F463313

General Info

Members Datasets Scaffolds Average Seq Length
557 300 556 108

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_12060267|Ga0157375_120602671
Length 108
Sequence MQYLFSVVDDTAGLASTDEQAAIDVFNEGLQADGYWVFAGGLGRPETATTIDNRGQGEPLLTDGPFVETKEYLAGFWIVEAPDLDVALGLAAKGSKACNRKVEVRPFL

Samples

Sample ID Description Type Environment
1 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
197 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
198 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
199 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
298 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.9
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 16.7
Rhizosphere 75.04
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10089321 3300001990 Bacteria 914
2 JGI24735J21928_10018658 3300002067 Unclassified 2137
3 JGI24738J21930_10139294 3300002075 Bacteria 535
4 rootH2_10106357 3300003320 Bacteria 3833
5 JGI25407J50210_10001381 3300003373 Bacteria 5503
6 JGI25407J50210_10034201 3300003373 Bacteria 1311
7 Ga0070658_10490348 3300005327 Bacteria 1061
8 Ga0070683_100018203 3300005329 Bacteria 6219
9 Ga0070683_100329420 3300005329 Bacteria 1454
10 Ga0070683_101561600 3300005329 Bacteria 634
11 Ga0068869_100536724 3300005334 Bacteria 981
12 Ga0070666_10445098 3300005335 Bacteria 935
13 Ga0070682_100261076 3300005337 Bacteria 1254
14 Ga0070682_100420290 3300005337 Bacteria 1016
15 Ga0070682_100652070 3300005337 Bacteria 838
16 Ga0068868_100423657 3300005338 Bacteria 1153
17 Ga0068868_100499768 3300005338 Bacteria 1065
18 Ga0070660_100019265 3300005339 Bacteria 4997
19 Ga0070687_100055860 3300005343 Bacteria 2064
20 Ga0070687_100464536 3300005343 Bacteria 845
21 Ga0070661_101271682 3300005344 Bacteria 617
22 Ga0070692_10008668 3300005345 Bacteria 4545
23 Ga0070671_100962308 3300005355 Bacteria 747
24 Ga0070688_100690477 3300005365 Bacteria 789
25 Ga0070659_100230134 3300005366 Bacteria 1532
26 Ga0070714_100315223 3300005435 Bacteria 1461
27 Ga0070713_100025848 3300005436 Bacteria 4598
28 Ga0070710_10124001 3300005437 Bacteria 1567
29 Ga0070711_100444722 3300005439 Bacteria 1060
30 Ga0070711_100502576 3300005439 Bacteria 1000
31 Ga0070700_100339430 3300005441 Bacteria 1110
32 Ga0070700_101663568 3300005441 Bacteria 547
33 Ga0070694_101128766 3300005444 Bacteria 655
34 Ga0070663_100901091 3300005455 Bacteria 764
35 Ga0070678_100046584 3300005456 Bacteria 3110
36 Ga0070678_100601518 3300005456 Bacteria 982
37 Ga0070678_101006260 3300005456 Bacteria 766
38 Ga0070678_101441205 3300005456 Bacteria 644
39 Ga0070662_100180012 3300005457 Bacteria 1666
40 Ga0070681_11923662 3300005458 Bacteria 519
41 Ga0068867_100266791 3300005459 Bacteria 1398
42 Ga0068867_100705570 3300005459 Bacteria 891
43 Ga0070685_11126139 3300005466 Bacteria 594
44 Ga0070685_11503795 3300005466 Bacteria 519
45 Ga0070706_100822227 3300005467 Bacteria 859
46 Ga0070679_102026395 3300005530 Bacteria 525
47 Ga0070684_100112035 3300005535 Bacteria 2447
48 Ga0070684_100364598 3300005535 Bacteria 1330
49 Ga0070684_100395067 3300005535 Bacteria 1275
50 Ga0070684_100926536 3300005535 Bacteria 817
51 Ga0068853_100178734 3300005539 Bacteria 1924
52 Ga0068853_101857185 3300005539 Bacteria 584
53 Ga0070672_100543988 3300005543 Bacteria 1008
54 Ga0070686_100889692 3300005544 Bacteria 724
55 Ga0070693_100192950 3300005547 Bacteria 1318
56 Ga0070665_100336579 3300005548 Bacteria 1514
57 Ga0070665_101051974 3300005548 Bacteria 826
58 Ga0070704_101302327 3300005549 Bacteria 665
59 Ga0068855_100016350 3300005563 Bacteria 8921
60 Ga0068855_100871713 3300005563 Bacteria 953
61 Ga0068855_101611243 3300005563 Bacteria 664
62 Ga0070664_100120263 3300005564 Bacteria 2299
63 Ga0070664_101754262 3300005564 Bacteria 589
64 Ga0068856_100068034 3300005614 Bacteria 3520
65 Ga0068856_100513810 3300005614 Bacteria 1219
66 Ga0068856_100892743 3300005614 Bacteria 908
67 Ga0068856_101022472 3300005614 Bacteria 845
68 Ga0070702_100446774 3300005615 Bacteria 937
69 Ga0070702_100551342 3300005615 Bacteria 856
70 Ga0070702_101024491 3300005615 Bacteria 655
71 Ga0070702_101113078 3300005615 Bacteria 632
72 Ga0068852_100118122 3300005616 Bacteria 2423
73 Ga0068852_100804997 3300005616 Bacteria 954
74 Ga0068852_102816450 3300005616 Bacteria 505
75 Ga0068864_100278366 3300005618 Bacteria 1561
76 Ga0068866_10571532 3300005718 Bacteria 759
77 Ga0068870_11203159 3300005840 Bacteria 549
78 Ga0068858_100301419 3300005842 Bacteria 1529
79 Ga0068860_100136066 3300005843 Bacteria 2359
80 Ga0081455_10088822 3300005937 Bacteria 2510
81 Ga0081538_10001721 3300005981 Bacteria 22267
82 Ga0081538_10162566 3300005981 Bacteria 989
83 Ga0081540_1006883 3300005983 Bacteria 8203
84 Ga0081540_1184967 3300005983 Bacteria 775
85 Ga0070717_10156835 3300006028 Bacteria 1972
86 Ga0070717_10159086 3300006028 Bacteria 1959
87 Ga0075363_100007636 3300006048 Bacteria 4986
88 Ga0075363_100354028 3300006048 Bacteria 858
89 Ga0075364_10054319 3300006051 Bacteria 2619
90 Ga0070715_10239027 3300006163 Bacteria 943
91 Ga0070716_100006634 3300006173 Bacteria 5662
92 Ga0070716_101211553 3300006173 Bacteria 607
93 Ga0075367_10007311 3300006178 Bacteria 5648
94 Ga0097621_100449730 3300006237 Bacteria 1160
95 Ga0097621_100901207 3300006237 Bacteria 824
96 Ga0075370_10170256 3300006353 Bacteria 1280
97 Ga0068871_100172135 3300006358 Bacteria 1857
98 Ga0068871_101311603 3300006358 Bacteria 681
99 Ga0075428_100202463 3300006844 Bacteria 2146
100 Ga0075431_100559060 3300006847 Bacteria 1131
101 Ga0075433_10226844 3300006852 Bacteria 1659
102 Ga0075434_100169029 3300006871 Bacteria 2206
103 Ga0075434_101715275 3300006871 Bacteria 636
104 Ga0075429_101014354 3300006880 Bacteria 725
105 Ga0068865_100164768 3300006881 Bacteria 1694
106 Ga0068865_101041383 3300006881 Bacteria 718
107 Ga0075436_100826849 3300006914 Bacteria 690
108 Ga0075435_100306903 3300007076 Bacteria 1358
109 Ga0075435_100561888 3300007076 Bacteria 988
110 Ga0105251_10325299 3300009011 Bacteria 699
111 Ga0105240_10037410 3300009093 Bacteria 6238
112 Ga0105245_10028880 3300009098 Bacteria 4896
113 Ga0105245_10320557 3300009098 Bacteria 1526
114 Ga0105245_10415152 3300009098 Bacteria 1348
115 Ga0105247_11467829 3300009101 Bacteria 555
116 Ga0114129_10288302 3300009147 Bacteria 2191
117 Ga0114129_11363364 3300009147 Bacteria 876
118 Ga0105243_10179176 3300009148 Bacteria 1842
119 Ga0105243_10247054 3300009148 Bacteria 1591
120 Ga0105243_10402423 3300009148 Bacteria 1272
121 Ga0105243_11015668 3300009148 Bacteria 833
122 Ga0105243_11759686 3300009148 Bacteria 650
123 Ga0105241_10270980 3300009174 Bacteria 1446
124 Ga0105242_10250443 3300009176 Bacteria 1596
125 Ga0105242_10727820 3300009176 Bacteria 974
126 Ga0105248_10344292 3300009177 Bacteria 1678
127 Ga0105248_11302315 3300009177 Bacteria 822
128 Ga0105248_13237847 3300009177 Bacteria 518
129 Ga0105237_10122838 3300009545 Bacteria 2591
130 Ga0105237_10588724 3300009545 Bacteria 1119
131 Ga0105237_10821519 3300009545 Bacteria 936
132 Ga0105237_11086709 3300009545 Bacteria 807
133 Ga0105238_10146571 3300009551 Bacteria 2337
134 Ga0105238_10464789 3300009551 Bacteria 1263
135 Ga0105238_11835058 3300009551 Bacteria 639
136 Ga0105249_10101727 3300009553 Bacteria 2703
137 Ga0105249_12603226 3300009553 Bacteria 578
138 Ga0105239_10066882 3300010375 Bacteria 3947
139 Ga0105239_10240544 3300010375 Bacteria 2032
140 Ga0105239_10273914 3300010375 Bacteria 1899
141 Ga0105246_10862592 3300011119 Bacteria 809
142 Ga0105246_10977846 3300011119 Bacteria 765
143 Ga0157343_1011842 3300012488 Bacteria 682
144 Ga0157371_10188884 3300013102 Bacteria 1475
145 Ga0157371_11184689 3300013102 Bacteria 588
146 Ga0157370_10435739 3300013104 Bacteria 1205
147 Ga0157369_10137192 3300013105 Bacteria 2589
148 Ga0157369_10328217 3300013105 Bacteria 1590
149 Ga0157369_11003227 3300013105 Bacteria 855
150 Ga0157369_11135849 3300013105 Bacteria 798
151 Ga0157374_10286378 3300013296 Bacteria 1627
152 Ga0163162_10098296 3300013306 Bacteria 3016
153 Ga0163162_10196025 3300013306 Bacteria 2148
154 Ga0163162_10660496 3300013306 Bacteria 1169
155 Ga0163162_11880622 3300013306 Bacteria 685
156 Ga0163162_11917934 3300013306 Bacteria 678
157 Ga0157372_10000123 3300013307 Bacteria 83350
158 Ga0157372_10602010 3300013307 Bacteria 1281
159 Ga0157372_11215871 3300013307 Bacteria 871
160 Ga0157372_11983875 3300013307 Bacteria 669
161 Ga0157375_10063855 3300013308 Bacteria 3665
162 Ga0157375_10092910 3300013308 Bacteria 3082
163 Ga0157375_10305162 3300013308 Bacteria 1756
164 Ga0157375_11536604 3300013308 Bacteria 786
165 Ga0157375_12060267 3300013308 Bacteria 679
166 Ga0157375_12604607 3300013308 Bacteria 604
167 Ga0157375_13172144 3300013308 Bacteria 548
168 Ga0163163_10216503 3300014325 Bacteria 1964
169 Ga0163163_10461282 3300014325 Bacteria 1331
170 Ga0163163_10491196 3300014325 Bacteria 1289
171 Ga0163163_11720925 3300014325 Bacteria 688
172 Ga0163163_12253266 3300014325 Bacteria 604
173 Ga0163163_12517712 3300014325 Bacteria 572
174 Ga0163163_13025764 3300014325 Bacteria 524
175 Ga0157380_10455749 3300014326 Bacteria 1230
176 Ga0157380_10680704 3300014326 Bacteria 1031
177 Ga0157380_12310469 3300014326 Bacteria 602
178 Ga0157377_10362697 3300014745 Bacteria 976
179 Ga0157379_10911591 3300014968 Bacteria 834
180 Ga0157376_10715763 3300014969 Bacteria 1007
181 Ga0157376_10772182 3300014969 Bacteria 972
182 Ga0157376_11570818 3300014969 Bacteria 692
183 Ga0163161_10525037 3300017792 Bacteria 967
184 Ga0163161_10958578 3300017792 Bacteria 728
185 Ga0206354_11138012 3300020081 Bacteria 697
186 Ga0206353_10784518 3300020082 Bacteria 1044
187 Ga0206353_11703250 3300020082 Bacteria 1155
188 Ga0213875_10040024 3300021388 Bacteria 2207
189 Ga0213875_10238549 3300021388 Bacteria 857
190 Ga0213875_10324379 3300021388 Bacteria 730
191 Ga0224712_10211468 3300022467 Bacteria 885
192 Ga0207697_10320354 3300025315 Bacteria 688
193 Ga0207692_10223964 3300025898 Bacteria 1116
194 Ga0207688_10425227 3300025901 Bacteria 826
195 Ga0207688_10628843 3300025901 Bacteria 677
196 Ga0207680_10478386 3300025903 Bacteria 886
197 Ga0207647_10047505 3300025904 Bacteria 2669
198 Ga0207647_10141123 3300025904 Bacteria 1412
199 Ga0207685_10290159 3300025905 Bacteria 806
200 Ga0207699_10485617 3300025906 Bacteria 890
201 Ga0207643_10621628 3300025908 Bacteria 696
202 Ga0207705_11048221 3300025909 Bacteria 629
203 Ga0207684_10164984 3300025910 Bacteria 1908
204 Ga0207654_10521045 3300025911 Bacteria 842
205 Ga0207695_10298701 3300025913 Bacteria 1502
206 Ga0207671_11588240 3300025914 Bacteria 503
207 Ga0207693_10085606 3300025915 Bacteria 2469
208 Ga0207693_10382654 3300025915 Bacteria 1100
209 Ga0207663_10956147 3300025916 Bacteria 686
210 Ga0207662_10069697 3300025918 Bacteria 2125
211 Ga0207662_10253327 3300025918 Bacteria 1156
212 Ga0207657_10030115 3300025919 Bacteria 4931
213 Ga0207649_10320886 3300025920 Bacteria 1138
214 Ga0207649_10867356 3300025920 Bacteria 707
215 Ga0207652_11677771 3300025921 Bacteria 540
216 Ga0207681_11608290 3300025923 Bacteria 544
217 Ga0207694_10246338 3300025924 Bacteria 1461
218 Ga0207694_10431523 3300025924 Bacteria 1098
219 Ga0207687_10096703 3300025927 Bacteria 2165
220 Ga0207687_10450104 3300025927 Bacteria 1068
221 Ga0207687_10751936 3300025927 Bacteria 830
222 Ga0207700_10006621 3300025928 Bacteria 7020
223 Ga0207664_10032117 3300025929 Bacteria 4022
224 Ga0207664_10227675 3300025929 Bacteria 1619
225 Ga0207644_11455556 3300025931 Bacteria 575
226 Ga0207706_11382855 3300025933 Bacteria 579
227 Ga0207686_10814022 3300025934 Bacteria 749
228 Ga0207686_11194496 3300025934 Bacteria 622
229 Ga0207709_10823771 3300025935 Bacteria 750
230 Ga0207669_10378173 3300025937 Bacteria 1103
231 Ga0207704_10205896 3300025938 Bacteria 1444
232 Ga0207704_11789288 3300025938 Bacteria 528
233 Ga0207665_10038727 3300025939 Bacteria 3176
234 Ga0207661_10022270 3300025944 Bacteria 4768
235 Ga0207661_10080808 3300025944 Bacteria 2683
236 Ga0207661_10569022 3300025944 Bacteria 1039
237 Ga0207679_10149892 3300025945 Bacteria 1897
238 Ga0207679_10247084 3300025945 Bacteria 1515
239 Ga0207679_11161182 3300025945 Bacteria 708
240 Ga0207667_10028269 3300025949 Bacteria 6092
241 Ga0207667_10087055 3300025949 Bacteria 3232
242 Ga0207667_11825913 3300025949 Bacteria 571
243 Ga0207712_10382181 3300025961 Bacteria 1179
244 Ga0207640_10246556 3300025981 Bacteria 1384
245 Ga0207640_11321741 3300025981 Bacteria 644
246 Ga0207658_10946151 3300025986 Bacteria 785
247 Ga0207677_10590047 3300026023 Bacteria 974
248 Ga0207703_10241469 3300026035 Bacteria 1624
249 Ga0207703_11149589 3300026035 Bacteria 746
250 Ga0207703_11559466 3300026035 Bacteria 635
251 Ga0207678_10435382 3300026067 Bacteria 1138
252 Ga0207678_10671168 3300026067 Bacteria 911
253 Ga0207678_11148941 3300026067 Bacteria 688
254 Ga0207708_10486792 3300026075 Bacteria 1032
255 Ga0207702_10135275 3300026078 Bacteria 2223
256 Ga0207702_10136624 3300026078 Bacteria 2213
257 Ga0207702_10475512 3300026078 Bacteria 1215
258 Ga0207702_10507720 3300026078 Bacteria 1176
259 Ga0207702_11705191 3300026078 Bacteria 623
260 Ga0207641_10835741 3300026088 Bacteria 912
261 Ga0207676_10200729 3300026095 Bacteria 1762
262 Ga0207674_11200070 3300026116 Bacteria 728
263 Ga0207675_100258670 3300026118 Bacteria 1686
264 Ga0207683_10019524 3300026121 Bacteria 5788
265 Ga0207683_10331711 3300026121 Bacteria 1394
266 Ga0207683_10951875 3300026121 Bacteria 797
267 Ga0207683_11684121 3300026121 Bacteria 583
268 Ga0207683_11930677 3300026121 Bacteria 539
269 Ga0207698_10623327 3300026142 Bacteria 1066
270 Ga0207698_10782045 3300026142 Bacteria 955
271 Ga0207698_11630341 3300026142 Bacteria 661
272 Ga0207698_11751445 3300026142 Bacteria 637
273 Ga0268266_10021956 3300028379 Bacteria 5440
274 Ga0268266_10354549 3300028379 Bacteria 1379
275 Ga0268266_10441782 3300028379 Bacteria 1236
276 Ga0268265_11094367 3300028380 Bacteria 791
277 Ga0307517_10087877 3300028786 Bacteria 2577
278 Ga0307515_10229481 3300028794 Bacteria 1653
279 Ga0307515_10694527 3300028794 Bacteria 633
280 Ga0307513_10438339 3300031456 Bacteria 1033
281 Ga0307509_10159330 3300031507 Bacteria 2158
282 Ga0307508_10130910 3300031616 Bacteria 2112
283 Ga0307405_11181219 3300031731 Bacteria 661
284 Ga0307413_10177625 3300031824 Bacteria 1514
285 Ga0307413_10334850 3300031824 Bacteria 1162
286 Ga0307410_10593822 3300031852 Bacteria 923
287 Ga0307406_10058765 3300031901 Bacteria 2472
288 Ga0307406_11256910 3300031901 Bacteria 645
289 Ga0307406_11395299 3300031901 Bacteria 614
290 Ga0307406_11570389 3300031901 Bacteria 581
291 Ga0307407_10528372 3300031903 Bacteria 869
292 Ga0307407_11111749 3300031903 Bacteria 615
293 Ga0307412_10398278 3300031911 Bacteria 1120
294 Ga0307416_100171065 3300032002 Bacteria 2022
295 Ga0307414_11995761 3300032004 Bacteria 542
296 Ga0307415_100113418 3300032126 Bacteria 2016
297 Ga0307415_100498998 3300032126 Bacteria 1064
298 Ga0307507_10173008 3300033179 Bacteria 1564
299 Ga0373926_0277943 3300035083 Bacteria 652
300 Ga0373944_0098413 3300035089 Bacteria 986
301 Ga0373923_0048690 3300035111 Bacteria 1770
302 Ga0373936_0043920 3300035113 Bacteria 1797
303 Ga0373954_0044920 3300035118 Bacteria 2063
304 Ga0373956_0002152 3300035119 Bacteria 8142
305 Ga0373957_0027648 3300035120 Bacteria 2061
306 Ga0373943_0212136 3300035170 Bacteria 1076
307 Ga0373955_0068220 3300035172 Bacteria 1981
308 Ga0373924_0003360 3300035410 Bacteria 5496
309 Ga0373931_0429550 3300035691 Bacteria 841
310 Ga0373933_0000467 3300035724 Bacteria 25272
311 Ga0373947_0068714 3300035725 Bacteria 2167
312 Ga0373947_0094944 3300035725 Bacteria 1866
313 Ga0373937_0004282 3300036401 Bacteria 12091
314 Ga0372808_006475 3300036459 Bacteria 1579
315 Ga0373925_0462713 3300037068 Bacteria 1039
316 Ga0395899_0126641 3300037312 Bacteria 1826
317 Ga0395898_1038426 3300037466 Bacteria 754
318 Ga0436364_0033670 3300037853 Bacteria 2208
319 Ga0436364_0226122 3300037853 Bacteria 519
320 Ga0436364_0534556 3300037853 Bacteria 2439
321 Ga0436364_0808660 3300037853 Bacteria 687
322 Ga0395901_0159029 3300038443 Bacteria 2372
323 Ga0395901_1126341 3300038443 Bacteria 754
324 Ga0242420_051785 3300038996 Bacteria 804
325 Ga0436363_1185957 3300039450 Bacteria 677
326 Ga0451789_0114893 3300041443 Bacteria 818
327 Ga0451789_1061075 3300041443 Bacteria 580
328 Ga0451793_1363888 3300041452 Bacteria 3691
329 Ga0451793_1888304 3300041452 Bacteria 627
330 Ga0451797_1007502 3300041453 Bacteria 2023
331 Ga0451797_1073397 3300041453 Bacteria 511
332 Ga0451795_0564621 3300041456 Bacteria 1590
333 Ga0451795_1447924 3300041456 Bacteria 631
334 Ga0451800_0480215 3300041459 Bacteria 780
335 Ga0451807_0741158 3300041486 Bacteria 778
336 Ga0451833_1106133 3300041491 Bacteria 513
337 Ga0451839_0263778 3300041496 Bacteria 507
338 Ga0451839_0691447 3300041496 Bacteria 1472
339 Ga0451839_0781426 3300041496 Bacteria 618
340 Ga0451841_0761344 3300041498 Bacteria 1352
341 Ga0451849_0996445 3300041505 Bacteria 1573
342 Ga0451843_0550863 3300041509 Bacteria 5677
343 Ga0451855_0984818 3300041511 Bacteria 754
344 Ga0451853_1384838 3300041512 Bacteria 4764
345 Ga0451853_3876009 3300041512 Bacteria 550
346 Ga0466969_0289023 3300044656 Bacteria 742
347 Ga0466972_0002240 3300044658 Bacteria 9505
348 Ga0466965_0000003 3300044683 Bacteria 265985
349 Ga0466965_0027518 3300044683 Bacteria 2761
350 Ga0466966_0052309 3300044684 Bacteria 2595
351 Ga0466966_0237162 3300044684 Bacteria 1100
352 Ga0466966_0427585 3300044684 Bacteria 796
353 Ga0466961_0031502 3300044693 Bacteria 3409
354 Ga0466961_0053936 3300044693 Bacteria 2565
355 Ga0466963_0017571 3300044694 Bacteria 4460
356 Ga0466963_0360957 3300044694 Bacteria 1023
357 Ga0466963_0944448 3300044694 Bacteria 607
358 Ga0466964_0080688 3300044706 Bacteria 1396
359 Ga0466964_0096960 3300044706 Bacteria 1293
360 Ga0466964_0640875 3300044706 Bacteria 587
361 Ga0466971_0002597 3300044719 Bacteria 7640
362 Ga0466968_0010062 3300044735 Bacteria 3656
363 Ga0466970_0627453 3300044765 Bacteria 624
364 Ga0466957_0005581 3300044842 Bacteria 7066
365 Ga0466957_0271237 3300044842 Bacteria 1133
366 Ga0466957_0530903 3300044842 Bacteria 818
367 Ga0466957_0617163 3300044842 Bacteria 760
368 Ga0466960_0141020 3300044901 Bacteria 1280
369 Ga0466959_0003017 3300045049 Bacteria 10876
370 Ga0466959_0010900 3300045049 Bacteria 6517
371 Ga0466959_0052008 3300045049 Bacteria 3002
372 Ga0466959_0158830 3300045049 Bacteria 1590
373 Ga0466958_0016425 3300045836 Bacteria 4262
374 Ga0466958_0027033 3300045836 Bacteria 3394
375 Ga0466958_0884638 3300045836 Bacteria 583
376 Ga0466967_0452415 3300045976 Bacteria 1255
377 Ga0495592_0008817 3300046454 Bacteria 7574
378 Ga0495592_0139356 3300046454 Bacteria 1689
379 Ga0495603_0128016 3300046455 Bacteria 1479
380 Ga0495629_0200624 3300046459 Bacteria 1379
381 Ga0495641_0042112 3300046461 Bacteria 2118
382 Ga0495651_0000424 3300046462 Bacteria 32646
383 Ga0495651_0213338 3300046462 Bacteria 1341
384 Ga0495653_0016012 3300046463 Bacteria 6111
385 Ga0495582_0147830 3300046473 Bacteria 1333
386 Ga0495639_0198339 3300046475 Bacteria 982
387 Ga0495639_0622613 3300046475 Bacteria 555
388 Ga0495662_0029740 3300046476 Bacteria 2636
389 Ga0495664_0062694 3300046477 Bacteria 2214
390 Ga0495664_0770264 3300046477 Bacteria 566
391 Ga0495594_0761522 3300046499 Bacteria 546
392 Ga0495608_0007454 3300046511 Bacteria 7729
393 Ga0495618_0009032 3300046514 Bacteria 6014
394 Ga0495628_0033351 3300046516 Bacteria 4151
395 Ga0495628_0147416 3300046516 Bacteria 1793
396 Ga0495630_0056342 3300046517 Bacteria 2945
397 Ga0495652_0000573 3300046529 Bacteria 42990
398 Ga0495652_0192418 3300046529 Bacteria 1555
399 Ga0495652_0749716 3300046529 Bacteria 653
400 Ga0495665_0548293 3300046531 Bacteria 580
401 Ga0495640_0005327 3300046533 Bacteria 10227
402 Ga0495587_0255675 3300046536 Bacteria 984
403 Ga0495645_0128078 3300046543 Bacteria 1782
404 Ga0495645_0174846 3300046543 Bacteria 1475
405 Ga0495645_0238798 3300046543 Bacteria 1213
406 Ga0495667_0001456 3300046559 Bacteria 15577
407 Ga0495667_0352380 3300046559 Bacteria 930
408 Ga0495667_0729173 3300046559 Bacteria 613
409 Ga0495634_0022031 3300046642 Bacteria 4493
410 Ga0495634_0406793 3300046642 Bacteria 808
411 Ga0495635_0048291 3300046663 Bacteria 2934
412 Ga0495635_0386321 3300046663 Bacteria 931
413 Ga0495588_0349221 3300046674 Bacteria 777
414 Ga0495657_0004269 3300046675 Bacteria 11426
415 Ga0495599_0003470 3300046678 Bacteria 9229
416 Ga0495599_0339673 3300046678 Bacteria 902
417 Ga0495646_0015104 3300046680 Bacteria 4905
418 Ga0495646_0670050 3300046680 Bacteria 523
419 Ga0495613_0204458 3300046689 Bacteria 1391
420 Ga0495600_0002578 3300046809 Bacteria 10440
421 Ga0495600_0374397 3300046809 Bacteria 889
422 Ga0495581_0025564 3300047315 Bacteria 3424
423 Ga0495604_0007008 3300047317 Bacteria 8934
424 Ga0495604_0070158 3300047317 Bacteria 2654
425 Ga0495604_0595664 3300047317 Bacteria 709
426 Ga0495674_0208247 3300047319 Bacteria 1620
427 Ga0495674_1488979 3300047319 Bacteria 501
428 Ga0495680_0005001 3300047322 Bacteria 12538
429 Ga0495675_0008107 3300047444 Bacteria 6501
430 Ga0495684_0023087 3300047471 Bacteria 4784
431 Ga0495684_0201868 3300047471 Bacteria 1465
432 Ga0495593_0025411 3300047673 Bacteria 3278
433 Ga0495602_0043423 3300048088 Bacteria 4087
434 Ga0495614_0089254 3300048089 Bacteria 1340
435 Ga0496100_0011668 3300048903 Bacteria 5008
436 Ga0496100_0077541 3300048903 Bacteria 2234
437 Ga0496100_0190479 3300048903 Bacteria 1489
438 Ga0496100_0493225 3300048903 Bacteria 943
439 Ga0496101_0007767 3300048904 Bacteria 6971
440 Ga0496101_0018299 3300048904 Bacteria 4762
441 Ga0496101_0218640 3300048904 Bacteria 1478
442 Ga0496101_1280952 3300048904 Bacteria 573
443 Ga0496102_0005237 3300048905 Bacteria 11008
444 Ga0496102_0017166 3300048905 Bacteria 6338
445 Ga0496102_0088358 3300048905 Bacteria 2865
446 Ga0496102_0153363 3300048905 Bacteria 2165
447 Ga0496102_0691661 3300048905 Bacteria 943
448 Ga0496103_0020975 3300048906 Bacteria 3929
449 Ga0496103_0091521 3300048906 Bacteria 1919
450 Ga0496103_0733135 3300048906 Bacteria 625
451 Ga0496103_0941696 3300048906 Bacteria 540
452 Ga0496104_0011267 3300048907 Bacteria 8003
453 Ga0496104_0025980 3300048907 Bacteria 5400
454 Ga0496104_0050371 3300048907 Bacteria 3929
455 Ga0496104_0637502 3300048907 Bacteria 975
456 Ga0496104_1086371 3300048907 Bacteria 704
457 Ga0496104_1229777 3300048907 Bacteria 652
458 Ga0496105_0000987 3300048908 Bacteria 19605
459 Ga0496105_0001487 3300048908 Bacteria 16545
460 Ga0496105_0037868 3300048908 Bacteria 3973
461 Ga0496105_0062755 3300048908 Bacteria 3066
462 Ga0496105_0076184 3300048908 Bacteria 2770
463 Ga0496105_0479976 3300048908 Bacteria 978
464 Ga0496105_1110087 3300048908 Bacteria 587
465 Ga0496106_0028565 3300048909 Bacteria 4155
466 Ga0496106_0273092 3300048909 Bacteria 1354
467 Ga0496106_0339153 3300048909 Bacteria 1207
468 Ga0496106_0760672 3300048909 Bacteria 770
469 Ga0496106_1112228 3300048909 Bacteria 619
470 Ga0496107_0084786 3300048910 Bacteria 2312
471 Ga0496107_0376425 3300048910 Bacteria 1056
472 Ga0496107_0484857 3300048910 Bacteria 917
473 Ga0496107_0555235 3300048910 Bacteria 850
474 Ga0496107_0566122 3300048910 Bacteria 841
475 Ga0496107_0960636 3300048910 Bacteria 621
476 Ga0496108_0016673 3300048911 Bacteria 6001
477 Ga0496108_0034779 3300048911 Bacteria 4186
478 Ga0496108_0046940 3300048911 Bacteria 3610
479 Ga0496108_0701646 3300048911 Bacteria 877
480 Ga0496109_0014871 3300048912 Bacteria 6772
481 Ga0496109_0027997 3300048912 Bacteria 5038
482 Ga0496109_0192336 3300048912 Bacteria 1917
483 Ga0496109_0275503 3300048912 Bacteria 1585
484 Ga0496109_0826834 3300048912 Bacteria 864
485 Ga0496109_1319780 3300048912 Bacteria 657
486 Ga0496109_1859614 3300048912 Bacteria 535
487 Ga0496110_0012988 3300048913 Bacteria 6869
488 Ga0496110_0023891 3300048913 Bacteria 5204
489 Ga0496110_0067046 3300048913 Bacteria 3175
490 Ga0496110_0770476 3300048913 Bacteria 866
491 Ga0496110_0774559 3300048913 Bacteria 863
492 Ga0496110_0786753 3300048913 Bacteria 855
493 Ga0496111_0017497 3300048914 Bacteria 4956
494 Ga0496111_0020929 3300048914 Bacteria 4561
495 Ga0496111_0072632 3300048914 Bacteria 2504
496 Ga0496111_1157743 3300048914 Bacteria 549
497 Ga0496112_0001908 3300048915 Bacteria 16451
498 Ga0496112_0024686 3300048915 Bacteria 5762
499 Ga0496112_0600883 3300048915 Bacteria 1032
500 Ga0496112_1209764 3300048915 Bacteria 672
501 Ga0496113_0020528 3300048916 Bacteria 4646
502 Ga0496113_0183034 3300048916 Bacteria 1661
503 Ga0496113_0321476 3300048916 Bacteria 1240
504 Ga0496114_0003588 3300048917 Bacteria 11923
505 Ga0496114_0007081 3300048917 Bacteria 8850
506 Ga0496114_0010348 3300048917 Bacteria 7421
507 Ga0496114_0056388 3300048917 Bacteria 3279
508 Ga0496114_0095672 3300048917 Bacteria 2528
509 Ga0496114_0305564 3300048917 Bacteria 1405
510 Ga0496114_0549214 3300048917 Bacteria 1021
511 Ga0496114_0738556 3300048917 Bacteria 861
512 Ga0496114_0875287 3300048917 Bacteria 779
513 Ga0496114_1135113 3300048917 Bacteria 667
514 Ga0496114_1430400 3300048917 Bacteria 579
515 Ga0496114_1448786 3300048917 Bacteria 574
516 Ga0496114_1764171 3300048917 Bacteria 507
517 Ga0496115_0231180 3300048918 Bacteria 1525
518 Ga0496126_0456924 3300048929 Bacteria 1027
519 Ga0501034_0114904 3300049571 Bacteria 2680
520 Ga0501040_1090376 3300049576 Bacteria 579
521 Ga0501067_0053080 3300049583 Bacteria 2246
522 Ga0501068_0118815 3300049584 Bacteria 1647
523 Ga0501069_0033958 3300049585 Bacteria 2810
524 Ga0501045_0143225 3300049824 Bacteria 1778
525 nmdc:mga03n38_30463_c1 3300050490 Bacteria 2269
526 nmdc:mga00v17_76444_c1 3300050491 Bacteria 2083
527 nmdc:mga06z11_32578_c1 3300050494 Bacteria 2543
528 nmdc:mga04h51_20444_c1 3300050495 Bacteria 1977
529 nmdc:mga05p37_1271663_c1 3300050507 Bacteria 753
530 nmdc:mga05p37_225573_c1 3300050507 Bacteria 2259
531 nmdc:mga09592_822492_c1 3300050508 Bacteria 785
532 nmdc:mga0qj67_524565_c1 3300050509 Bacteria 951
533 nmdc:mga0n895_612536_c1 3300050512 Bacteria 1090
534 nmdc:mga0n895_87868_c1 3300050512 Bacteria 3107
535 nmdc:mga0rr50_192639_c1 3300050513 Bacteria 1672
536 nmdc:mga0rr50_212576_c1 3300050513 Bacteria 1594
537 nmdc:mga08x19_568526_c1 3300050514 Bacteria 803
538 nmdc:mga08x19_819724_c1 3300050514 Bacteria 661
539 nmdc:mga0a205_164790_c1 3300050515 Bacteria 2112
540 Ga0495601_0047053 3300053077 Bacteria 2715
541 Ga0495601_0176540 3300053077 Bacteria 1396
542 Ga0495601_0192802 3300053077 Bacteria 1332
543 Ga0495612_0039973 3300053078 Bacteria 1909
544 Ga0500635_0000073 3300053080 Bacteria 65023
545 Ga0495619_0073284 3300053085 Bacteria 2294
546 Ga0495619_0420434 3300053085 Bacteria 922
547 Ga0500644_0000299 3300053088 Bacteria 26587
548 Ga0500644_0446015 3300053088 Bacteria 567
549 Ga0500654_207985 3300053099 Bacteria 578
550 Ga0500556_0001027 3300053104 Bacteria 14597
551 Ga0500628_030718 3300053129 Bacteria 1164
552 Ga0500628_190598 3300053129 Bacteria 588
553 Ga0500573_0113042 3300053140 Bacteria 1518
554 Ga0500616_0000097 3300053153 Bacteria 178988
555 Ga0466962_0008377 3300061719 Bacteria 4955
556 Ga0466962_0193689 3300061719 Bacteria 992

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1126341 Ga0395901_1126341_419_739 98
2 3300014325 Ga0163163_13025764 Ga0163163_130257642 102
3 3300026067 Ga0207678_11148941 Ga0207678_111489412 102
4 iso_pu_bacteria 2919051321 2919053957 103
5 3300009177 Ga0105248_13237847 Ga0105248_132378472 106
6 3300021388 Ga0213875_10324379 Ga0213875_103243792 106
7 3300025981 Ga0207640_10246556 Ga0207640_102465561 106
8 3300028379 Ga0268266_10021956 Ga0268266_100219566 106
9 3300028786 Ga0307517_10087877 Ga0307517_100878771 106
10 3300031824 Ga0307413_10177625 Ga0307413_101776252 106
11 3300031852 Ga0307410_10593822 Ga0307410_105938222 106
12 3300031901 Ga0307406_10058765 Ga0307406_100587654 106
13 3300031901 Ga0307406_11256910 Ga0307406_112569101 106
14 3300031903 Ga0307407_10528372 Ga0307407_105283722 106
15 3300031911 Ga0307412_10398278 Ga0307412_103982782 106
16 3300032002 Ga0307416_100171065 Ga0307416_1001710652 106
17 3300032004 Ga0307414_11995761 Ga0307414_119957612 106
18 3300032126 Ga0307415_100113418 Ga0307415_1001134183 106
19 3300032126 Ga0307415_100498998 Ga0307415_1004989982 106
20 3300037853 Ga0436364_0226122 Ga0436364_0226122_56_400 106
21 3300037853 Ga0436364_0808660 Ga0436364_0808660_191_526 106
22 3300039450 Ga0436363_1185957 Ga0436363_1185957_317_652 106
23 3300041453 Ga0451797_1073397 Ga0451797_1073397_71_406 106
24 3300044683 Ga0466965_0000003 Ga0466965_0000003_98788_99120 106
25 3300049571 Ga0501034_0114904 Ga0501034_0114904_2164_2493 106
26 3300053088 Ga0500644_0446015 Ga0500644_0446015_188_523 106
27 3300053129 Ga0500628_190598 Ga0500628_190598_201_536 106
28 3300001990 JGI24737J22298_10089321 JGI24737J22298_100893211 107
29 3300002067 JGI24735J21928_10018658 JGI24735J21928_100186582 107
30 3300002075 JGI24738J21930_10139294 JGI24738J21930_101392942 107
31 3300003320 rootH2_10106357 rootH2_101063572 107
32 3300003373 JGI25407J50210_10001381 JGI25407J50210_100013812 107
33 3300003373 JGI25407J50210_10034201 JGI25407J50210_100342012 107
34 3300005327 Ga0070658_10490348 Ga0070658_104903482 107
35 3300005329 Ga0070683_100018203 Ga0070683_1000182037 107
36 3300005329 Ga0070683_100329420 Ga0070683_1003294203 107
37 3300005329 Ga0070683_101561600 Ga0070683_1015616001 107
38 3300005334 Ga0068869_100536724 Ga0068869_1005367242 107
39 3300005335 Ga0070666_10445098 Ga0070666_104450982 107
40 3300005337 Ga0070682_100261076 Ga0070682_1002610762 107
41 3300005337 Ga0070682_100420290 Ga0070682_1004202902 107
42 3300005337 Ga0070682_100652070 Ga0070682_1006520703 107
43 3300005338 Ga0068868_100423657 Ga0068868_1004236573 107
44 3300005338 Ga0068868_100499768 Ga0068868_1004997682 107
45 3300005339 Ga0070660_100019265 Ga0070660_1000192653 107
46 3300005343 Ga0070687_100055860 Ga0070687_1000558602 107
47 3300005343 Ga0070687_100464536 Ga0070687_1004645362 107
48 3300005344 Ga0070661_101271682 Ga0070661_1012716821 107
49 3300005345 Ga0070692_10008668 Ga0070692_100086682 107
50 3300005355 Ga0070671_100962308 Ga0070671_1009623081 107
51 3300005365 Ga0070688_100690477 Ga0070688_1006904771 107
52 3300005366 Ga0070659_100230134 Ga0070659_1002301343 107
53 3300005435 Ga0070714_100315223 Ga0070714_1003152232 107
54 3300005436 Ga0070713_100025848 Ga0070713_1000258486 107
55 3300005437 Ga0070710_10124001 Ga0070710_101240012 107
56 3300005439 Ga0070711_100444722 Ga0070711_1004447222 107
57 3300005439 Ga0070711_100502576 Ga0070711_1005025762 107
58 3300005441 Ga0070700_100339430 Ga0070700_1003394301 107
59 3300005441 Ga0070700_101663568 Ga0070700_1016635681 107
60 3300005444 Ga0070694_101128766 Ga0070694_1011287662 107
61 3300005455 Ga0070663_100901091 Ga0070663_1009010911 107
62 3300005456 Ga0070678_100046584 Ga0070678_1000465842 107
63 3300005456 Ga0070678_100601518 Ga0070678_1006015182 107
64 3300005456 Ga0070678_101006260 Ga0070678_1010062601 107
65 3300005456 Ga0070678_101441205 Ga0070678_1014412051 107
66 3300005457 Ga0070662_100180012 Ga0070662_1001800122 107
67 3300005458 Ga0070681_11923662 Ga0070681_119236621 107
68 3300005459 Ga0068867_100266791 Ga0068867_1002667911 107
69 3300005459 Ga0068867_100705570 Ga0068867_1007055701 107
70 3300005466 Ga0070685_11126139 Ga0070685_111261391 107
71 3300005466 Ga0070685_11503795 Ga0070685_115037951 107
72 3300005467 Ga0070706_100822227 Ga0070706_1008222272 107
73 3300005530 Ga0070679_102026395 Ga0070679_1020263951 107
74 3300005535 Ga0070684_100112035 Ga0070684_1001120352 107
75 3300005535 Ga0070684_100364598 Ga0070684_1003645982 107
76 3300005535 Ga0070684_100395067 Ga0070684_1003950672 107
77 3300005535 Ga0070684_100926536 Ga0070684_1009265362 107
78 3300005539 Ga0068853_100178734 Ga0068853_1001787343 107
79 3300005539 Ga0068853_101857185 Ga0068853_1018571852 107
80 3300005543 Ga0070672_100543988 Ga0070672_1005439882 107
81 3300005544 Ga0070686_100889692 Ga0070686_1008896922 107
82 3300005547 Ga0070693_100192950 Ga0070693_1001929502 107
83 3300005548 Ga0070665_100336579 Ga0070665_1003365792 107
84 3300005548 Ga0070665_101051974 Ga0070665_1010519741 107
85 3300005549 Ga0070704_101302327 Ga0070704_1013023271 107
86 3300005563 Ga0068855_100016350 Ga0068855_1000163507 107
87 3300005563 Ga0068855_100871713 Ga0068855_1008717132 107
88 3300005563 Ga0068855_101611243 Ga0068855_1016112432 107
89 3300005564 Ga0070664_100120263 Ga0070664_1001202632 107
90 3300005564 Ga0070664_101754262 Ga0070664_1017542622 107
91 3300005614 Ga0068856_100068034 Ga0068856_1000680342 107
92 3300005614 Ga0068856_100513810 Ga0068856_1005138102 107
93 3300005614 Ga0068856_100892743 Ga0068856_1008927431 107
94 3300005614 Ga0068856_101022472 Ga0068856_1010224722 107
95 3300005615 Ga0070702_100446774 Ga0070702_1004467741 107
96 3300005615 Ga0070702_100551342 Ga0070702_1005513422 107
97 3300005615 Ga0070702_101024491 Ga0070702_1010244911 107
98 3300005615 Ga0070702_101113078 Ga0070702_1011130781 107
99 3300005616 Ga0068852_100118122 Ga0068852_1001181222 107
100 3300005616 Ga0068852_100804997 Ga0068852_1008049971 107
101 3300005616 Ga0068852_102816450 Ga0068852_1028164502 107
102 3300005618 Ga0068864_100278366 Ga0068864_1002783662 107
103 3300005718 Ga0068866_10571532 Ga0068866_105715322 107
104 3300005840 Ga0068870_11203159 Ga0068870_112031592 107
105 3300005842 Ga0068858_100301419 Ga0068858_1003014192 107
106 3300005843 Ga0068860_100136066 Ga0068860_1001360662 107
107 3300005937 Ga0081455_10088822 Ga0081455_100888224 107
108 3300005981 Ga0081538_10001721 Ga0081538_1000172112 107
109 3300005981 Ga0081538_10162566 Ga0081538_101625661 107
110 3300005983 Ga0081540_1006883 Ga0081540_10068832 107
111 3300005983 Ga0081540_1184967 Ga0081540_11849672 107
112 3300006028 Ga0070717_10156835 Ga0070717_101568352 107
113 3300006028 Ga0070717_10159086 Ga0070717_101590862 107
114 3300006048 Ga0075363_100007636 Ga0075363_1000076365 107
115 3300006048 Ga0075363_100354028 Ga0075363_1003540282 107
116 3300006051 Ga0075364_10054319 Ga0075364_100543193 107
117 3300006163 Ga0070715_10239027 Ga0070715_102390271 107
118 3300006173 Ga0070716_100006634 Ga0070716_1000066348 107
119 3300006173 Ga0070716_101211553 Ga0070716_1012115531 107
120 3300006178 Ga0075367_10007311 Ga0075367_100073114 107
121 3300006237 Ga0097621_100449730 Ga0097621_1004497303 107
122 3300006237 Ga0097621_100901207 Ga0097621_1009012071 107
123 3300006353 Ga0075370_10170256 Ga0075370_101702562 107
124 3300006358 Ga0068871_100172135 Ga0068871_1001721352 107
125 3300006358 Ga0068871_101311603 Ga0068871_1013116032 107
126 3300006844 Ga0075428_100202463 Ga0075428_1002024633 107
127 3300006847 Ga0075431_100559060 Ga0075431_1005590601 107
128 3300006852 Ga0075433_10226844 Ga0075433_102268442 107
129 3300006871 Ga0075434_100169029 Ga0075434_1001690292 107
130 3300006871 Ga0075434_101715275 Ga0075434_1017152751 107
131 3300006880 Ga0075429_101014354 Ga0075429_1010143542 107
132 3300006881 Ga0068865_100164768 Ga0068865_1001647682 107
133 3300006881 Ga0068865_101041383 Ga0068865_1010413832 107
134 3300006914 Ga0075436_100826849 Ga0075436_1008268492 107
135 3300007076 Ga0075435_100306903 Ga0075435_1003069032 107
136 3300007076 Ga0075435_100561888 Ga0075435_1005618882 107
137 3300009011 Ga0105251_10325299 Ga0105251_103252992 107
138 3300009093 Ga0105240_10037410 Ga0105240_100374104 107
139 3300009098 Ga0105245_10028880 Ga0105245_100288803 107
140 3300009098 Ga0105245_10320557 Ga0105245_103205572 107
141 3300009098 Ga0105245_10415152 Ga0105245_104151522 107
142 3300009101 Ga0105247_11467829 Ga0105247_114678292 107
143 3300009147 Ga0114129_10288302 Ga0114129_102883021 107
144 3300009147 Ga0114129_11363364 Ga0114129_113633642 107
145 3300009148 Ga0105243_10179176 Ga0105243_101791762 107
146 3300009148 Ga0105243_10247054 Ga0105243_102470542 107
147 3300009148 Ga0105243_10402423 Ga0105243_104024232 107
148 3300009148 Ga0105243_11015668 Ga0105243_110156681 107
149 3300009148 Ga0105243_11759686 Ga0105243_117596862 107
150 3300009174 Ga0105241_10270980 Ga0105241_102709802 107
151 3300009176 Ga0105242_10250443 Ga0105242_102504432 107
152 3300009176 Ga0105242_10727820 Ga0105242_107278201 107
153 3300009177 Ga0105248_10344292 Ga0105248_103442922 107
154 3300009177 Ga0105248_11302315 Ga0105248_113023151 107
155 3300009545 Ga0105237_10122838 Ga0105237_101228382 107
156 3300009545 Ga0105237_10588724 Ga0105237_105887242 107
157 3300009545 Ga0105237_10821519 Ga0105237_108215192 107
158 3300009545 Ga0105237_11086709 Ga0105237_110867091 107
159 3300009551 Ga0105238_10146571 Ga0105238_101465713 107
160 3300009551 Ga0105238_10464789 Ga0105238_104647892 107
161 3300009551 Ga0105238_11835058 Ga0105238_118350582 107
162 3300009553 Ga0105249_10101727 Ga0105249_101017273 107
163 3300009553 Ga0105249_12603226 Ga0105249_126032262 107
164 3300010375 Ga0105239_10066882 Ga0105239_100668823 107
165 3300010375 Ga0105239_10240544 Ga0105239_102405443 107
166 3300010375 Ga0105239_10273914 Ga0105239_102739143 107
167 3300011119 Ga0105246_10862592 Ga0105246_108625922 107
168 3300011119 Ga0105246_10977846 Ga0105246_109778461 107
169 3300012488 Ga0157343_1011842 Ga0157343_10118422 107
170 3300013102 Ga0157371_10188884 Ga0157371_101888842 107
171 3300013102 Ga0157371_11184689 Ga0157371_111846892 107
172 3300013104 Ga0157370_10435739 Ga0157370_104357392 107
173 3300013105 Ga0157369_10137192 Ga0157369_101371921 107
174 3300013105 Ga0157369_10328217 Ga0157369_103282172 107
175 3300013105 Ga0157369_11003227 Ga0157369_110032272 107
176 3300013105 Ga0157369_11135849 Ga0157369_111358492 107
177 3300013296 Ga0157374_10286378 Ga0157374_102863782 107
178 3300013306 Ga0163162_10098296 Ga0163162_100982961 107
179 3300013306 Ga0163162_10196025 Ga0163162_101960252 107
180 3300013306 Ga0163162_10660496 Ga0163162_106604963 107
181 3300013306 Ga0163162_11880622 Ga0163162_118806221 107
182 3300013306 Ga0163162_11917934 Ga0163162_119179342 107
183 3300013307 Ga0157372_10000123 Ga0157372_1000012350 107
184 3300013307 Ga0157372_10602010 Ga0157372_106020103 107
185 3300013307 Ga0157372_11215871 Ga0157372_112158712 107
186 3300013307 Ga0157372_11983875 Ga0157372_119838751 107
187 3300013308 Ga0157375_10063855 Ga0157375_100638554 107
188 3300013308 Ga0157375_10092910 Ga0157375_100929102 107
189 3300013308 Ga0157375_10305162 Ga0157375_103051622 107
190 3300013308 Ga0157375_11536604 Ga0157375_115366042 107
191 3300013308 Ga0157375_12060267 Ga0157375_120602671 107
192 3300013308 Ga0157375_12604607 Ga0157375_126046072 107
193 3300013308 Ga0157375_13172144 Ga0157375_131721442 107
194 3300014325 Ga0163163_10216503 Ga0163163_102165033 107
195 3300014325 Ga0163163_10461282 Ga0163163_104612821 107
196 3300014325 Ga0163163_10491196 Ga0163163_104911961 107
197 3300014325 Ga0163163_11720925 Ga0163163_117209251 107
198 3300014325 Ga0163163_12253266 Ga0163163_122532661 107
199 3300014325 Ga0163163_12517712 Ga0163163_125177121 107
200 3300014326 Ga0157380_10455749 Ga0157380_104557491 107
201 3300014326 Ga0157380_10680704 Ga0157380_106807041 107
202 3300014326 Ga0157380_12310469 Ga0157380_123104691 107
203 3300014745 Ga0157377_10362697 Ga0157377_103626972 107
204 3300014968 Ga0157379_10911591 Ga0157379_109115912 107
205 3300014969 Ga0157376_10715763 Ga0157376_107157631 107
206 3300014969 Ga0157376_10772182 Ga0157376_107721822 107
207 3300014969 Ga0157376_11570818 Ga0157376_115708182 107
208 3300017792 Ga0163161_10525037 Ga0163161_105250372 107
209 3300017792 Ga0163161_10958578 Ga0163161_109585781 107
210 3300020081 Ga0206354_11138012 Ga0206354_111380122 107
211 3300020082 Ga0206353_10784518 Ga0206353_107845182 107
212 3300020082 Ga0206353_11703250 Ga0206353_117032502 107
213 3300021388 Ga0213875_10040024 Ga0213875_100400242 107
214 3300021388 Ga0213875_10238549 Ga0213875_102385492 107
215 3300022467 Ga0224712_10211468 Ga0224712_102114682 107
216 3300025315 Ga0207697_10320354 Ga0207697_103203542 107
217 3300025898 Ga0207692_10223964 Ga0207692_102239641 107
218 3300025901 Ga0207688_10425227 Ga0207688_104252272 107
219 3300025901 Ga0207688_10628843 Ga0207688_106288432 107
220 3300025903 Ga0207680_10478386 Ga0207680_104783862 107
221 3300025904 Ga0207647_10047505 Ga0207647_100475053 107
222 3300025904 Ga0207647_10141123 Ga0207647_101411232 107
223 3300025905 Ga0207685_10290159 Ga0207685_102901591 107
224 3300025906 Ga0207699_10485617 Ga0207699_104856172 107
225 3300025908 Ga0207643_10621628 Ga0207643_106216281 107
226 3300025909 Ga0207705_11048221 Ga0207705_110482212 107
227 3300025910 Ga0207684_10164984 Ga0207684_101649843 107
228 3300025911 Ga0207654_10521045 Ga0207654_105210452 107
229 3300025913 Ga0207695_10298701 Ga0207695_102987011 107
230 3300025914 Ga0207671_11588240 Ga0207671_115882401 107
231 3300025915 Ga0207693_10085606 Ga0207693_100856062 107
232 3300025915 Ga0207693_10382654 Ga0207693_103826542 107
233 3300025916 Ga0207663_10956147 Ga0207663_109561471 107
234 3300025918 Ga0207662_10069697 Ga0207662_100696972 107
235 3300025918 Ga0207662_10253327 Ga0207662_102533271 107
236 3300025919 Ga0207657_10030115 Ga0207657_100301154 107
237 3300025920 Ga0207649_10320886 Ga0207649_103208861 107
238 3300025920 Ga0207649_10867356 Ga0207649_108673562 107
239 3300025921 Ga0207652_11677771 Ga0207652_116777711 107
240 3300025923 Ga0207681_11608290 Ga0207681_116082901 107
241 3300025924 Ga0207694_10246338 Ga0207694_102463382 107
242 3300025924 Ga0207694_10431523 Ga0207694_104315232 107
243 3300025927 Ga0207687_10096703 Ga0207687_100967031 107
244 3300025927 Ga0207687_10450104 Ga0207687_104501042 107
245 3300025927 Ga0207687_10751936 Ga0207687_107519362 107
246 3300025928 Ga0207700_10006621 Ga0207700_100066212 107
247 3300025929 Ga0207664_10032117 Ga0207664_100321172 107
248 3300025929 Ga0207664_10227675 Ga0207664_102276751 107
249 3300025931 Ga0207644_11455556 Ga0207644_114555562 107
250 3300025933 Ga0207706_11382855 Ga0207706_113828552 107
251 3300025934 Ga0207686_10814022 Ga0207686_108140222 107
252 3300025934 Ga0207686_11194496 Ga0207686_111944962 107
253 3300025935 Ga0207709_10823771 Ga0207709_108237711 107
254 3300025937 Ga0207669_10378173 Ga0207669_103781731 107
255 3300025938 Ga0207704_10205896 Ga0207704_102058962 107
256 3300025938 Ga0207704_11789288 Ga0207704_117892882 107
257 3300025939 Ga0207665_10038727 Ga0207665_100387274 107
258 3300025944 Ga0207661_10022270 Ga0207661_100222701 107
259 3300025944 Ga0207661_10080808 Ga0207661_100808083 107
260 3300025944 Ga0207661_10569022 Ga0207661_105690222 107
261 3300025945 Ga0207679_10149892 Ga0207679_101498923 107
262 3300025945 Ga0207679_10247084 Ga0207679_102470842 107
263 3300025945 Ga0207679_11161182 Ga0207679_111611822 107
264 3300025949 Ga0207667_10028269 Ga0207667_100282692 107
265 3300025949 Ga0207667_10087055 Ga0207667_100870552 107
266 3300025949 Ga0207667_11825913 Ga0207667_118259132 107
267 3300025961 Ga0207712_10382181 Ga0207712_103821812 107
268 3300025981 Ga0207640_11321741 Ga0207640_113217412 107
269 3300025986 Ga0207658_10946151 Ga0207658_109461511 107
270 3300026023 Ga0207677_10590047 Ga0207677_105900471 107
271 3300026035 Ga0207703_10241469 Ga0207703_102414692 107
272 3300026035 Ga0207703_11149589 Ga0207703_111495891 107
273 3300026035 Ga0207703_11559466 Ga0207703_115594661 107
274 3300026067 Ga0207678_10435382 Ga0207678_104353822 107
275 3300026067 Ga0207678_10671168 Ga0207678_106711682 107
276 3300026075 Ga0207708_10486792 Ga0207708_104867922 107
277 3300026078 Ga0207702_10135275 Ga0207702_101352752 107
278 3300026078 Ga0207702_10136624 Ga0207702_101366242 107
279 3300026078 Ga0207702_10475512 Ga0207702_104755122 107
280 3300026078 Ga0207702_10507720 Ga0207702_105077201 107
281 3300026078 Ga0207702_11705191 Ga0207702_117051912 107
282 3300026088 Ga0207641_10835741 Ga0207641_108357411 107
283 3300026095 Ga0207676_10200729 Ga0207676_102007292 107
284 3300026116 Ga0207674_11200070 Ga0207674_112000701 107
285 3300026118 Ga0207675_100258670 Ga0207675_1002586702 107
286 3300026121 Ga0207683_10019524 Ga0207683_100195242 107
287 3300026121 Ga0207683_10331711 Ga0207683_103317111 107
288 3300026121 Ga0207683_10951875 Ga0207683_109518752 107
289 3300026121 Ga0207683_11684121 Ga0207683_116841212 107
290 3300026121 Ga0207683_11930677 Ga0207683_119306771 107
291 3300026142 Ga0207698_10623327 Ga0207698_106233272 107
292 3300026142 Ga0207698_10782045 Ga0207698_107820452 107
293 3300026142 Ga0207698_11630341 Ga0207698_116303411 107
294 3300026142 Ga0207698_11751445 Ga0207698_117514451 107
295 3300028379 Ga0268266_10354549 Ga0268266_103545492 107
296 3300028379 Ga0268266_10441782 Ga0268266_104417821 107
297 3300028380 Ga0268265_11094367 Ga0268265_110943672 107
298 3300028794 Ga0307515_10229481 Ga0307515_102294812 107
299 3300028794 Ga0307515_10694527 Ga0307515_106945271 107
300 3300031456 Ga0307513_10438339 Ga0307513_104383392 107
301 3300031507 Ga0307509_10159330 Ga0307509_101593303 107
302 3300031616 Ga0307508_10130910 Ga0307508_101309104 107
303 3300031731 Ga0307405_11181219 Ga0307405_111812192 107
304 3300031824 Ga0307413_10334850 Ga0307413_103348502 107
305 3300031901 Ga0307406_11395299 Ga0307406_113952992 107
306 3300031901 Ga0307406_11570389 Ga0307406_115703891 107
307 3300031903 Ga0307407_11111749 Ga0307407_111117492 107
308 3300033179 Ga0307507_10173008 Ga0307507_101730081 107
309 3300035083 Ga0373926_0277943 Ga0373926_0277943_69_392 107
310 3300035089 Ga0373944_0098413 Ga0373944_0098413_342_665 107
311 3300035111 Ga0373923_0048690 Ga0373923_0048690_828_1151 107
312 3300035113 Ga0373936_0043920 Ga0373936_0043920_1173_1496 107
313 3300035118 Ga0373954_0044920 Ga0373954_0044920_160_483 107
314 3300035119 Ga0373956_0002152 Ga0373956_0002152_5849_6172 107
315 3300035120 Ga0373957_0027648 Ga0373957_0027648_1392_1715 107
316 3300035170 Ga0373943_0212136 Ga0373943_0212136_332_655 107
317 3300035172 Ga0373955_0068220 Ga0373955_0068220_690_1013 107
318 3300035410 Ga0373924_0003360 Ga0373924_0003360_787_1110 107
319 3300035691 Ga0373931_0429550 Ga0373931_0429550_148_471 107
320 3300035724 Ga0373933_0000467 Ga0373933_0000467_16146_16469 107
321 3300035725 Ga0373947_0068714 Ga0373947_0068714_302_625 107
322 3300035725 Ga0373947_0094944 Ga0373947_0094944_11_340 107
323 3300036401 Ga0373937_0004282 Ga0373937_0004282_8228_8551 107
324 3300036459 Ga0372808_006475 Ga0372808_006475_1097_1420 107
325 3300037068 Ga0373925_0462713 Ga0373925_0462713_391_714 107
326 3300037312 Ga0395899_0126641 Ga0395899_0126641_1307_1639 107
327 3300037466 Ga0395898_1038426 Ga0395898_1038426_57_389 107
328 3300037853 Ga0436364_0033670 Ga0436364_0033670_1606_1935 107
329 3300037853 Ga0436364_0534556 Ga0436364_0534556_1793_2116 107
330 3300038443 Ga0395901_0159029 Ga0395901_0159029_1544_1876 107
331 3300038996 Ga0242420_051785 Ga0242420_051785_96_419 107
332 3300041443 Ga0451789_0114893 Ga0451789_0114893_249_626 107
333 3300041443 Ga0451789_1061075 Ga0451789_1061075_51_374 107
334 3300041452 Ga0451793_1363888 Ga0451793_1363888_2892_3269 107
335 3300041452 Ga0451793_1888304 Ga0451793_1888304_146_469 107
336 3300041453 Ga0451797_1007502 Ga0451797_1007502_963_1340 107
337 3300041456 Ga0451795_0564621 Ga0451795_0564621_853_1230 107
338 3300041456 Ga0451795_1447924 Ga0451795_1447924_89_412 107
339 3300041459 Ga0451800_0480215 Ga0451800_0480215_105_482 107
340 3300041486 Ga0451807_0741158 Ga0451807_0741158_54_377 107
341 3300041491 Ga0451833_1106133 Ga0451833_1106133_84_407 107
342 3300041496 Ga0451839_0263778 Ga0451839_0263778_88_414 107
343 3300041496 Ga0451839_0691447 Ga0451839_0691447_751_1128 107
344 3300041496 Ga0451839_0781426 Ga0451839_0781426_40_363 107
345 3300041498 Ga0451841_0761344 Ga0451841_0761344_523_900 107
346 3300041505 Ga0451849_0996445 Ga0451849_0996445_360_737 107
347 3300041509 Ga0451843_0550863 Ga0451843_0550863_118_495 107
348 3300041511 Ga0451855_0984818 Ga0451855_0984818_93_470 107
349 3300041512 Ga0451853_1384838 Ga0451853_1384838_3010_3387 107
350 3300041512 Ga0451853_3876009 Ga0451853_3876009_65_400 107
351 3300044656 Ga0466969_0289023 Ga0466969_0289023_297_632 107
352 3300044658 Ga0466972_0002240 Ga0466972_0002240_6415_6807 107
353 3300044683 Ga0466965_0027518 Ga0466965_0027518_569_895 107
354 3300044684 Ga0466966_0052309 Ga0466966_0052309_1905_2240 107
355 3300044684 Ga0466966_0237162 Ga0466966_0237162_724_1056 107
356 3300044684 Ga0466966_0427585 Ga0466966_0427585_287_619 107
357 3300044693 Ga0466961_0031502 Ga0466961_0031502_787_1113 107
358 3300044693 Ga0466961_0053936 Ga0466961_0053936_228_563 107
359 3300044694 Ga0466963_0017571 Ga0466963_0017571_2872_3198 107
360 3300044694 Ga0466963_0360957 Ga0466963_0360957_512_853 107
361 3300044694 Ga0466963_0944448 Ga0466963_0944448_93_416 107
362 3300044706 Ga0466964_0080688 Ga0466964_0080688_644_967 107
363 3300044706 Ga0466964_0096960 Ga0466964_0096960_413_739 107
364 3300044706 Ga0466964_0640875 Ga0466964_0640875_96_467 107
365 3300044719 Ga0466971_0002597 Ga0466971_0002597_3606_3932 107
366 3300044735 Ga0466968_0010062 Ga0466968_0010062_2787_3113 107
367 3300044765 Ga0466970_0627453 Ga0466970_0627453_234_572 107
368 3300044842 Ga0466957_0005581 Ga0466957_0005581_6141_6467 107
369 3300044842 Ga0466957_0271237 Ga0466957_0271237_164_493 107
370 3300044842 Ga0466957_0530903 Ga0466957_0530903_62_385 107
371 3300044842 Ga0466957_0617163 Ga0466957_0617163_287_610 107
372 3300044901 Ga0466960_0141020 Ga0466960_0141020_740_1132 107
373 3300045049 Ga0466959_0003017 Ga0466959_0003017_9686_10021 107
374 3300045049 Ga0466959_0010900 Ga0466959_0010900_1492_1818 107
375 3300045049 Ga0466959_0052008 Ga0466959_0052008_2403_2735 107
376 3300045049 Ga0466959_0158830 Ga0466959_0158830_742_1065 107
377 3300045836 Ga0466958_0016425 Ga0466958_0016425_1553_1879 107
378 3300045836 Ga0466958_0027033 Ga0466958_0027033_319_642 107
379 3300045836 Ga0466958_0884638 Ga0466958_0884638_186_521 107
380 3300045976 Ga0466967_0452415 Ga0466967_0452415_550_873 107
381 3300046454 Ga0495592_0008817 Ga0495592_0008817_394_717 107
382 3300046454 Ga0495592_0139356 Ga0495592_0139356_105_428 107
383 3300046455 Ga0495603_0128016 Ga0495603_0128016_938_1261 107
384 3300046459 Ga0495629_0200624 Ga0495629_0200624_541_864 107
385 3300046461 Ga0495641_0042112 Ga0495641_0042112_832_1155 107
386 3300046462 Ga0495651_0000424 Ga0495651_0000424_9115_9438 107
387 3300046462 Ga0495651_0213338 Ga0495651_0213338_721_1044 107
388 3300046463 Ga0495653_0016012 Ga0495653_0016012_3541_3864 107
389 3300046473 Ga0495582_0147830 Ga0495582_0147830_118_441 107
390 3300046475 Ga0495639_0198339 Ga0495639_0198339_64_396 107
391 3300046475 Ga0495639_0622613 Ga0495639_0622613_129_452 107
392 3300046476 Ga0495662_0029740 Ga0495662_0029740_856_1179 107
393 3300046477 Ga0495664_0062694 Ga0495664_0062694_1482_1805 107
394 3300046477 Ga0495664_0770264 Ga0495664_0770264_175_498 107
395 3300046499 Ga0495594_0761522 Ga0495594_0761522_111_434 107
396 3300046511 Ga0495608_0007454 Ga0495608_0007454_238_561 107
397 3300046514 Ga0495618_0009032 Ga0495618_0009032_4536_4859 107
398 3300046516 Ga0495628_0033351 Ga0495628_0033351_3374_3697 107
399 3300046516 Ga0495628_0147416 Ga0495628_0147416_1041_1364 107
400 3300046517 Ga0495630_0056342 Ga0495630_0056342_2030_2353 107
401 3300046529 Ga0495652_0000573 Ga0495652_0000573_21561_21884 107
402 3300046529 Ga0495652_0192418 Ga0495652_0192418_429_752 107
403 3300046529 Ga0495652_0749716 Ga0495652_0749716_55_390 107
404 3300046531 Ga0495665_0548293 Ga0495665_0548293_35_358 107
405 3300046533 Ga0495640_0005327 Ga0495640_0005327_6954_7277 107
406 3300046536 Ga0495587_0255675 Ga0495587_0255675_69_392 107
407 3300046543 Ga0495645_0128078 Ga0495645_0128078_64_387 107
408 3300046543 Ga0495645_0174846 Ga0495645_0174846_69_398 107
409 3300046543 Ga0495645_0238798 Ga0495645_0238798_298_621 107
410 3300046559 Ga0495667_0001456 Ga0495667_0001456_2031_2354 107
411 3300046559 Ga0495667_0352380 Ga0495667_0352380_94_417 107
412 3300046559 Ga0495667_0729173 Ga0495667_0729173_36_371 107
413 3300046642 Ga0495634_0022031 Ga0495634_0022031_3968_4291 107
414 3300046642 Ga0495634_0406793 Ga0495634_0406793_318_641 107
415 3300046663 Ga0495635_0048291 Ga0495635_0048291_320_643 107
416 3300046663 Ga0495635_0386321 Ga0495635_0386321_359_682 107
417 3300046674 Ga0495588_0349221 Ga0495588_0349221_87_410 107
418 3300046675 Ga0495657_0004269 Ga0495657_0004269_7348_7671 107
419 3300046678 Ga0495599_0003470 Ga0495599_0003470_8482_8805 107
420 3300046678 Ga0495599_0339673 Ga0495599_0339673_285_608 107
421 3300046680 Ga0495646_0015104 Ga0495646_0015104_4140_4463 107
422 3300046680 Ga0495646_0670050 Ga0495646_0670050_69_392 107
423 3300046689 Ga0495613_0204458 Ga0495613_0204458_185_508 107
424 3300046809 Ga0495600_0002578 Ga0495600_0002578_2939_3262 107
425 3300046809 Ga0495600_0374397 Ga0495600_0374397_214_549 107
426 3300047315 Ga0495581_0025564 Ga0495581_0025564_931_1254 107
427 3300047317 Ga0495604_0007008 Ga0495604_0007008_4705_5028 107
428 3300047317 Ga0495604_0070158 Ga0495604_0070158_822_1145 107
429 3300047317 Ga0495604_0595664 Ga0495604_0595664_328_663 107
430 3300047319 Ga0495674_0208247 Ga0495674_0208247_739_1062 107
431 3300047319 Ga0495674_1488979 Ga0495674_1488979_71_394 107
432 3300047322 Ga0495680_0005001 Ga0495680_0005001_3688_4011 107
433 3300047444 Ga0495675_0008107 Ga0495675_0008107_4139_4462 107
434 3300047471 Ga0495684_0023087 Ga0495684_0023087_1523_1846 107
435 3300047471 Ga0495684_0201868 Ga0495684_0201868_461_784 107
436 3300047673 Ga0495593_0025411 Ga0495593_0025411_2282_2605 107
437 3300048088 Ga0495602_0043423 Ga0495602_0043423_3027_3350 107
438 3300048089 Ga0495614_0089254 Ga0495614_0089254_571_894 107
439 3300048903 Ga0496100_0011668 Ga0496100_0011668_3126_3449 107
440 3300048903 Ga0496100_0077541 Ga0496100_0077541_1132_1455 107
441 3300048903 Ga0496100_0190479 Ga0496100_0190479_358_690 107
442 3300048903 Ga0496100_0493225 Ga0496100_0493225_337_660 107
443 3300048904 Ga0496101_0007767 Ga0496101_0007767_1225_1548 107
444 3300048904 Ga0496101_0018299 Ga0496101_0018299_1801_2124 107
445 3300048904 Ga0496101_0218640 Ga0496101_0218640_606_929 107
446 3300048904 Ga0496101_1280952 Ga0496101_1280952_83_415 107
447 3300048905 Ga0496102_0005237 Ga0496102_0005237_8214_8537 107
448 3300048905 Ga0496102_0017166 Ga0496102_0017166_408_731 107
449 3300048905 Ga0496102_0088358 Ga0496102_0088358_2145_2468 107
450 3300048905 Ga0496102_0153363 Ga0496102_0153363_1404_1727 107
451 3300048905 Ga0496102_0691661 Ga0496102_0691661_372_704 107
452 3300048906 Ga0496103_0020975 Ga0496103_0020975_3122_3445 107
453 3300048906 Ga0496103_0091521 Ga0496103_0091521_1297_1620 107
454 3300048906 Ga0496103_0733135 Ga0496103_0733135_43_366 107
455 3300048906 Ga0496103_0941696 Ga0496103_0941696_195_518 107
456 3300048907 Ga0496104_0011267 Ga0496104_0011267_4025_4348 107
457 3300048907 Ga0496104_0025980 Ga0496104_0025980_1836_2168 107
458 3300048907 Ga0496104_0050371 Ga0496104_0050371_3580_3903 107
459 3300048907 Ga0496104_0637502 Ga0496104_0637502_158_481 107
460 3300048907 Ga0496104_1086371 Ga0496104_1086371_312_689 107
461 3300048907 Ga0496104_1229777 Ga0496104_1229777_43_366 107
462 3300048908 Ga0496105_0000987 Ga0496105_0000987_10665_10988 107
463 3300048908 Ga0496105_0001487 Ga0496105_0001487_12761_13084 107
464 3300048908 Ga0496105_0037868 Ga0496105_0037868_773_1096 107
465 3300048908 Ga0496105_0062755 Ga0496105_0062755_2203_2535 107
466 3300048908 Ga0496105_0076184 Ga0496105_0076184_960_1283 107
467 3300048908 Ga0496105_0479976 Ga0496105_0479976_256_579 107
468 3300048908 Ga0496105_1110087 Ga0496105_1110087_79_408 107
469 3300048909 Ga0496106_0028565 Ga0496106_0028565_3683_4006 107
470 3300048909 Ga0496106_0273092 Ga0496106_0273092_278_601 107
471 3300048909 Ga0496106_0339153 Ga0496106_0339153_195_518 107
472 3300048909 Ga0496106_0760672 Ga0496106_0760672_18_341 107
473 3300048909 Ga0496106_1112228 Ga0496106_1112228_115_438 107
474 3300048910 Ga0496107_0084786 Ga0496107_0084786_1417_1740 107
475 3300048910 Ga0496107_0376425 Ga0496107_0376425_627_950 107
476 3300048910 Ga0496107_0484857 Ga0496107_0484857_171_494 107
477 3300048910 Ga0496107_0555235 Ga0496107_0555235_61_384 107
478 3300048910 Ga0496107_0566122 Ga0496107_0566122_122_445 107
479 3300048910 Ga0496107_0960636 Ga0496107_0960636_254_586 107
480 3300048911 Ga0496108_0016673 Ga0496108_0016673_29_352 107
481 3300048911 Ga0496108_0034779 Ga0496108_0034779_3606_3929 107
482 3300048911 Ga0496108_0046940 Ga0496108_0046940_2783_3106 107
483 3300048911 Ga0496108_0701646 Ga0496108_0701646_14_337 107
484 3300048912 Ga0496109_0014871 Ga0496109_0014871_4096_4419 107
485 3300048912 Ga0496109_0027997 Ga0496109_0027997_3496_3819 107
486 3300048912 Ga0496109_0192336 Ga0496109_0192336_1301_1624 107
487 3300048912 Ga0496109_0275503 Ga0496109_0275503_418_741 107
488 3300048912 Ga0496109_0826834 Ga0496109_0826834_114_491 107
489 3300048912 Ga0496109_1319780 Ga0496109_1319780_315_638 107
490 3300048912 Ga0496109_1859614 Ga0496109_1859614_143_478 107
491 3300048913 Ga0496110_0012988 Ga0496110_0012988_55_378 107
492 3300048913 Ga0496110_0023891 Ga0496110_0023891_4374_4697 107
493 3300048913 Ga0496110_0067046 Ga0496110_0067046_1936_2265 107
494 3300048913 Ga0496110_0770476 Ga0496110_0770476_227_550 107
495 3300048913 Ga0496110_0774559 Ga0496110_0774559_199_522 107
496 3300048913 Ga0496110_0786753 Ga0496110_0786753_341_664 107
497 3300048914 Ga0496111_0017497 Ga0496111_0017497_1268_1591 107
498 3300048914 Ga0496111_0020929 Ga0496111_0020929_527_850 107
499 3300048914 Ga0496111_0072632 Ga0496111_0072632_1632_1955 107
500 3300048914 Ga0496111_1157743 Ga0496111_1157743_63_386 107
501 3300048915 Ga0496112_0001908 Ga0496112_0001908_16047_16370 107
502 3300048915 Ga0496112_0024686 Ga0496112_0024686_3544_3867 107
503 3300048915 Ga0496112_0600883 Ga0496112_0600883_238_561 107
504 3300048915 Ga0496112_1209764 Ga0496112_1209764_269_592 107
505 3300048916 Ga0496113_0020528 Ga0496113_0020528_204_527 107
506 3300048916 Ga0496113_0183034 Ga0496113_0183034_946_1269 107
507 3300048916 Ga0496113_0321476 Ga0496113_0321476_853_1182 107
508 3300048917 Ga0496114_0003588 Ga0496114_0003588_2988_3311 107
509 3300048917 Ga0496114_0007081 Ga0496114_0007081_2654_2977 107
510 3300048917 Ga0496114_0010348 Ga0496114_0010348_2044_2376 107
511 3300048917 Ga0496114_0056388 Ga0496114_0056388_2887_3210 107
512 3300048917 Ga0496114_0095672 Ga0496114_0095672_2053_2376 107
513 3300048917 Ga0496114_0305564 Ga0496114_0305564_81_410 107
514 3300048917 Ga0496114_0549214 Ga0496114_0549214_616_939 107
515 3300048917 Ga0496114_0738556 Ga0496114_0738556_111_434 107
516 3300048917 Ga0496114_0875287 Ga0496114_0875287_272_595 107
517 3300048917 Ga0496114_1135113 Ga0496114_1135113_283_606 107
518 3300048917 Ga0496114_1430400 Ga0496114_1430400_214_537 107
519 3300048917 Ga0496114_1448786 Ga0496114_1448786_128_451 107
520 3300048917 Ga0496114_1764171 Ga0496114_1764171_90_419 107
521 3300048918 Ga0496115_0231180 Ga0496115_0231180_1061_1384 107
522 3300048929 Ga0496126_0456924 Ga0496126_0456924_336_671 107
523 3300049576 Ga0501040_1090376 Ga0501040_1090376_224_547 107
524 3300049583 Ga0501067_0053080 Ga0501067_0053080_1017_1340 107
525 3300049584 Ga0501068_0118815 Ga0501068_0118815_250_573 107
526 3300049585 Ga0501069_0033958 Ga0501069_0033958_1199_1522 107
527 3300049824 Ga0501045_0143225 Ga0501045_0143225_126_449 107
528 3300050490 nmdc:mga03n38_30463_c1 nmdc:mga03n38_30463_c1_42_371 107
529 3300050491 nmdc:mga00v17_76444_c1 nmdc:mga00v17_76444_c1_384_713 107
530 3300050494 nmdc:mga06z11_32578_c1 nmdc:mga06z11_32578_c1_603_932 107
531 3300050495 nmdc:mga04h51_20444_c1 nmdc:mga04h51_20444_c1_172_501 107
532 3300050507 nmdc:mga05p37_1271663_c1 nmdc:mga05p37_1271663_c1_121_456 107
533 3300050507 nmdc:mga05p37_225573_c1 nmdc:mga05p37_225573_c1_1258_1599 107
534 3300050508 nmdc:mga09592_822492_c1 nmdc:mga09592_822492_c1_190_531 107
535 3300050509 nmdc:mga0qj67_524565_c1 nmdc:mga0qj67_524565_c1_491_820 107
536 3300050512 nmdc:mga0n895_612536_c1 nmdc:mga0n895_612536_c1_520_843 107
537 3300050512 nmdc:mga0n895_87868_c1 nmdc:mga0n895_87868_c1_1108_1431 107
538 3300050513 nmdc:mga0rr50_192639_c1 nmdc:mga0rr50_192639_c1_1119_1442 107
539 3300050513 nmdc:mga0rr50_212576_c1 nmdc:mga0rr50_212576_c1_315_641 107
540 3300050514 nmdc:mga08x19_568526_c1 nmdc:mga08x19_568526_c1_180_503 107
541 3300050514 nmdc:mga08x19_819724_c1 nmdc:mga08x19_819724_c1_289_624 107
542 3300050515 nmdc:mga0a205_164790_c1 nmdc:mga0a205_164790_c1_114_449 107
543 3300053077 Ga0495601_0047053 Ga0495601_0047053_515_850 107
544 3300053077 Ga0495601_0176540 Ga0495601_0176540_68_391 107
545 3300053077 Ga0495601_0192802 Ga0495601_0192802_556_879 107
546 3300053078 Ga0495612_0039973 Ga0495612_0039973_678_1013 107
547 3300053080 Ga0500635_0000073 Ga0500635_0000073_45535_45879 107
548 3300053085 Ga0495619_0073284 Ga0495619_0073284_821_1144 107
549 3300053085 Ga0495619_0420434 Ga0495619_0420434_144_479 107
550 3300053088 Ga0500644_0000299 Ga0500644_0000299_8185_8514 107
551 3300053099 Ga0500654_207985 Ga0500654_207985_210_539 107
552 3300053104 Ga0500556_0001027 Ga0500556_0001027_12018_12341 107
553 3300053129 Ga0500628_030718 Ga0500628_030718_450_773 107
554 3300053140 Ga0500573_0113042 Ga0500573_0113042_456_779 107
555 3300053153 Ga0500616_0000097 Ga0500616_0000097_94636_94959 107
556 3300061719 Ga0466962_0008377 Ga0466962_0008377_3183_3509 107
557 3300061719 Ga0466962_0193689 Ga0466962_0193689_643_966 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

108

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7789 1 106
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7661 1 106
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.7412 2 107
2w29-assembly1.cif.gz_B gly102thr mutant of rv3291c 0.7252 2 107
2w25-assembly1.cif.gz_B crystal structure of glu104ala mutant 0.7228 2 107
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7789 1 106 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7661 1 106 3.30.70.1060
af_P71888_58_138_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7381 2 104 3.30.70.920
af_P0ACJ5_55_139_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7199 2 104 3.30.70.920
2w24A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7154 2 103 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A0M2RZ18-F1-model_v4 YCII-related domain-containing protein 0.9447 2 107
AF-A0A316FIT7-F1-model_v4 YCII-related domain-containing protein 0.9406 1 107
AF-A0A810LMP5-F1-model_v4 deleted 0.9371 2 107
AF-A0A1H8SN34-F1-model_v4 Uncharacterized conserved protein 0.9359 1 107
AF-A0A316FIT7-F1-model_v4 YCII-related domain-containing protein 0.9322 1 107

Feature Viewer

pLDDT pTM Quality
91.62 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map