA family toxin	0.9948	1	145	GO:0045333 GO:0048039
AF-J2UST8-F1-model_v4	Oligoketide cyclase/lipid transport protein	0.9928	1	145	GO:0045333 GO:0048039
AF-A0A6L8LBS9-F1-model_v4	deleted	0.9926	1	146
AF-A0A1I7M2N0-F1-model_v4	Ribosome association toxin PasT (RatA) of the RatAB toxin-antitoxin module	0.9916	1	147	GO:0045333 GO:0048039
AF-A0A840MNP9-F1-model_v4	Ribosome-associated toxin RatA of RatAB toxin-antitoxin module	0.9915	1	145	GO:0045333 GO:0048039

Feature Viewer

pLDDT	pTM	Quality
93.67	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F463399

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

28

155

0.98

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

19

163

0.74

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map