F463313
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 557 | 300 | 556 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_12060267|Ga0157375_120602671 |
| Length | 108 |
| Sequence | MQYLFSVVDDTAGLASTDEQAAIDVFNEGLQADGYWVFAGGLGRPETATTIDNRGQGEPLLTDGPFVETKEYLAGFWIVEAPDLDVALGLAAKGSKACNRKVEVRPFL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 157 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 197 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 198 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 199 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 200 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 201 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 298 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 299 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 0.9 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.23 |
| Nodule | 0 |
| Rhizoplane | 16.7 |
| Rhizosphere | 75.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10089321 | 3300001990 | Bacteria | 914 |
| 2 | JGI24735J21928_10018658 | 3300002067 | Unclassified | 2137 |
| 3 | JGI24738J21930_10139294 | 3300002075 | Bacteria | 535 |
| 4 | rootH2_10106357 | 3300003320 | Bacteria | 3833 |
| 5 | JGI25407J50210_10001381 | 3300003373 | Bacteria | 5503 |
| 6 | JGI25407J50210_10034201 | 3300003373 | Bacteria | 1311 |
| 7 | Ga0070658_10490348 | 3300005327 | Bacteria | 1061 |
| 8 | Ga0070683_100018203 | 3300005329 | Bacteria | 6219 |
| 9 | Ga0070683_100329420 | 3300005329 | Bacteria | 1454 |
| 10 | Ga0070683_101561600 | 3300005329 | Bacteria | 634 |
| 11 | Ga0068869_100536724 | 3300005334 | Bacteria | 981 |
| 12 | Ga0070666_10445098 | 3300005335 | Bacteria | 935 |
| 13 | Ga0070682_100261076 | 3300005337 | Bacteria | 1254 |
| 14 | Ga0070682_100420290 | 3300005337 | Bacteria | 1016 |
| 15 | Ga0070682_100652070 | 3300005337 | Bacteria | 838 |
| 16 | Ga0068868_100423657 | 3300005338 | Bacteria | 1153 |
| 17 | Ga0068868_100499768 | 3300005338 | Bacteria | 1065 |
| 18 | Ga0070660_100019265 | 3300005339 | Bacteria | 4997 |
| 19 | Ga0070687_100055860 | 3300005343 | Bacteria | 2064 |
| 20 | Ga0070687_100464536 | 3300005343 | Bacteria | 845 |
| 21 | Ga0070661_101271682 | 3300005344 | Bacteria | 617 |
| 22 | Ga0070692_10008668 | 3300005345 | Bacteria | 4545 |
| 23 | Ga0070671_100962308 | 3300005355 | Bacteria | 747 |
| 24 | Ga0070688_100690477 | 3300005365 | Bacteria | 789 |
| 25 | Ga0070659_100230134 | 3300005366 | Bacteria | 1532 |
| 26 | Ga0070714_100315223 | 3300005435 | Bacteria | 1461 |
| 27 | Ga0070713_100025848 | 3300005436 | Bacteria | 4598 |
| 28 | Ga0070710_10124001 | 3300005437 | Bacteria | 1567 |
| 29 | Ga0070711_100444722 | 3300005439 | Bacteria | 1060 |
| 30 | Ga0070711_100502576 | 3300005439 | Bacteria | 1000 |
| 31 | Ga0070700_100339430 | 3300005441 | Bacteria | 1110 |
| 32 | Ga0070700_101663568 | 3300005441 | Bacteria | 547 |
| 33 | Ga0070694_101128766 | 3300005444 | Bacteria | 655 |
| 34 | Ga0070663_100901091 | 3300005455 | Bacteria | 764 |
| 35 | Ga0070678_100046584 | 3300005456 | Bacteria | 3110 |
| 36 | Ga0070678_100601518 | 3300005456 | Bacteria | 982 |
| 37 | Ga0070678_101006260 | 3300005456 | Bacteria | 766 |
| 38 | Ga0070678_101441205 | 3300005456 | Bacteria | 644 |
| 39 | Ga0070662_100180012 | 3300005457 | Bacteria | 1666 |
| 40 | Ga0070681_11923662 | 3300005458 | Bacteria | 519 |
| 41 | Ga0068867_100266791 | 3300005459 | Bacteria | 1398 |
| 42 | Ga0068867_100705570 | 3300005459 | Bacteria | 891 |
| 43 | Ga0070685_11126139 | 3300005466 | Bacteria | 594 |
| 44 | Ga0070685_11503795 | 3300005466 | Bacteria | 519 |
| 45 | Ga0070706_100822227 | 3300005467 | Bacteria | 859 |
| 46 | Ga0070679_102026395 | 3300005530 | Bacteria | 525 |
| 47 | Ga0070684_100112035 | 3300005535 | Bacteria | 2447 |
| 48 | Ga0070684_100364598 | 3300005535 | Bacteria | 1330 |
| 49 | Ga0070684_100395067 | 3300005535 | Bacteria | 1275 |
| 50 | Ga0070684_100926536 | 3300005535 | Bacteria | 817 |
| 51 | Ga0068853_100178734 | 3300005539 | Bacteria | 1924 |
| 52 | Ga0068853_101857185 | 3300005539 | Bacteria | 584 |
| 53 | Ga0070672_100543988 | 3300005543 | Bacteria | 1008 |
| 54 | Ga0070686_100889692 | 3300005544 | Bacteria | 724 |
| 55 | Ga0070693_100192950 | 3300005547 | Bacteria | 1318 |
| 56 | Ga0070665_100336579 | 3300005548 | Bacteria | 1514 |
| 57 | Ga0070665_101051974 | 3300005548 | Bacteria | 826 |
| 58 | Ga0070704_101302327 | 3300005549 | Bacteria | 665 |
| 59 | Ga0068855_100016350 | 3300005563 | Bacteria | 8921 |
| 60 | Ga0068855_100871713 | 3300005563 | Bacteria | 953 |
| 61 | Ga0068855_101611243 | 3300005563 | Bacteria | 664 |
| 62 | Ga0070664_100120263 | 3300005564 | Bacteria | 2299 |
| 63 | Ga0070664_101754262 | 3300005564 | Bacteria | 589 |
| 64 | Ga0068856_100068034 | 3300005614 | Bacteria | 3520 |
| 65 | Ga0068856_100513810 | 3300005614 | Bacteria | 1219 |
| 66 | Ga0068856_100892743 | 3300005614 | Bacteria | 908 |
| 67 | Ga0068856_101022472 | 3300005614 | Bacteria | 845 |
| 68 | Ga0070702_100446774 | 3300005615 | Bacteria | 937 |
| 69 | Ga0070702_100551342 | 3300005615 | Bacteria | 856 |
| 70 | Ga0070702_101024491 | 3300005615 | Bacteria | 655 |
| 71 | Ga0070702_101113078 | 3300005615 | Bacteria | 632 |
| 72 | Ga0068852_100118122 | 3300005616 | Bacteria | 2423 |
| 73 | Ga0068852_100804997 | 3300005616 | Bacteria | 954 |
| 74 | Ga0068852_102816450 | 3300005616 | Bacteria | 505 |
| 75 | Ga0068864_100278366 | 3300005618 | Bacteria | 1561 |
| 76 | Ga0068866_10571532 | 3300005718 | Bacteria | 759 |
| 77 | Ga0068870_11203159 | 3300005840 | Bacteria | 549 |
| 78 | Ga0068858_100301419 | 3300005842 | Bacteria | 1529 |
| 79 | Ga0068860_100136066 | 3300005843 | Bacteria | 2359 |
| 80 | Ga0081455_10088822 | 3300005937 | Bacteria | 2510 |
| 81 | Ga0081538_10001721 | 3300005981 | Bacteria | 22267 |
| 82 | Ga0081538_10162566 | 3300005981 | Bacteria | 989 |
| 83 | Ga0081540_1006883 | 3300005983 | Bacteria | 8203 |
| 84 | Ga0081540_1184967 | 3300005983 | Bacteria | 775 |
| 85 | Ga0070717_10156835 | 3300006028 | Bacteria | 1972 |
| 86 | Ga0070717_10159086 | 3300006028 | Bacteria | 1959 |
| 87 | Ga0075363_100007636 | 3300006048 | Bacteria | 4986 |
| 88 | Ga0075363_100354028 | 3300006048 | Bacteria | 858 |
| 89 | Ga0075364_10054319 | 3300006051 | Bacteria | 2619 |
| 90 | Ga0070715_10239027 | 3300006163 | Bacteria | 943 |
| 91 | Ga0070716_100006634 | 3300006173 | Bacteria | 5662 |
| 92 | Ga0070716_101211553 | 3300006173 | Bacteria | 607 |
| 93 | Ga0075367_10007311 | 3300006178 | Bacteria | 5648 |
| 94 | Ga0097621_100449730 | 3300006237 | Bacteria | 1160 |
| 95 | Ga0097621_100901207 | 3300006237 | Bacteria | 824 |
| 96 | Ga0075370_10170256 | 3300006353 | Bacteria | 1280 |
| 97 | Ga0068871_100172135 | 3300006358 | Bacteria | 1857 |
| 98 | Ga0068871_101311603 | 3300006358 | Bacteria | 681 |
| 99 | Ga0075428_100202463 | 3300006844 | Bacteria | 2146 |
| 100 | Ga0075431_100559060 | 3300006847 | Bacteria | 1131 |
| 101 | Ga0075433_10226844 | 3300006852 | Bacteria | 1659 |
| 102 | Ga0075434_100169029 | 3300006871 | Bacteria | 2206 |
| 103 | Ga0075434_101715275 | 3300006871 | Bacteria | 636 |
| 104 | Ga0075429_101014354 | 3300006880 | Bacteria | 725 |
| 105 | Ga0068865_100164768 | 3300006881 | Bacteria | 1694 |
| 106 | Ga0068865_101041383 | 3300006881 | Bacteria | 718 |
| 107 | Ga0075436_100826849 | 3300006914 | Bacteria | 690 |
| 108 | Ga0075435_100306903 | 3300007076 | Bacteria | 1358 |
| 109 | Ga0075435_100561888 | 3300007076 | Bacteria | 988 |
| 110 | Ga0105251_10325299 | 3300009011 | Bacteria | 699 |
| 111 | Ga0105240_10037410 | 3300009093 | Bacteria | 6238 |
| 112 | Ga0105245_10028880 | 3300009098 | Bacteria | 4896 |
| 113 | Ga0105245_10320557 | 3300009098 | Bacteria | 1526 |
| 114 | Ga0105245_10415152 | 3300009098 | Bacteria | 1348 |
| 115 | Ga0105247_11467829 | 3300009101 | Bacteria | 555 |
| 116 | Ga0114129_10288302 | 3300009147 | Bacteria | 2191 |
| 117 | Ga0114129_11363364 | 3300009147 | Bacteria | 876 |
| 118 | Ga0105243_10179176 | 3300009148 | Bacteria | 1842 |
| 119 | Ga0105243_10247054 | 3300009148 | Bacteria | 1591 |
| 120 | Ga0105243_10402423 | 3300009148 | Bacteria | 1272 |
| 121 | Ga0105243_11015668 | 3300009148 | Bacteria | 833 |
| 122 | Ga0105243_11759686 | 3300009148 | Bacteria | 650 |
| 123 | Ga0105241_10270980 | 3300009174 | Bacteria | 1446 |
| 124 | Ga0105242_10250443 | 3300009176 | Bacteria | 1596 |
| 125 | Ga0105242_10727820 | 3300009176 | Bacteria | 974 |
| 126 | Ga0105248_10344292 | 3300009177 | Bacteria | 1678 |
| 127 | Ga0105248_11302315 | 3300009177 | Bacteria | 822 |
| 128 | Ga0105248_13237847 | 3300009177 | Bacteria | 518 |
| 129 | Ga0105237_10122838 | 3300009545 | Bacteria | 2591 |
| 130 | Ga0105237_10588724 | 3300009545 | Bacteria | 1119 |
| 131 | Ga0105237_10821519 | 3300009545 | Bacteria | 936 |
| 132 | Ga0105237_11086709 | 3300009545 | Bacteria | 807 |
| 133 | Ga0105238_10146571 | 3300009551 | Bacteria | 2337 |
| 134 | Ga0105238_10464789 | 3300009551 | Bacteria | 1263 |
| 135 | Ga0105238_11835058 | 3300009551 | Bacteria | 639 |
| 136 | Ga0105249_10101727 | 3300009553 | Bacteria | 2703 |
| 137 | Ga0105249_12603226 | 3300009553 | Bacteria | 578 |
| 138 | Ga0105239_10066882 | 3300010375 | Bacteria | 3947 |
| 139 | Ga0105239_10240544 | 3300010375 | Bacteria | 2032 |
| 140 | Ga0105239_10273914 | 3300010375 | Bacteria | 1899 |
| 141 | Ga0105246_10862592 | 3300011119 | Bacteria | 809 |
| 142 | Ga0105246_10977846 | 3300011119 | Bacteria | 765 |
| 143 | Ga0157343_1011842 | 3300012488 | Bacteria | 682 |
| 144 | Ga0157371_10188884 | 3300013102 | Bacteria | 1475 |
| 145 | Ga0157371_11184689 | 3300013102 | Bacteria | 588 |
| 146 | Ga0157370_10435739 | 3300013104 | Bacteria | 1205 |
| 147 | Ga0157369_10137192 | 3300013105 | Bacteria | 2589 |
| 148 | Ga0157369_10328217 | 3300013105 | Bacteria | 1590 |
| 149 | Ga0157369_11003227 | 3300013105 | Bacteria | 855 |
| 150 | Ga0157369_11135849 | 3300013105 | Bacteria | 798 |
| 151 | Ga0157374_10286378 | 3300013296 | Bacteria | 1627 |
| 152 | Ga0163162_10098296 | 3300013306 | Bacteria | 3016 |
| 153 | Ga0163162_10196025 | 3300013306 | Bacteria | 2148 |
| 154 | Ga0163162_10660496 | 3300013306 | Bacteria | 1169 |
| 155 | Ga0163162_11880622 | 3300013306 | Bacteria | 685 |
| 156 | Ga0163162_11917934 | 3300013306 | Bacteria | 678 |
| 157 | Ga0157372_10000123 | 3300013307 | Bacteria | 83350 |
| 158 | Ga0157372_10602010 | 3300013307 | Bacteria | 1281 |
| 159 | Ga0157372_11215871 | 3300013307 | Bacteria | 871 |
| 160 | Ga0157372_11983875 | 3300013307 | Bacteria | 669 |
| 161 | Ga0157375_10063855 | 3300013308 | Bacteria | 3665 |
| 162 | Ga0157375_10092910 | 3300013308 | Bacteria | 3082 |
| 163 | Ga0157375_10305162 | 3300013308 | Bacteria | 1756 |
| 164 | Ga0157375_11536604 | 3300013308 | Bacteria | 786 |
| 165 | Ga0157375_12060267 | 3300013308 | Bacteria | 679 |
| 166 | Ga0157375_12604607 | 3300013308 | Bacteria | 604 |
| 167 | Ga0157375_13172144 | 3300013308 | Bacteria | 548 |
| 168 | Ga0163163_10216503 | 3300014325 | Bacteria | 1964 |
| 169 | Ga0163163_10461282 | 3300014325 | Bacteria | 1331 |
| 170 | Ga0163163_10491196 | 3300014325 | Bacteria | 1289 |
| 171 | Ga0163163_11720925 | 3300014325 | Bacteria | 688 |
| 172 | Ga0163163_12253266 | 3300014325 | Bacteria | 604 |
| 173 | Ga0163163_12517712 | 3300014325 | Bacteria | 572 |
| 174 | Ga0163163_13025764 | 3300014325 | Bacteria | 524 |
| 175 | Ga0157380_10455749 | 3300014326 | Bacteria | 1230 |
| 176 | Ga0157380_10680704 | 3300014326 | Bacteria | 1031 |
| 177 | Ga0157380_12310469 | 3300014326 | Bacteria | 602 |
| 178 | Ga0157377_10362697 | 3300014745 | Bacteria | 976 |
| 179 | Ga0157379_10911591 | 3300014968 | Bacteria | 834 |
| 180 | Ga0157376_10715763 | 3300014969 | Bacteria | 1007 |
| 181 | Ga0157376_10772182 | 3300014969 | Bacteria | 972 |
| 182 | Ga0157376_11570818 | 3300014969 | Bacteria | 692 |
| 183 | Ga0163161_10525037 | 3300017792 | Bacteria | 967 |
| 184 | Ga0163161_10958578 | 3300017792 | Bacteria | 728 |
| 185 | Ga0206354_11138012 | 3300020081 | Bacteria | 697 |
| 186 | Ga0206353_10784518 | 3300020082 | Bacteria | 1044 |
| 187 | Ga0206353_11703250 | 3300020082 | Bacteria | 1155 |
| 188 | Ga0213875_10040024 | 3300021388 | Bacteria | 2207 |
| 189 | Ga0213875_10238549 | 3300021388 | Bacteria | 857 |
| 190 | Ga0213875_10324379 | 3300021388 | Bacteria | 730 |
| 191 | Ga0224712_10211468 | 3300022467 | Bacteria | 885 |
| 192 | Ga0207697_10320354 | 3300025315 | Bacteria | 688 |
| 193 | Ga0207692_10223964 | 3300025898 | Bacteria | 1116 |
| 194 | Ga0207688_10425227 | 3300025901 | Bacteria | 826 |
| 195 | Ga0207688_10628843 | 3300025901 | Bacteria | 677 |
| 196 | Ga0207680_10478386 | 3300025903 | Bacteria | 886 |
| 197 | Ga0207647_10047505 | 3300025904 | Bacteria | 2669 |
| 198 | Ga0207647_10141123 | 3300025904 | Bacteria | 1412 |
| 199 | Ga0207685_10290159 | 3300025905 | Bacteria | 806 |
| 200 | Ga0207699_10485617 | 3300025906 | Bacteria | 890 |
| 201 | Ga0207643_10621628 | 3300025908 | Bacteria | 696 |
| 202 | Ga0207705_11048221 | 3300025909 | Bacteria | 629 |
| 203 | Ga0207684_10164984 | 3300025910 | Bacteria | 1908 |
| 204 | Ga0207654_10521045 | 3300025911 | Bacteria | 842 |
| 205 | Ga0207695_10298701 | 3300025913 | Bacteria | 1502 |
| 206 | Ga0207671_11588240 | 3300025914 | Bacteria | 503 |
| 207 | Ga0207693_10085606 | 3300025915 | Bacteria | 2469 |
| 208 | Ga0207693_10382654 | 3300025915 | Bacteria | 1100 |
| 209 | Ga0207663_10956147 | 3300025916 | Bacteria | 686 |
| 210 | Ga0207662_10069697 | 3300025918 | Bacteria | 2125 |
| 211 | Ga0207662_10253327 | 3300025918 | Bacteria | 1156 |
| 212 | Ga0207657_10030115 | 3300025919 | Bacteria | 4931 |
| 213 | Ga0207649_10320886 | 3300025920 | Bacteria | 1138 |
| 214 | Ga0207649_10867356 | 3300025920 | Bacteria | 707 |
| 215 | Ga0207652_11677771 | 3300025921 | Bacteria | 540 |
| 216 | Ga0207681_11608290 | 3300025923 | Bacteria | 544 |
| 217 | Ga0207694_10246338 | 3300025924 | Bacteria | 1461 |
| 218 | Ga0207694_10431523 | 3300025924 | Bacteria | 1098 |
| 219 | Ga0207687_10096703 | 3300025927 | Bacteria | 2165 |
| 220 | Ga0207687_10450104 | 3300025927 | Bacteria | 1068 |
| 221 | Ga0207687_10751936 | 3300025927 | Bacteria | 830 |
| 222 | Ga0207700_10006621 | 3300025928 | Bacteria | 7020 |
| 223 | Ga0207664_10032117 | 3300025929 | Bacteria | 4022 |
| 224 | Ga0207664_10227675 | 3300025929 | Bacteria | 1619 |
| 225 | Ga0207644_11455556 | 3300025931 | Bacteria | 575 |
| 226 | Ga0207706_11382855 | 3300025933 | Bacteria | 579 |
| 227 | Ga0207686_10814022 | 3300025934 | Bacteria | 749 |
| 228 | Ga0207686_11194496 | 3300025934 | Bacteria | 622 |
| 229 | Ga0207709_10823771 | 3300025935 | Bacteria | 750 |
| 230 | Ga0207669_10378173 | 3300025937 | Bacteria | 1103 |
| 231 | Ga0207704_10205896 | 3300025938 | Bacteria | 1444 |
| 232 | Ga0207704_11789288 | 3300025938 | Bacteria | 528 |
| 233 | Ga0207665_10038727 | 3300025939 | Bacteria | 3176 |
| 234 | Ga0207661_10022270 | 3300025944 | Bacteria | 4768 |
| 235 | Ga0207661_10080808 | 3300025944 | Bacteria | 2683 |
| 236 | Ga0207661_10569022 | 3300025944 | Bacteria | 1039 |
| 237 | Ga0207679_10149892 | 3300025945 | Bacteria | 1897 |
| 238 | Ga0207679_10247084 | 3300025945 | Bacteria | 1515 |
| 239 | Ga0207679_11161182 | 3300025945 | Bacteria | 708 |
| 240 | Ga0207667_10028269 | 3300025949 | Bacteria | 6092 |
| 241 | Ga0207667_10087055 | 3300025949 | Bacteria | 3232 |
| 242 | Ga0207667_11825913 | 3300025949 | Bacteria | 571 |
| 243 | Ga0207712_10382181 | 3300025961 | Bacteria | 1179 |
| 244 | Ga0207640_10246556 | 3300025981 | Bacteria | 1384 |
| 245 | Ga0207640_11321741 | 3300025981 | Bacteria | 644 |
| 246 | Ga0207658_10946151 | 3300025986 | Bacteria | 785 |
| 247 | Ga0207677_10590047 | 3300026023 | Bacteria | 974 |
| 248 | Ga0207703_10241469 | 3300026035 | Bacteria | 1624 |
| 249 | Ga0207703_11149589 | 3300026035 | Bacteria | 746 |
| 250 | Ga0207703_11559466 | 3300026035 | Bacteria | 635 |
| 251 | Ga0207678_10435382 | 3300026067 | Bacteria | 1138 |
| 252 | Ga0207678_10671168 | 3300026067 | Bacteria | 911 |
| 253 | Ga0207678_11148941 | 3300026067 | Bacteria | 688 |
| 254 | Ga0207708_10486792 | 3300026075 | Bacteria | 1032 |
| 255 | Ga0207702_10135275 | 3300026078 | Bacteria | 2223 |
| 256 | Ga0207702_10136624 | 3300026078 | Bacteria | 2213 |
| 257 | Ga0207702_10475512 | 3300026078 | Bacteria | 1215 |
| 258 | Ga0207702_10507720 | 3300026078 | Bacteria | 1176 |
| 259 | Ga0207702_11705191 | 3300026078 | Bacteria | 623 |
| 260 | Ga0207641_10835741 | 3300026088 | Bacteria | 912 |
| 261 | Ga0207676_10200729 | 3300026095 | Bacteria | 1762 |
| 262 | Ga0207674_11200070 | 3300026116 | Bacteria | 728 |
| 263 | Ga0207675_100258670 | 3300026118 | Bacteria | 1686 |
| 264 | Ga0207683_10019524 | 3300026121 | Bacteria | 5788 |
| 265 | Ga0207683_10331711 | 3300026121 | Bacteria | 1394 |
| 266 | Ga0207683_10951875 | 3300026121 | Bacteria | 797 |
| 267 | Ga0207683_11684121 | 3300026121 | Bacteria | 583 |
| 268 | Ga0207683_11930677 | 3300026121 | Bacteria | 539 |
| 269 | Ga0207698_10623327 | 3300026142 | Bacteria | 1066 |
| 270 | Ga0207698_10782045 | 3300026142 | Bacteria | 955 |
| 271 | Ga0207698_11630341 | 3300026142 | Bacteria | 661 |
| 272 | Ga0207698_11751445 | 3300026142 | Bacteria | 637 |
| 273 | Ga0268266_10021956 | 3300028379 | Bacteria | 5440 |
| 274 | Ga0268266_10354549 | 3300028379 | Bacteria | 1379 |
| 275 | Ga0268266_10441782 | 3300028379 | Bacteria | 1236 |
| 276 | Ga0268265_11094367 | 3300028380 | Bacteria | 791 |
| 277 | Ga0307517_10087877 | 3300028786 | Bacteria | 2577 |
| 278 | Ga0307515_10229481 | 3300028794 | Bacteria | 1653 |
| 279 | Ga0307515_10694527 | 3300028794 | Bacteria | 633 |
| 280 | Ga0307513_10438339 | 3300031456 | Bacteria | 1033 |
| 281 | Ga0307509_10159330 | 3300031507 | Bacteria | 2158 |
| 282 | Ga0307508_10130910 | 3300031616 | Bacteria | 2112 |
| 283 | Ga0307405_11181219 | 3300031731 | Bacteria | 661 |
| 284 | Ga0307413_10177625 | 3300031824 | Bacteria | 1514 |
| 285 | Ga0307413_10334850 | 3300031824 | Bacteria | 1162 |
| 286 | Ga0307410_10593822 | 3300031852 | Bacteria | 923 |
| 287 | Ga0307406_10058765 | 3300031901 | Bacteria | 2472 |
| 288 | Ga0307406_11256910 | 3300031901 | Bacteria | 645 |
| 289 | Ga0307406_11395299 | 3300031901 | Bacteria | 614 |
| 290 | Ga0307406_11570389 | 3300031901 | Bacteria | 581 |
| 291 | Ga0307407_10528372 | 3300031903 | Bacteria | 869 |
| 292 | Ga0307407_11111749 | 3300031903 | Bacteria | 615 |
| 293 | Ga0307412_10398278 | 3300031911 | Bacteria | 1120 |
| 294 | Ga0307416_100171065 | 3300032002 | Bacteria | 2022 |
| 295 | Ga0307414_11995761 | 3300032004 | Bacteria | 542 |
| 296 | Ga0307415_100113418 | 3300032126 | Bacteria | 2016 |
| 297 | Ga0307415_100498998 | 3300032126 | Bacteria | 1064 |
| 298 | Ga0307507_10173008 | 3300033179 | Bacteria | 1564 |
| 299 | Ga0373926_0277943 | 3300035083 | Bacteria | 652 |
| 300 | Ga0373944_0098413 | 3300035089 | Bacteria | 986 |
| 301 | Ga0373923_0048690 | 3300035111 | Bacteria | 1770 |
| 302 | Ga0373936_0043920 | 3300035113 | Bacteria | 1797 |
| 303 | Ga0373954_0044920 | 3300035118 | Bacteria | 2063 |
| 304 | Ga0373956_0002152 | 3300035119 | Bacteria | 8142 |
| 305 | Ga0373957_0027648 | 3300035120 | Bacteria | 2061 |
| 306 | Ga0373943_0212136 | 3300035170 | Bacteria | 1076 |
| 307 | Ga0373955_0068220 | 3300035172 | Bacteria | 1981 |
| 308 | Ga0373924_0003360 | 3300035410 | Bacteria | 5496 |
| 309 | Ga0373931_0429550 | 3300035691 | Bacteria | 841 |
| 310 | Ga0373933_0000467 | 3300035724 | Bacteria | 25272 |
| 311 | Ga0373947_0068714 | 3300035725 | Bacteria | 2167 |
| 312 | Ga0373947_0094944 | 3300035725 | Bacteria | 1866 |
| 313 | Ga0373937_0004282 | 3300036401 | Bacteria | 12091 |
| 314 | Ga0372808_006475 | 3300036459 | Bacteria | 1579 |
| 315 | Ga0373925_0462713 | 3300037068 | Bacteria | 1039 |
| 316 | Ga0395899_0126641 | 3300037312 | Bacteria | 1826 |
| 317 | Ga0395898_1038426 | 3300037466 | Bacteria | 754 |
| 318 | Ga0436364_0033670 | 3300037853 | Bacteria | 2208 |
| 319 | Ga0436364_0226122 | 3300037853 | Bacteria | 519 |
| 320 | Ga0436364_0534556 | 3300037853 | Bacteria | 2439 |
| 321 | Ga0436364_0808660 | 3300037853 | Bacteria | 687 |
| 322 | Ga0395901_0159029 | 3300038443 | Bacteria | 2372 |
| 323 | Ga0395901_1126341 | 3300038443 | Bacteria | 754 |
| 324 | Ga0242420_051785 | 3300038996 | Bacteria | 804 |
| 325 | Ga0436363_1185957 | 3300039450 | Bacteria | 677 |
| 326 | Ga0451789_0114893 | 3300041443 | Bacteria | 818 |
| 327 | Ga0451789_1061075 | 3300041443 | Bacteria | 580 |
| 328 | Ga0451793_1363888 | 3300041452 | Bacteria | 3691 |
| 329 | Ga0451793_1888304 | 3300041452 | Bacteria | 627 |
| 330 | Ga0451797_1007502 | 3300041453 | Bacteria | 2023 |
| 331 | Ga0451797_1073397 | 3300041453 | Bacteria | 511 |
| 332 | Ga0451795_0564621 | 3300041456 | Bacteria | 1590 |
| 333 | Ga0451795_1447924 | 3300041456 | Bacteria | 631 |
| 334 | Ga0451800_0480215 | 3300041459 | Bacteria | 780 |
| 335 | Ga0451807_0741158 | 3300041486 | Bacteria | 778 |
| 336 | Ga0451833_1106133 | 3300041491 | Bacteria | 513 |
| 337 | Ga0451839_0263778 | 3300041496 | Bacteria | 507 |
| 338 | Ga0451839_0691447 | 3300041496 | Bacteria | 1472 |
| 339 | Ga0451839_0781426 | 3300041496 | Bacteria | 618 |
| 340 | Ga0451841_0761344 | 3300041498 | Bacteria | 1352 |
| 341 | Ga0451849_0996445 | 3300041505 | Bacteria | 1573 |
| 342 | Ga0451843_0550863 | 3300041509 | Bacteria | 5677 |
| 343 | Ga0451855_0984818 | 3300041511 | Bacteria | 754 |
| 344 | Ga0451853_1384838 | 3300041512 | Bacteria | 4764 |
| 345 | Ga0451853_3876009 | 3300041512 | Bacteria | 550 |
| 346 | Ga0466969_0289023 | 3300044656 | Bacteria | 742 |
| 347 | Ga0466972_0002240 | 3300044658 | Bacteria | 9505 |
| 348 | Ga0466965_0000003 | 3300044683 | Bacteria | 265985 |
| 349 | Ga0466965_0027518 | 3300044683 | Bacteria | 2761 |
| 350 | Ga0466966_0052309 | 3300044684 | Bacteria | 2595 |
| 351 | Ga0466966_0237162 | 3300044684 | Bacteria | 1100 |
| 352 | Ga0466966_0427585 | 3300044684 | Bacteria | 796 |
| 353 | Ga0466961_0031502 | 3300044693 | Bacteria | 3409 |
| 354 | Ga0466961_0053936 | 3300044693 | Bacteria | 2565 |
| 355 | Ga0466963_0017571 | 3300044694 | Bacteria | 4460 |
| 356 | Ga0466963_0360957 | 3300044694 | Bacteria | 1023 |
| 357 | Ga0466963_0944448 | 3300044694 | Bacteria | 607 |
| 358 | Ga0466964_0080688 | 3300044706 | Bacteria | 1396 |
| 359 | Ga0466964_0096960 | 3300044706 | Bacteria | 1293 |
| 360 | Ga0466964_0640875 | 3300044706 | Bacteria | 587 |
| 361 | Ga0466971_0002597 | 3300044719 | Bacteria | 7640 |
| 362 | Ga0466968_0010062 | 3300044735 | Bacteria | 3656 |
| 363 | Ga0466970_0627453 | 3300044765 | Bacteria | 624 |
| 364 | Ga0466957_0005581 | 3300044842 | Bacteria | 7066 |
| 365 | Ga0466957_0271237 | 3300044842 | Bacteria | 1133 |
| 366 | Ga0466957_0530903 | 3300044842 | Bacteria | 818 |
| 367 | Ga0466957_0617163 | 3300044842 | Bacteria | 760 |
| 368 | Ga0466960_0141020 | 3300044901 | Bacteria | 1280 |
| 369 | Ga0466959_0003017 | 3300045049 | Bacteria | 10876 |
| 370 | Ga0466959_0010900 | 3300045049 | Bacteria | 6517 |
| 371 | Ga0466959_0052008 | 3300045049 | Bacteria | 3002 |
| 372 | Ga0466959_0158830 | 3300045049 | Bacteria | 1590 |
| 373 | Ga0466958_0016425 | 3300045836 | Bacteria | 4262 |
| 374 | Ga0466958_0027033 | 3300045836 | Bacteria | 3394 |
| 375 | Ga0466958_0884638 | 3300045836 | Bacteria | 583 |
| 376 | Ga0466967_0452415 | 3300045976 | Bacteria | 1255 |
| 377 | Ga0495592_0008817 | 3300046454 | Bacteria | 7574 |
| 378 | Ga0495592_0139356 | 3300046454 | Bacteria | 1689 |
| 379 | Ga0495603_0128016 | 3300046455 | Bacteria | 1479 |
| 380 | Ga0495629_0200624 | 3300046459 | Bacteria | 1379 |
| 381 | Ga0495641_0042112 | 3300046461 | Bacteria | 2118 |
| 382 | Ga0495651_0000424 | 3300046462 | Bacteria | 32646 |
| 383 | Ga0495651_0213338 | 3300046462 | Bacteria | 1341 |
| 384 | Ga0495653_0016012 | 3300046463 | Bacteria | 6111 |
| 385 | Ga0495582_0147830 | 3300046473 | Bacteria | 1333 |
| 386 | Ga0495639_0198339 | 3300046475 | Bacteria | 982 |
| 387 | Ga0495639_0622613 | 3300046475 | Bacteria | 555 |
| 388 | Ga0495662_0029740 | 3300046476 | Bacteria | 2636 |
| 389 | Ga0495664_0062694 | 3300046477 | Bacteria | 2214 |
| 390 | Ga0495664_0770264 | 3300046477 | Bacteria | 566 |
| 391 | Ga0495594_0761522 | 3300046499 | Bacteria | 546 |
| 392 | Ga0495608_0007454 | 3300046511 | Bacteria | 7729 |
| 393 | Ga0495618_0009032 | 3300046514 | Bacteria | 6014 |
| 394 | Ga0495628_0033351 | 3300046516 | Bacteria | 4151 |
| 395 | Ga0495628_0147416 | 3300046516 | Bacteria | 1793 |
| 396 | Ga0495630_0056342 | 3300046517 | Bacteria | 2945 |
| 397 | Ga0495652_0000573 | 3300046529 | Bacteria | 42990 |
| 398 | Ga0495652_0192418 | 3300046529 | Bacteria | 1555 |
| 399 | Ga0495652_0749716 | 3300046529 | Bacteria | 653 |
| 400 | Ga0495665_0548293 | 3300046531 | Bacteria | 580 |
| 401 | Ga0495640_0005327 | 3300046533 | Bacteria | 10227 |
| 402 | Ga0495587_0255675 | 3300046536 | Bacteria | 984 |
| 403 | Ga0495645_0128078 | 3300046543 | Bacteria | 1782 |
| 404 | Ga0495645_0174846 | 3300046543 | Bacteria | 1475 |
| 405 | Ga0495645_0238798 | 3300046543 | Bacteria | 1213 |
| 406 | Ga0495667_0001456 | 3300046559 | Bacteria | 15577 |
| 407 | Ga0495667_0352380 | 3300046559 | Bacteria | 930 |
| 408 | Ga0495667_0729173 | 3300046559 | Bacteria | 613 |
| 409 | Ga0495634_0022031 | 3300046642 | Bacteria | 4493 |
| 410 | Ga0495634_0406793 | 3300046642 | Bacteria | 808 |
| 411 | Ga0495635_0048291 | 3300046663 | Bacteria | 2934 |
| 412 | Ga0495635_0386321 | 3300046663 | Bacteria | 931 |
| 413 | Ga0495588_0349221 | 3300046674 | Bacteria | 777 |
| 414 | Ga0495657_0004269 | 3300046675 | Bacteria | 11426 |
| 415 | Ga0495599_0003470 | 3300046678 | Bacteria | 9229 |
| 416 | Ga0495599_0339673 | 3300046678 | Bacteria | 902 |
| 417 | Ga0495646_0015104 | 3300046680 | Bacteria | 4905 |
| 418 | Ga0495646_0670050 | 3300046680 | Bacteria | 523 |
| 419 | Ga0495613_0204458 | 3300046689 | Bacteria | 1391 |
| 420 | Ga0495600_0002578 | 3300046809 | Bacteria | 10440 |
| 421 | Ga0495600_0374397 | 3300046809 | Bacteria | 889 |
| 422 | Ga0495581_0025564 | 3300047315 | Bacteria | 3424 |
| 423 | Ga0495604_0007008 | 3300047317 | Bacteria | 8934 |
| 424 | Ga0495604_0070158 | 3300047317 | Bacteria | 2654 |
| 425 | Ga0495604_0595664 | 3300047317 | Bacteria | 709 |
| 426 | Ga0495674_0208247 | 3300047319 | Bacteria | 1620 |
| 427 | Ga0495674_1488979 | 3300047319 | Bacteria | 501 |
| 428 | Ga0495680_0005001 | 3300047322 | Bacteria | 12538 |
| 429 | Ga0495675_0008107 | 3300047444 | Bacteria | 6501 |
| 430 | Ga0495684_0023087 | 3300047471 | Bacteria | 4784 |
| 431 | Ga0495684_0201868 | 3300047471 | Bacteria | 1465 |
| 432 | Ga0495593_0025411 | 3300047673 | Bacteria | 3278 |
| 433 | Ga0495602_0043423 | 3300048088 | Bacteria | 4087 |
| 434 | Ga0495614_0089254 | 3300048089 | Bacteria | 1340 |
| 435 | Ga0496100_0011668 | 3300048903 | Bacteria | 5008 |
| 436 | Ga0496100_0077541 | 3300048903 | Bacteria | 2234 |
| 437 | Ga0496100_0190479 | 3300048903 | Bacteria | 1489 |
| 438 | Ga0496100_0493225 | 3300048903 | Bacteria | 943 |
| 439 | Ga0496101_0007767 | 3300048904 | Bacteria | 6971 |
| 440 | Ga0496101_0018299 | 3300048904 | Bacteria | 4762 |
| 441 | Ga0496101_0218640 | 3300048904 | Bacteria | 1478 |
| 442 | Ga0496101_1280952 | 3300048904 | Bacteria | 573 |
| 443 | Ga0496102_0005237 | 3300048905 | Bacteria | 11008 |
| 444 | Ga0496102_0017166 | 3300048905 | Bacteria | 6338 |
| 445 | Ga0496102_0088358 | 3300048905 | Bacteria | 2865 |
| 446 | Ga0496102_0153363 | 3300048905 | Bacteria | 2165 |
| 447 | Ga0496102_0691661 | 3300048905 | Bacteria | 943 |
| 448 | Ga0496103_0020975 | 3300048906 | Bacteria | 3929 |
| 449 | Ga0496103_0091521 | 3300048906 | Bacteria | 1919 |
| 450 | Ga0496103_0733135 | 3300048906 | Bacteria | 625 |
| 451 | Ga0496103_0941696 | 3300048906 | Bacteria | 540 |
| 452 | Ga0496104_0011267 | 3300048907 | Bacteria | 8003 |
| 453 | Ga0496104_0025980 | 3300048907 | Bacteria | 5400 |
| 454 | Ga0496104_0050371 | 3300048907 | Bacteria | 3929 |
| 455 | Ga0496104_0637502 | 3300048907 | Bacteria | 975 |
| 456 | Ga0496104_1086371 | 3300048907 | Bacteria | 704 |
| 457 | Ga0496104_1229777 | 3300048907 | Bacteria | 652 |
| 458 | Ga0496105_0000987 | 3300048908 | Bacteria | 19605 |
| 459 | Ga0496105_0001487 | 3300048908 | Bacteria | 16545 |
| 460 | Ga0496105_0037868 | 3300048908 | Bacteria | 3973 |
| 461 | Ga0496105_0062755 | 3300048908 | Bacteria | 3066 |
| 462 | Ga0496105_0076184 | 3300048908 | Bacteria | 2770 |
| 463 | Ga0496105_0479976 | 3300048908 | Bacteria | 978 |
| 464 | Ga0496105_1110087 | 3300048908 | Bacteria | 587 |
| 465 | Ga0496106_0028565 | 3300048909 | Bacteria | 4155 |
| 466 | Ga0496106_0273092 | 3300048909 | Bacteria | 1354 |
| 467 | Ga0496106_0339153 | 3300048909 | Bacteria | 1207 |
| 468 | Ga0496106_0760672 | 3300048909 | Bacteria | 770 |
| 469 | Ga0496106_1112228 | 3300048909 | Bacteria | 619 |
| 470 | Ga0496107_0084786 | 3300048910 | Bacteria | 2312 |
| 471 | Ga0496107_0376425 | 3300048910 | Bacteria | 1056 |
| 472 | Ga0496107_0484857 | 3300048910 | Bacteria | 917 |
| 473 | Ga0496107_0555235 | 3300048910 | Bacteria | 850 |
| 474 | Ga0496107_0566122 | 3300048910 | Bacteria | 841 |
| 475 | Ga0496107_0960636 | 3300048910 | Bacteria | 621 |
| 476 | Ga0496108_0016673 | 3300048911 | Bacteria | 6001 |
| 477 | Ga0496108_0034779 | 3300048911 | Bacteria | 4186 |
| 478 | Ga0496108_0046940 | 3300048911 | Bacteria | 3610 |
| 479 | Ga0496108_0701646 | 3300048911 | Bacteria | 877 |
| 480 | Ga0496109_0014871 | 3300048912 | Bacteria | 6772 |
| 481 | Ga0496109_0027997 | 3300048912 | Bacteria | 5038 |
| 482 | Ga0496109_0192336 | 3300048912 | Bacteria | 1917 |
| 483 | Ga0496109_0275503 | 3300048912 | Bacteria | 1585 |
| 484 | Ga0496109_0826834 | 3300048912 | Bacteria | 864 |
| 485 | Ga0496109_1319780 | 3300048912 | Bacteria | 657 |
| 486 | Ga0496109_1859614 | 3300048912 | Bacteria | 535 |
| 487 | Ga0496110_0012988 | 3300048913 | Bacteria | 6869 |
| 488 | Ga0496110_0023891 | 3300048913 | Bacteria | 5204 |
| 489 | Ga0496110_0067046 | 3300048913 | Bacteria | 3175 |
| 490 | Ga0496110_0770476 | 3300048913 | Bacteria | 866 |
| 491 | Ga0496110_0774559 | 3300048913 | Bacteria | 863 |
| 492 | Ga0496110_0786753 | 3300048913 | Bacteria | 855 |
| 493 | Ga0496111_0017497 | 3300048914 | Bacteria | 4956 |
| 494 | Ga0496111_0020929 | 3300048914 | Bacteria | 4561 |
| 495 | Ga0496111_0072632 | 3300048914 | Bacteria | 2504 |
| 496 | Ga0496111_1157743 | 3300048914 | Bacteria | 549 |
| 497 | Ga0496112_0001908 | 3300048915 | Bacteria | 16451 |
| 498 | Ga0496112_0024686 | 3300048915 | Bacteria | 5762 |
| 499 | Ga0496112_0600883 | 3300048915 | Bacteria | 1032 |
| 500 | Ga0496112_1209764 | 3300048915 | Bacteria | 672 |
| 501 | Ga0496113_0020528 | 3300048916 | Bacteria | 4646 |
| 502 | Ga0496113_0183034 | 3300048916 | Bacteria | 1661 |
| 503 | Ga0496113_0321476 | 3300048916 | Bacteria | 1240 |
| 504 | Ga0496114_0003588 | 3300048917 | Bacteria | 11923 |
| 505 | Ga0496114_0007081 | 3300048917 | Bacteria | 8850 |
| 506 | Ga0496114_0010348 | 3300048917 | Bacteria | 7421 |
| 507 | Ga0496114_0056388 | 3300048917 | Bacteria | 3279 |
| 508 | Ga0496114_0095672 | 3300048917 | Bacteria | 2528 |
| 509 | Ga0496114_0305564 | 3300048917 | Bacteria | 1405 |
| 510 | Ga0496114_0549214 | 3300048917 | Bacteria | 1021 |
| 511 | Ga0496114_0738556 | 3300048917 | Bacteria | 861 |
| 512 | Ga0496114_0875287 | 3300048917 | Bacteria | 779 |
| 513 | Ga0496114_1135113 | 3300048917 | Bacteria | 667 |
| 514 | Ga0496114_1430400 | 3300048917 | Bacteria | 579 |
| 515 | Ga0496114_1448786 | 3300048917 | Bacteria | 574 |
| 516 | Ga0496114_1764171 | 3300048917 | Bacteria | 507 |
| 517 | Ga0496115_0231180 | 3300048918 | Bacteria | 1525 |
| 518 | Ga0496126_0456924 | 3300048929 | Bacteria | 1027 |
| 519 | Ga0501034_0114904 | 3300049571 | Bacteria | 2680 |
| 520 | Ga0501040_1090376 | 3300049576 | Bacteria | 579 |
| 521 | Ga0501067_0053080 | 3300049583 | Bacteria | 2246 |
| 522 | Ga0501068_0118815 | 3300049584 | Bacteria | 1647 |
| 523 | Ga0501069_0033958 | 3300049585 | Bacteria | 2810 |
| 524 | Ga0501045_0143225 | 3300049824 | Bacteria | 1778 |
| 525 | nmdc:mga03n38_30463_c1 | 3300050490 | Bacteria | 2269 |
| 526 | nmdc:mga00v17_76444_c1 | 3300050491 | Bacteria | 2083 |
| 527 | nmdc:mga06z11_32578_c1 | 3300050494 | Bacteria | 2543 |
| 528 | nmdc:mga04h51_20444_c1 | 3300050495 | Bacteria | 1977 |
| 529 | nmdc:mga05p37_1271663_c1 | 3300050507 | Bacteria | 753 |
| 530 | nmdc:mga05p37_225573_c1 | 3300050507 | Bacteria | 2259 |
| 531 | nmdc:mga09592_822492_c1 | 3300050508 | Bacteria | 785 |
| 532 | nmdc:mga0qj67_524565_c1 | 3300050509 | Bacteria | 951 |
| 533 | nmdc:mga0n895_612536_c1 | 3300050512 | Bacteria | 1090 |
| 534 | nmdc:mga0n895_87868_c1 | 3300050512 | Bacteria | 3107 |
| 535 | nmdc:mga0rr50_192639_c1 | 3300050513 | Bacteria | 1672 |
| 536 | nmdc:mga0rr50_212576_c1 | 3300050513 | Bacteria | 1594 |
| 537 | nmdc:mga08x19_568526_c1 | 3300050514 | Bacteria | 803 |
| 538 | nmdc:mga08x19_819724_c1 | 3300050514 | Bacteria | 661 |
| 539 | nmdc:mga0a205_164790_c1 | 3300050515 | Bacteria | 2112 |
| 540 | Ga0495601_0047053 | 3300053077 | Bacteria | 2715 |
| 541 | Ga0495601_0176540 | 3300053077 | Bacteria | 1396 |
| 542 | Ga0495601_0192802 | 3300053077 | Bacteria | 1332 |
| 543 | Ga0495612_0039973 | 3300053078 | Bacteria | 1909 |
| 544 | Ga0500635_0000073 | 3300053080 | Bacteria | 65023 |
| 545 | Ga0495619_0073284 | 3300053085 | Bacteria | 2294 |
| 546 | Ga0495619_0420434 | 3300053085 | Bacteria | 922 |
| 547 | Ga0500644_0000299 | 3300053088 | Bacteria | 26587 |
| 548 | Ga0500644_0446015 | 3300053088 | Bacteria | 567 |
| 549 | Ga0500654_207985 | 3300053099 | Bacteria | 578 |
| 550 | Ga0500556_0001027 | 3300053104 | Bacteria | 14597 |
| 551 | Ga0500628_030718 | 3300053129 | Bacteria | 1164 |
| 552 | Ga0500628_190598 | 3300053129 | Bacteria | 588 |
| 553 | Ga0500573_0113042 | 3300053140 | Bacteria | 1518 |
| 554 | Ga0500616_0000097 | 3300053153 | Bacteria | 178988 |
| 555 | Ga0466962_0008377 | 3300061719 | Bacteria | 4955 |
| 556 | Ga0466962_0193689 | 3300061719 | Bacteria | 992 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_1126341 | Ga0395901_1126341_419_739 | 98 |
| 2 | 3300014325 | Ga0163163_13025764 | Ga0163163_130257642 | 102 |
| 3 | 3300026067 | Ga0207678_11148941 | Ga0207678_111489412 | 102 |
| 4 | iso_pu_bacteria | 2919051321 | 2919053957 | 103 |
| 5 | 3300009177 | Ga0105248_13237847 | Ga0105248_132378472 | 106 |
| 6 | 3300021388 | Ga0213875_10324379 | Ga0213875_103243792 | 106 |
| 7 | 3300025981 | Ga0207640_10246556 | Ga0207640_102465561 | 106 |
| 8 | 3300028379 | Ga0268266_10021956 | Ga0268266_100219566 | 106 |
| 9 | 3300028786 | Ga0307517_10087877 | Ga0307517_100878771 | 106 |
| 10 | 3300031824 | Ga0307413_10177625 | Ga0307413_101776252 | 106 |
| 11 | 3300031852 | Ga0307410_10593822 | Ga0307410_105938222 | 106 |
| 12 | 3300031901 | Ga0307406_10058765 | Ga0307406_100587654 | 106 |
| 13 | 3300031901 | Ga0307406_11256910 | Ga0307406_112569101 | 106 |
| 14 | 3300031903 | Ga0307407_10528372 | Ga0307407_105283722 | 106 |
| 15 | 3300031911 | Ga0307412_10398278 | Ga0307412_103982782 | 106 |
| 16 | 3300032002 | Ga0307416_100171065 | Ga0307416_1001710652 | 106 |
| 17 | 3300032004 | Ga0307414_11995761 | Ga0307414_119957612 | 106 |
| 18 | 3300032126 | Ga0307415_100113418 | Ga0307415_1001134183 | 106 |
| 19 | 3300032126 | Ga0307415_100498998 | Ga0307415_1004989982 | 106 |
| 20 | 3300037853 | Ga0436364_0226122 | Ga0436364_0226122_56_400 | 106 |
| 21 | 3300037853 | Ga0436364_0808660 | Ga0436364_0808660_191_526 | 106 |
| 22 | 3300039450 | Ga0436363_1185957 | Ga0436363_1185957_317_652 | 106 |
| 23 | 3300041453 | Ga0451797_1073397 | Ga0451797_1073397_71_406 | 106 |
| 24 | 3300044683 | Ga0466965_0000003 | Ga0466965_0000003_98788_99120 | 106 |
| 25 | 3300049571 | Ga0501034_0114904 | Ga0501034_0114904_2164_2493 | 106 |
| 26 | 3300053088 | Ga0500644_0446015 | Ga0500644_0446015_188_523 | 106 |
| 27 | 3300053129 | Ga0500628_190598 | Ga0500628_190598_201_536 | 106 |
| 28 | 3300001990 | JGI24737J22298_10089321 | JGI24737J22298_100893211 | 107 |
| 29 | 3300002067 | JGI24735J21928_10018658 | JGI24735J21928_100186582 | 107 |
| 30 | 3300002075 | JGI24738J21930_10139294 | JGI24738J21930_101392942 | 107 |
| 31 | 3300003320 | rootH2_10106357 | rootH2_101063572 | 107 |
| 32 | 3300003373 | JGI25407J50210_10001381 | JGI25407J50210_100013812 | 107 |
| 33 | 3300003373 | JGI25407J50210_10034201 | JGI25407J50210_100342012 | 107 |
| 34 | 3300005327 | Ga0070658_10490348 | Ga0070658_104903482 | 107 |
| 35 | 3300005329 | Ga0070683_100018203 | Ga0070683_1000182037 | 107 |
| 36 | 3300005329 | Ga0070683_100329420 | Ga0070683_1003294203 | 107 |
| 37 | 3300005329 | Ga0070683_101561600 | Ga0070683_1015616001 | 107 |
| 38 | 3300005334 | Ga0068869_100536724 | Ga0068869_1005367242 | 107 |
| 39 | 3300005335 | Ga0070666_10445098 | Ga0070666_104450982 | 107 |
| 40 | 3300005337 | Ga0070682_100261076 | Ga0070682_1002610762 | 107 |
| 41 | 3300005337 | Ga0070682_100420290 | Ga0070682_1004202902 | 107 |
| 42 | 3300005337 | Ga0070682_100652070 | Ga0070682_1006520703 | 107 |
| 43 | 3300005338 | Ga0068868_100423657 | Ga0068868_1004236573 | 107 |
| 44 | 3300005338 | Ga0068868_100499768 | Ga0068868_1004997682 | 107 |
| 45 | 3300005339 | Ga0070660_100019265 | Ga0070660_1000192653 | 107 |
| 46 | 3300005343 | Ga0070687_100055860 | Ga0070687_1000558602 | 107 |
| 47 | 3300005343 | Ga0070687_100464536 | Ga0070687_1004645362 | 107 |
| 48 | 3300005344 | Ga0070661_101271682 | Ga0070661_1012716821 | 107 |
| 49 | 3300005345 | Ga0070692_10008668 | Ga0070692_100086682 | 107 |
| 50 | 3300005355 | Ga0070671_100962308 | Ga0070671_1009623081 | 107 |
| 51 | 3300005365 | Ga0070688_100690477 | Ga0070688_1006904771 | 107 |
| 52 | 3300005366 | Ga0070659_100230134 | Ga0070659_1002301343 | 107 |
| 53 | 3300005435 | Ga0070714_100315223 | Ga0070714_1003152232 | 107 |
| 54 | 3300005436 | Ga0070713_100025848 | Ga0070713_1000258486 | 107 |
| 55 | 3300005437 | Ga0070710_10124001 | Ga0070710_101240012 | 107 |
| 56 | 3300005439 | Ga0070711_100444722 | Ga0070711_1004447222 | 107 |
| 57 | 3300005439 | Ga0070711_100502576 | Ga0070711_1005025762 | 107 |
| 58 | 3300005441 | Ga0070700_100339430 | Ga0070700_1003394301 | 107 |
| 59 | 3300005441 | Ga0070700_101663568 | Ga0070700_1016635681 | 107 |
| 60 | 3300005444 | Ga0070694_101128766 | Ga0070694_1011287662 | 107 |
| 61 | 3300005455 | Ga0070663_100901091 | Ga0070663_1009010911 | 107 |
| 62 | 3300005456 | Ga0070678_100046584 | Ga0070678_1000465842 | 107 |
| 63 | 3300005456 | Ga0070678_100601518 | Ga0070678_1006015182 | 107 |
| 64 | 3300005456 | Ga0070678_101006260 | Ga0070678_1010062601 | 107 |
| 65 | 3300005456 | Ga0070678_101441205 | Ga0070678_1014412051 | 107 |
| 66 | 3300005457 | Ga0070662_100180012 | Ga0070662_1001800122 | 107 |
| 67 | 3300005458 | Ga0070681_11923662 | Ga0070681_119236621 | 107 |
| 68 | 3300005459 | Ga0068867_100266791 | Ga0068867_1002667911 | 107 |
| 69 | 3300005459 | Ga0068867_100705570 | Ga0068867_1007055701 | 107 |
| 70 | 3300005466 | Ga0070685_11126139 | Ga0070685_111261391 | 107 |
| 71 | 3300005466 | Ga0070685_11503795 | Ga0070685_115037951 | 107 |
| 72 | 3300005467 | Ga0070706_100822227 | Ga0070706_1008222272 | 107 |
| 73 | 3300005530 | Ga0070679_102026395 | Ga0070679_1020263951 | 107 |
| 74 | 3300005535 | Ga0070684_100112035 | Ga0070684_1001120352 | 107 |
| 75 | 3300005535 | Ga0070684_100364598 | Ga0070684_1003645982 | 107 |
| 76 | 3300005535 | Ga0070684_100395067 | Ga0070684_1003950672 | 107 |
| 77 | 3300005535 | Ga0070684_100926536 | Ga0070684_1009265362 | 107 |
| 78 | 3300005539 | Ga0068853_100178734 | Ga0068853_1001787343 | 107 |
| 79 | 3300005539 | Ga0068853_101857185 | Ga0068853_1018571852 | 107 |
| 80 | 3300005543 | Ga0070672_100543988 | Ga0070672_1005439882 | 107 |
| 81 | 3300005544 | Ga0070686_100889692 | Ga0070686_1008896922 | 107 |
| 82 | 3300005547 | Ga0070693_100192950 | Ga0070693_1001929502 | 107 |
| 83 | 3300005548 | Ga0070665_100336579 | Ga0070665_1003365792 | 107 |
| 84 | 3300005548 | Ga0070665_101051974 | Ga0070665_1010519741 | 107 |
| 85 | 3300005549 | Ga0070704_101302327 | Ga0070704_1013023271 | 107 |
| 86 | 3300005563 | Ga0068855_100016350 | Ga0068855_1000163507 | 107 |
| 87 | 3300005563 | Ga0068855_100871713 | Ga0068855_1008717132 | 107 |
| 88 | 3300005563 | Ga0068855_101611243 | Ga0068855_1016112432 | 107 |
| 89 | 3300005564 | Ga0070664_100120263 | Ga0070664_1001202632 | 107 |
| 90 | 3300005564 | Ga0070664_101754262 | Ga0070664_1017542622 | 107 |
| 91 | 3300005614 | Ga0068856_100068034 | Ga0068856_1000680342 | 107 |
| 92 | 3300005614 | Ga0068856_100513810 | Ga0068856_1005138102 | 107 |
| 93 | 3300005614 | Ga0068856_100892743 | Ga0068856_1008927431 | 107 |
| 94 | 3300005614 | Ga0068856_101022472 | Ga0068856_1010224722 | 107 |
| 95 | 3300005615 | Ga0070702_100446774 | Ga0070702_1004467741 | 107 |
| 96 | 3300005615 | Ga0070702_100551342 | Ga0070702_1005513422 | 107 |
| 97 | 3300005615 | Ga0070702_101024491 | Ga0070702_1010244911 | 107 |
| 98 | 3300005615 | Ga0070702_101113078 | Ga0070702_1011130781 | 107 |
| 99 | 3300005616 | Ga0068852_100118122 | Ga0068852_1001181222 | 107 |
| 100 | 3300005616 | Ga0068852_100804997 | Ga0068852_1008049971 | 107 |
| 101 | 3300005616 | Ga0068852_102816450 | Ga0068852_1028164502 | 107 |
| 102 | 3300005618 | Ga0068864_100278366 | Ga0068864_1002783662 | 107 |
| 103 | 3300005718 | Ga0068866_10571532 | Ga0068866_105715322 | 107 |
| 104 | 3300005840 | Ga0068870_11203159 | Ga0068870_112031592 | 107 |
| 105 | 3300005842 | Ga0068858_100301419 | Ga0068858_1003014192 | 107 |
| 106 | 3300005843 | Ga0068860_100136066 | Ga0068860_1001360662 | 107 |
| 107 | 3300005937 | Ga0081455_10088822 | Ga0081455_100888224 | 107 |
| 108 | 3300005981 | Ga0081538_10001721 | Ga0081538_1000172112 | 107 |
| 109 | 3300005981 | Ga0081538_10162566 | Ga0081538_101625661 | 107 |
| 110 | 3300005983 | Ga0081540_1006883 | Ga0081540_10068832 | 107 |
| 111 | 3300005983 | Ga0081540_1184967 | Ga0081540_11849672 | 107 |
| 112 | 3300006028 | Ga0070717_10156835 | Ga0070717_101568352 | 107 |
| 113 | 3300006028 | Ga0070717_10159086 | Ga0070717_101590862 | 107 |
| 114 | 3300006048 | Ga0075363_100007636 | Ga0075363_1000076365 | 107 |
| 115 | 3300006048 | Ga0075363_100354028 | Ga0075363_1003540282 | 107 |
| 116 | 3300006051 | Ga0075364_10054319 | Ga0075364_100543193 | 107 |
| 117 | 3300006163 | Ga0070715_10239027 | Ga0070715_102390271 | 107 |
| 118 | 3300006173 | Ga0070716_100006634 | Ga0070716_1000066348 | 107 |
| 119 | 3300006173 | Ga0070716_101211553 | Ga0070716_1012115531 | 107 |
| 120 | 3300006178 | Ga0075367_10007311 | Ga0075367_100073114 | 107 |
| 121 | 3300006237 | Ga0097621_100449730 | Ga0097621_1004497303 | 107 |
| 122 | 3300006237 | Ga0097621_100901207 | Ga0097621_1009012071 | 107 |
| 123 | 3300006353 | Ga0075370_10170256 | Ga0075370_101702562 | 107 |
| 124 | 3300006358 | Ga0068871_100172135 | Ga0068871_1001721352 | 107 |
| 125 | 3300006358 | Ga0068871_101311603 | Ga0068871_1013116032 | 107 |
| 126 | 3300006844 | Ga0075428_100202463 | Ga0075428_1002024633 | 107 |
| 127 | 3300006847 | Ga0075431_100559060 | Ga0075431_1005590601 | 107 |
| 128 | 3300006852 | Ga0075433_10226844 | Ga0075433_102268442 | 107 |
| 129 | 3300006871 | Ga0075434_100169029 | Ga0075434_1001690292 | 107 |
| 130 | 3300006871 | Ga0075434_101715275 | Ga0075434_1017152751 | 107 |
| 131 | 3300006880 | Ga0075429_101014354 | Ga0075429_1010143542 | 107 |
| 132 | 3300006881 | Ga0068865_100164768 | Ga0068865_1001647682 | 107 |
| 133 | 3300006881 | Ga0068865_101041383 | Ga0068865_1010413832 | 107 |
| 134 | 3300006914 | Ga0075436_100826849 | Ga0075436_1008268492 | 107 |
| 135 | 3300007076 | Ga0075435_100306903 | Ga0075435_1003069032 | 107 |
| 136 | 3300007076 | Ga0075435_100561888 | Ga0075435_1005618882 | 107 |
| 137 | 3300009011 | Ga0105251_10325299 | Ga0105251_103252992 | 107 |
| 138 | 3300009093 | Ga0105240_10037410 | Ga0105240_100374104 | 107 |
| 139 | 3300009098 | Ga0105245_10028880 | Ga0105245_100288803 | 107 |
| 140 | 3300009098 | Ga0105245_10320557 | Ga0105245_103205572 | 107 |
| 141 | 3300009098 | Ga0105245_10415152 | Ga0105245_104151522 | 107 |
| 142 | 3300009101 | Ga0105247_11467829 | Ga0105247_114678292 | 107 |
| 143 | 3300009147 | Ga0114129_10288302 | Ga0114129_102883021 | 107 |
| 144 | 3300009147 | Ga0114129_11363364 | Ga0114129_113633642 | 107 |
| 145 | 3300009148 | Ga0105243_10179176 | Ga0105243_101791762 | 107 |
| 146 | 3300009148 | Ga0105243_10247054 | Ga0105243_102470542 | 107 |
| 147 | 3300009148 | Ga0105243_10402423 | Ga0105243_104024232 | 107 |
| 148 | 3300009148 | Ga0105243_11015668 | Ga0105243_110156681 | 107 |
| 149 | 3300009148 | Ga0105243_11759686 | Ga0105243_117596862 | 107 |
| 150 | 3300009174 | Ga0105241_10270980 | Ga0105241_102709802 | 107 |
| 151 | 3300009176 | Ga0105242_10250443 | Ga0105242_102504432 | 107 |
| 152 | 3300009176 | Ga0105242_10727820 | Ga0105242_107278201 | 107 |
| 153 | 3300009177 | Ga0105248_10344292 | Ga0105248_103442922 | 107 |
| 154 | 3300009177 | Ga0105248_11302315 | Ga0105248_113023151 | 107 |
| 155 | 3300009545 | Ga0105237_10122838 | Ga0105237_101228382 | 107 |
| 156 | 3300009545 | Ga0105237_10588724 | Ga0105237_105887242 | 107 |
| 157 | 3300009545 | Ga0105237_10821519 | Ga0105237_108215192 | 107 |
| 158 | 3300009545 | Ga0105237_11086709 | Ga0105237_110867091 | 107 |
| 159 | 3300009551 | Ga0105238_10146571 | Ga0105238_101465713 | 107 |
| 160 | 3300009551 | Ga0105238_10464789 | Ga0105238_104647892 | 107 |
| 161 | 3300009551 | Ga0105238_11835058 | Ga0105238_118350582 | 107 |
| 162 | 3300009553 | Ga0105249_10101727 | Ga0105249_101017273 | 107 |
| 163 | 3300009553 | Ga0105249_12603226 | Ga0105249_126032262 | 107 |
| 164 | 3300010375 | Ga0105239_10066882 | Ga0105239_100668823 | 107 |
| 165 | 3300010375 | Ga0105239_10240544 | Ga0105239_102405443 | 107 |
| 166 | 3300010375 | Ga0105239_10273914 | Ga0105239_102739143 | 107 |
| 167 | 3300011119 | Ga0105246_10862592 | Ga0105246_108625922 | 107 |
| 168 | 3300011119 | Ga0105246_10977846 | Ga0105246_109778461 | 107 |
| 169 | 3300012488 | Ga0157343_1011842 | Ga0157343_10118422 | 107 |
| 170 | 3300013102 | Ga0157371_10188884 | Ga0157371_101888842 | 107 |
| 171 | 3300013102 | Ga0157371_11184689 | Ga0157371_111846892 | 107 |
| 172 | 3300013104 | Ga0157370_10435739 | Ga0157370_104357392 | 107 |
| 173 | 3300013105 | Ga0157369_10137192 | Ga0157369_101371921 | 107 |
| 174 | 3300013105 | Ga0157369_10328217 | Ga0157369_103282172 | 107 |
| 175 | 3300013105 | Ga0157369_11003227 | Ga0157369_110032272 | 107 |
| 176 | 3300013105 | Ga0157369_11135849 | Ga0157369_111358492 | 107 |
| 177 | 3300013296 | Ga0157374_10286378 | Ga0157374_102863782 | 107 |
| 178 | 3300013306 | Ga0163162_10098296 | Ga0163162_100982961 | 107 |
| 179 | 3300013306 | Ga0163162_10196025 | Ga0163162_101960252 | 107 |
| 180 | 3300013306 | Ga0163162_10660496 | Ga0163162_106604963 | 107 |
| 181 | 3300013306 | Ga0163162_11880622 | Ga0163162_118806221 | 107 |
| 182 | 3300013306 | Ga0163162_11917934 | Ga0163162_119179342 | 107 |
| 183 | 3300013307 | Ga0157372_10000123 | Ga0157372_1000012350 | 107 |
| 184 | 3300013307 | Ga0157372_10602010 | Ga0157372_106020103 | 107 |
| 185 | 3300013307 | Ga0157372_11215871 | Ga0157372_112158712 | 107 |
| 186 | 3300013307 | Ga0157372_11983875 | Ga0157372_119838751 | 107 |
| 187 | 3300013308 | Ga0157375_10063855 | Ga0157375_100638554 | 107 |
| 188 | 3300013308 | Ga0157375_10092910 | Ga0157375_100929102 | 107 |
| 189 | 3300013308 | Ga0157375_10305162 | Ga0157375_103051622 | 107 |
| 190 | 3300013308 | Ga0157375_11536604 | Ga0157375_115366042 | 107 |
| 191 | 3300013308 | Ga0157375_12060267 | Ga0157375_120602671 | 107 |
| 192 | 3300013308 | Ga0157375_12604607 | Ga0157375_126046072 | 107 |
| 193 | 3300013308 | Ga0157375_13172144 | Ga0157375_131721442 | 107 |
| 194 | 3300014325 | Ga0163163_10216503 | Ga0163163_102165033 | 107 |
| 195 | 3300014325 | Ga0163163_10461282 | Ga0163163_104612821 | 107 |
| 196 | 3300014325 | Ga0163163_10491196 | Ga0163163_104911961 | 107 |
| 197 | 3300014325 | Ga0163163_11720925 | Ga0163163_117209251 | 107 |
| 198 | 3300014325 | Ga0163163_12253266 | Ga0163163_122532661 | 107 |
| 199 | 3300014325 | Ga0163163_12517712 | Ga0163163_125177121 | 107 |
| 200 | 3300014326 | Ga0157380_10455749 | Ga0157380_104557491 | 107 |
| 201 | 3300014326 | Ga0157380_10680704 | Ga0157380_106807041 | 107 |
| 202 | 3300014326 | Ga0157380_12310469 | Ga0157380_123104691 | 107 |
| 203 | 3300014745 | Ga0157377_10362697 | Ga0157377_103626972 | 107 |
| 204 | 3300014968 | Ga0157379_10911591 | Ga0157379_109115912 | 107 |
| 205 | 3300014969 | Ga0157376_10715763 | Ga0157376_107157631 | 107 |
| 206 | 3300014969 | Ga0157376_10772182 | Ga0157376_107721822 | 107 |
| 207 | 3300014969 | Ga0157376_11570818 | Ga0157376_115708182 | 107 |
| 208 | 3300017792 | Ga0163161_10525037 | Ga0163161_105250372 | 107 |
| 209 | 3300017792 | Ga0163161_10958578 | Ga0163161_109585781 | 107 |
| 210 | 3300020081 | Ga0206354_11138012 | Ga0206354_111380122 | 107 |
| 211 | 3300020082 | Ga0206353_10784518 | Ga0206353_107845182 | 107 |
| 212 | 3300020082 | Ga0206353_11703250 | Ga0206353_117032502 | 107 |
| 213 | 3300021388 | Ga0213875_10040024 | Ga0213875_100400242 | 107 |
| 214 | 3300021388 | Ga0213875_10238549 | Ga0213875_102385492 | 107 |
| 215 | 3300022467 | Ga0224712_10211468 | Ga0224712_102114682 | 107 |
| 216 | 3300025315 | Ga0207697_10320354 | Ga0207697_103203542 | 107 |
| 217 | 3300025898 | Ga0207692_10223964 | Ga0207692_102239641 | 107 |
| 218 | 3300025901 | Ga0207688_10425227 | Ga0207688_104252272 | 107 |
| 219 | 3300025901 | Ga0207688_10628843 | Ga0207688_106288432 | 107 |
| 220 | 3300025903 | Ga0207680_10478386 | Ga0207680_104783862 | 107 |
| 221 | 3300025904 | Ga0207647_10047505 | Ga0207647_100475053 | 107 |
| 222 | 3300025904 | Ga0207647_10141123 | Ga0207647_101411232 | 107 |
| 223 | 3300025905 | Ga0207685_10290159 | Ga0207685_102901591 | 107 |
| 224 | 3300025906 | Ga0207699_10485617 | Ga0207699_104856172 | 107 |
| 225 | 3300025908 | Ga0207643_10621628 | Ga0207643_106216281 | 107 |
| 226 | 3300025909 | Ga0207705_11048221 | Ga0207705_110482212 | 107 |
| 227 | 3300025910 | Ga0207684_10164984 | Ga0207684_101649843 | 107 |
| 228 | 3300025911 | Ga0207654_10521045 | Ga0207654_105210452 | 107 |
| 229 | 3300025913 | Ga0207695_10298701 | Ga0207695_102987011 | 107 |
| 230 | 3300025914 | Ga0207671_11588240 | Ga0207671_115882401 | 107 |
| 231 | 3300025915 | Ga0207693_10085606 | Ga0207693_100856062 | 107 |
| 232 | 3300025915 | Ga0207693_10382654 | Ga0207693_103826542 | 107 |
| 233 | 3300025916 | Ga0207663_10956147 | Ga0207663_109561471 | 107 |
| 234 | 3300025918 | Ga0207662_10069697 | Ga0207662_100696972 | 107 |
| 235 | 3300025918 | Ga0207662_10253327 | Ga0207662_102533271 | 107 |
| 236 | 3300025919 | Ga0207657_10030115 | Ga0207657_100301154 | 107 |
| 237 | 3300025920 | Ga0207649_10320886 | Ga0207649_103208861 | 107 |
| 238 | 3300025920 | Ga0207649_10867356 | Ga0207649_108673562 | 107 |
| 239 | 3300025921 | Ga0207652_11677771 | Ga0207652_116777711 | 107 |
| 240 | 3300025923 | Ga0207681_11608290 | Ga0207681_116082901 | 107 |
| 241 | 3300025924 | Ga0207694_10246338 | Ga0207694_102463382 | 107 |
| 242 | 3300025924 | Ga0207694_10431523 | Ga0207694_104315232 | 107 |
| 243 | 3300025927 | Ga0207687_10096703 | Ga0207687_100967031 | 107 |
| 244 | 3300025927 | Ga0207687_10450104 | Ga0207687_104501042 | 107 |
| 245 | 3300025927 | Ga0207687_10751936 | Ga0207687_107519362 | 107 |
| 246 | 3300025928 | Ga0207700_10006621 | Ga0207700_100066212 | 107 |
| 247 | 3300025929 | Ga0207664_10032117 | Ga0207664_100321172 | 107 |
| 248 | 3300025929 | Ga0207664_10227675 | Ga0207664_102276751 | 107 |
| 249 | 3300025931 | Ga0207644_11455556 | Ga0207644_114555562 | 107 |
| 250 | 3300025933 | Ga0207706_11382855 | Ga0207706_113828552 | 107 |
| 251 | 3300025934 | Ga0207686_10814022 | Ga0207686_108140222 | 107 |
| 252 | 3300025934 | Ga0207686_11194496 | Ga0207686_111944962 | 107 |
| 253 | 3300025935 | Ga0207709_10823771 | Ga0207709_108237711 | 107 |
| 254 | 3300025937 | Ga0207669_10378173 | Ga0207669_103781731 | 107 |
| 255 | 3300025938 | Ga0207704_10205896 | Ga0207704_102058962 | 107 |
| 256 | 3300025938 | Ga0207704_11789288 | Ga0207704_117892882 | 107 |
| 257 | 3300025939 | Ga0207665_10038727 | Ga0207665_100387274 | 107 |
| 258 | 3300025944 | Ga0207661_10022270 | Ga0207661_100222701 | 107 |
| 259 | 3300025944 | Ga0207661_10080808 | Ga0207661_100808083 | 107 |
| 260 | 3300025944 | Ga0207661_10569022 | Ga0207661_105690222 | 107 |
| 261 | 3300025945 | Ga0207679_10149892 | Ga0207679_101498923 | 107 |
| 262 | 3300025945 | Ga0207679_10247084 | Ga0207679_102470842 | 107 |
| 263 | 3300025945 | Ga0207679_11161182 | Ga0207679_111611822 | 107 |
| 264 | 3300025949 | Ga0207667_10028269 | Ga0207667_100282692 | 107 |
| 265 | 3300025949 | Ga0207667_10087055 | Ga0207667_100870552 | 107 |
| 266 | 3300025949 | Ga0207667_11825913 | Ga0207667_118259132 | 107 |
| 267 | 3300025961 | Ga0207712_10382181 | Ga0207712_103821812 | 107 |
| 268 | 3300025981 | Ga0207640_11321741 | Ga0207640_113217412 | 107 |
| 269 | 3300025986 | Ga0207658_10946151 | Ga0207658_109461511 | 107 |
| 270 | 3300026023 | Ga0207677_10590047 | Ga0207677_105900471 | 107 |
| 271 | 3300026035 | Ga0207703_10241469 | Ga0207703_102414692 | 107 |
| 272 | 3300026035 | Ga0207703_11149589 | Ga0207703_111495891 | 107 |
| 273 | 3300026035 | Ga0207703_11559466 | Ga0207703_115594661 | 107 |
| 274 | 3300026067 | Ga0207678_10435382 | Ga0207678_104353822 | 107 |
| 275 | 3300026067 | Ga0207678_10671168 | Ga0207678_106711682 | 107 |
| 276 | 3300026075 | Ga0207708_10486792 | Ga0207708_104867922 | 107 |
| 277 | 3300026078 | Ga0207702_10135275 | Ga0207702_101352752 | 107 |
| 278 | 3300026078 | Ga0207702_10136624 | Ga0207702_101366242 | 107 |
| 279 | 3300026078 | Ga0207702_10475512 | Ga0207702_104755122 | 107 |
| 280 | 3300026078 | Ga0207702_10507720 | Ga0207702_105077201 | 107 |
| 281 | 3300026078 | Ga0207702_11705191 | Ga0207702_117051912 | 107 |
| 282 | 3300026088 | Ga0207641_10835741 | Ga0207641_108357411 | 107 |
| 283 | 3300026095 | Ga0207676_10200729 | Ga0207676_102007292 | 107 |
| 284 | 3300026116 | Ga0207674_11200070 | Ga0207674_112000701 | 107 |
| 285 | 3300026118 | Ga0207675_100258670 | Ga0207675_1002586702 | 107 |
| 286 | 3300026121 | Ga0207683_10019524 | Ga0207683_100195242 | 107 |
| 287 | 3300026121 | Ga0207683_10331711 | Ga0207683_103317111 | 107 |
| 288 | 3300026121 | Ga0207683_10951875 | Ga0207683_109518752 | 107 |
| 289 | 3300026121 | Ga0207683_11684121 | Ga0207683_116841212 | 107 |
| 290 | 3300026121 | Ga0207683_11930677 | Ga0207683_119306771 | 107 |
| 291 | 3300026142 | Ga0207698_10623327 | Ga0207698_106233272 | 107 |
| 292 | 3300026142 | Ga0207698_10782045 | Ga0207698_107820452 | 107 |
| 293 | 3300026142 | Ga0207698_11630341 | Ga0207698_116303411 | 107 |
| 294 | 3300026142 | Ga0207698_11751445 | Ga0207698_117514451 | 107 |
| 295 | 3300028379 | Ga0268266_10354549 | Ga0268266_103545492 | 107 |
| 296 | 3300028379 | Ga0268266_10441782 | Ga0268266_104417821 | 107 |
| 297 | 3300028380 | Ga0268265_11094367 | Ga0268265_110943672 | 107 |
| 298 | 3300028794 | Ga0307515_10229481 | Ga0307515_102294812 | 107 |
| 299 | 3300028794 | Ga0307515_10694527 | Ga0307515_106945271 | 107 |
| 300 | 3300031456 | Ga0307513_10438339 | Ga0307513_104383392 | 107 |
| 301 | 3300031507 | Ga0307509_10159330 | Ga0307509_101593303 | 107 |
| 302 | 3300031616 | Ga0307508_10130910 | Ga0307508_101309104 | 107 |
| 303 | 3300031731 | Ga0307405_11181219 | Ga0307405_111812192 | 107 |
| 304 | 3300031824 | Ga0307413_10334850 | Ga0307413_103348502 | 107 |
| 305 | 3300031901 | Ga0307406_11395299 | Ga0307406_113952992 | 107 |
| 306 | 3300031901 | Ga0307406_11570389 | Ga0307406_115703891 | 107 |
| 307 | 3300031903 | Ga0307407_11111749 | Ga0307407_111117492 | 107 |
| 308 | 3300033179 | Ga0307507_10173008 | Ga0307507_101730081 | 107 |
| 309 | 3300035083 | Ga0373926_0277943 | Ga0373926_0277943_69_392 | 107 |
| 310 | 3300035089 | Ga0373944_0098413 | Ga0373944_0098413_342_665 | 107 |
| 311 | 3300035111 | Ga0373923_0048690 | Ga0373923_0048690_828_1151 | 107 |
| 312 | 3300035113 | Ga0373936_0043920 | Ga0373936_0043920_1173_1496 | 107 |
| 313 | 3300035118 | Ga0373954_0044920 | Ga0373954_0044920_160_483 | 107 |
| 314 | 3300035119 | Ga0373956_0002152 | Ga0373956_0002152_5849_6172 | 107 |
| 315 | 3300035120 | Ga0373957_0027648 | Ga0373957_0027648_1392_1715 | 107 |
| 316 | 3300035170 | Ga0373943_0212136 | Ga0373943_0212136_332_655 | 107 |
| 317 | 3300035172 | Ga0373955_0068220 | Ga0373955_0068220_690_1013 | 107 |
| 318 | 3300035410 | Ga0373924_0003360 | Ga0373924_0003360_787_1110 | 107 |
| 319 | 3300035691 | Ga0373931_0429550 | Ga0373931_0429550_148_471 | 107 |
| 320 | 3300035724 | Ga0373933_0000467 | Ga0373933_0000467_16146_16469 | 107 |
| 321 | 3300035725 | Ga0373947_0068714 | Ga0373947_0068714_302_625 | 107 |
| 322 | 3300035725 | Ga0373947_0094944 | Ga0373947_0094944_11_340 | 107 |
| 323 | 3300036401 | Ga0373937_0004282 | Ga0373937_0004282_8228_8551 | 107 |
| 324 | 3300036459 | Ga0372808_006475 | Ga0372808_006475_1097_1420 | 107 |
| 325 | 3300037068 | Ga0373925_0462713 | Ga0373925_0462713_391_714 | 107 |
| 326 | 3300037312 | Ga0395899_0126641 | Ga0395899_0126641_1307_1639 | 107 |
| 327 | 3300037466 | Ga0395898_1038426 | Ga0395898_1038426_57_389 | 107 |
| 328 | 3300037853 | Ga0436364_0033670 | Ga0436364_0033670_1606_1935 | 107 |
| 329 | 3300037853 | Ga0436364_0534556 | Ga0436364_0534556_1793_2116 | 107 |
| 330 | 3300038443 | Ga0395901_0159029 | Ga0395901_0159029_1544_1876 | 107 |
| 331 | 3300038996 | Ga0242420_051785 | Ga0242420_051785_96_419 | 107 |
| 332 | 3300041443 | Ga0451789_0114893 | Ga0451789_0114893_249_626 | 107 |
| 333 | 3300041443 | Ga0451789_1061075 | Ga0451789_1061075_51_374 | 107 |
| 334 | 3300041452 | Ga0451793_1363888 | Ga0451793_1363888_2892_3269 | 107 |
| 335 | 3300041452 | Ga0451793_1888304 | Ga0451793_1888304_146_469 | 107 |
| 336 | 3300041453 | Ga0451797_1007502 | Ga0451797_1007502_963_1340 | 107 |
| 337 | 3300041456 | Ga0451795_0564621 | Ga0451795_0564621_853_1230 | 107 |
| 338 | 3300041456 | Ga0451795_1447924 | Ga0451795_1447924_89_412 | 107 |
| 339 | 3300041459 | Ga0451800_0480215 | Ga0451800_0480215_105_482 | 107 |
| 340 | 3300041486 | Ga0451807_0741158 | Ga0451807_0741158_54_377 | 107 |
| 341 | 3300041491 | Ga0451833_1106133 | Ga0451833_1106133_84_407 | 107 |
| 342 | 3300041496 | Ga0451839_0263778 | Ga0451839_0263778_88_414 | 107 |
| 343 | 3300041496 | Ga0451839_0691447 | Ga0451839_0691447_751_1128 | 107 |
| 344 | 3300041496 | Ga0451839_0781426 | Ga0451839_0781426_40_363 | 107 |
| 345 | 3300041498 | Ga0451841_0761344 | Ga0451841_0761344_523_900 | 107 |
| 346 | 3300041505 | Ga0451849_0996445 | Ga0451849_0996445_360_737 | 107 |
| 347 | 3300041509 | Ga0451843_0550863 | Ga0451843_0550863_118_495 | 107 |
| 348 | 3300041511 | Ga0451855_0984818 | Ga0451855_0984818_93_470 | 107 |
| 349 | 3300041512 | Ga0451853_1384838 | Ga0451853_1384838_3010_3387 | 107 |
| 350 | 3300041512 | Ga0451853_3876009 | Ga0451853_3876009_65_400 | 107 |
| 351 | 3300044656 | Ga0466969_0289023 | Ga0466969_0289023_297_632 | 107 |
| 352 | 3300044658 | Ga0466972_0002240 | Ga0466972_0002240_6415_6807 | 107 |
| 353 | 3300044683 | Ga0466965_0027518 | Ga0466965_0027518_569_895 | 107 |
| 354 | 3300044684 | Ga0466966_0052309 | Ga0466966_0052309_1905_2240 | 107 |
| 355 | 3300044684 | Ga0466966_0237162 | Ga0466966_0237162_724_1056 | 107 |
| 356 | 3300044684 | Ga0466966_0427585 | Ga0466966_0427585_287_619 | 107 |
| 357 | 3300044693 | Ga0466961_0031502 | Ga0466961_0031502_787_1113 | 107 |
| 358 | 3300044693 | Ga0466961_0053936 | Ga0466961_0053936_228_563 | 107 |
| 359 | 3300044694 | Ga0466963_0017571 | Ga0466963_0017571_2872_3198 | 107 |
| 360 | 3300044694 | Ga0466963_0360957 | Ga0466963_0360957_512_853 | 107 |
| 361 | 3300044694 | Ga0466963_0944448 | Ga0466963_0944448_93_416 | 107 |
| 362 | 3300044706 | Ga0466964_0080688 | Ga0466964_0080688_644_967 | 107 |
| 363 | 3300044706 | Ga0466964_0096960 | Ga0466964_0096960_413_739 | 107 |
| 364 | 3300044706 | Ga0466964_0640875 | Ga0466964_0640875_96_467 | 107 |
| 365 | 3300044719 | Ga0466971_0002597 | Ga0466971_0002597_3606_3932 | 107 |
| 366 | 3300044735 | Ga0466968_0010062 | Ga0466968_0010062_2787_3113 | 107 |
| 367 | 3300044765 | Ga0466970_0627453 | Ga0466970_0627453_234_572 | 107 |
| 368 | 3300044842 | Ga0466957_0005581 | Ga0466957_0005581_6141_6467 | 107 |
| 369 | 3300044842 | Ga0466957_0271237 | Ga0466957_0271237_164_493 | 107 |
| 370 | 3300044842 | Ga0466957_0530903 | Ga0466957_0530903_62_385 | 107 |
| 371 | 3300044842 | Ga0466957_0617163 | Ga0466957_0617163_287_610 | 107 |
| 372 | 3300044901 | Ga0466960_0141020 | Ga0466960_0141020_740_1132 | 107 |
| 373 | 3300045049 | Ga0466959_0003017 | Ga0466959_0003017_9686_10021 | 107 |
| 374 | 3300045049 | Ga0466959_0010900 | Ga0466959_0010900_1492_1818 | 107 |
| 375 | 3300045049 | Ga0466959_0052008 | Ga0466959_0052008_2403_2735 | 107 |
| 376 | 3300045049 | Ga0466959_0158830 | Ga0466959_0158830_742_1065 | 107 |
| 377 | 3300045836 | Ga0466958_0016425 | Ga0466958_0016425_1553_1879 | 107 |
| 378 | 3300045836 | Ga0466958_0027033 | Ga0466958_0027033_319_642 | 107 |
| 379 | 3300045836 | Ga0466958_0884638 | Ga0466958_0884638_186_521 | 107 |
| 380 | 3300045976 | Ga0466967_0452415 | Ga0466967_0452415_550_873 | 107 |
| 381 | 3300046454 | Ga0495592_0008817 | Ga0495592_0008817_394_717 | 107 |
| 382 | 3300046454 | Ga0495592_0139356 | Ga0495592_0139356_105_428 | 107 |
| 383 | 3300046455 | Ga0495603_0128016 | Ga0495603_0128016_938_1261 | 107 |
| 384 | 3300046459 | Ga0495629_0200624 | Ga0495629_0200624_541_864 | 107 |
| 385 | 3300046461 | Ga0495641_0042112 | Ga0495641_0042112_832_1155 | 107 |
| 386 | 3300046462 | Ga0495651_0000424 | Ga0495651_0000424_9115_9438 | 107 |
| 387 | 3300046462 | Ga0495651_0213338 | Ga0495651_0213338_721_1044 | 107 |
| 388 | 3300046463 | Ga0495653_0016012 | Ga0495653_0016012_3541_3864 | 107 |
| 389 | 3300046473 | Ga0495582_0147830 | Ga0495582_0147830_118_441 | 107 |
| 390 | 3300046475 | Ga0495639_0198339 | Ga0495639_0198339_64_396 | 107 |
| 391 | 3300046475 | Ga0495639_0622613 | Ga0495639_0622613_129_452 | 107 |
| 392 | 3300046476 | Ga0495662_0029740 | Ga0495662_0029740_856_1179 | 107 |
| 393 | 3300046477 | Ga0495664_0062694 | Ga0495664_0062694_1482_1805 | 107 |
| 394 | 3300046477 | Ga0495664_0770264 | Ga0495664_0770264_175_498 | 107 |
| 395 | 3300046499 | Ga0495594_0761522 | Ga0495594_0761522_111_434 | 107 |
| 396 | 3300046511 | Ga0495608_0007454 | Ga0495608_0007454_238_561 | 107 |
| 397 | 3300046514 | Ga0495618_0009032 | Ga0495618_0009032_4536_4859 | 107 |
| 398 | 3300046516 | Ga0495628_0033351 | Ga0495628_0033351_3374_3697 | 107 |
| 399 | 3300046516 | Ga0495628_0147416 | Ga0495628_0147416_1041_1364 | 107 |
| 400 | 3300046517 | Ga0495630_0056342 | Ga0495630_0056342_2030_2353 | 107 |
| 401 | 3300046529 | Ga0495652_0000573 | Ga0495652_0000573_21561_21884 | 107 |
| 402 | 3300046529 | Ga0495652_0192418 | Ga0495652_0192418_429_752 | 107 |
| 403 | 3300046529 | Ga0495652_0749716 | Ga0495652_0749716_55_390 | 107 |
| 404 | 3300046531 | Ga0495665_0548293 | Ga0495665_0548293_35_358 | 107 |
| 405 | 3300046533 | Ga0495640_0005327 | Ga0495640_0005327_6954_7277 | 107 |
| 406 | 3300046536 | Ga0495587_0255675 | Ga0495587_0255675_69_392 | 107 |
| 407 | 3300046543 | Ga0495645_0128078 | Ga0495645_0128078_64_387 | 107 |
| 408 | 3300046543 | Ga0495645_0174846 | Ga0495645_0174846_69_398 | 107 |
| 409 | 3300046543 | Ga0495645_0238798 | Ga0495645_0238798_298_621 | 107 |
| 410 | 3300046559 | Ga0495667_0001456 | Ga0495667_0001456_2031_2354 | 107 |
| 411 | 3300046559 | Ga0495667_0352380 | Ga0495667_0352380_94_417 | 107 |
| 412 | 3300046559 | Ga0495667_0729173 | Ga0495667_0729173_36_371 | 107 |
| 413 | 3300046642 | Ga0495634_0022031 | Ga0495634_0022031_3968_4291 | 107 |
| 414 | 3300046642 | Ga0495634_0406793 | Ga0495634_0406793_318_641 | 107 |
| 415 | 3300046663 | Ga0495635_0048291 | Ga0495635_0048291_320_643 | 107 |
| 416 | 3300046663 | Ga0495635_0386321 | Ga0495635_0386321_359_682 | 107 |
| 417 | 3300046674 | Ga0495588_0349221 | Ga0495588_0349221_87_410 | 107 |
| 418 | 3300046675 | Ga0495657_0004269 | Ga0495657_0004269_7348_7671 | 107 |
| 419 | 3300046678 | Ga0495599_0003470 | Ga0495599_0003470_8482_8805 | 107 |
| 420 | 3300046678 | Ga0495599_0339673 | Ga0495599_0339673_285_608 | 107 |
| 421 | 3300046680 | Ga0495646_0015104 | Ga0495646_0015104_4140_4463 | 107 |
| 422 | 3300046680 | Ga0495646_0670050 | Ga0495646_0670050_69_392 | 107 |
| 423 | 3300046689 | Ga0495613_0204458 | Ga0495613_0204458_185_508 | 107 |
| 424 | 3300046809 | Ga0495600_0002578 | Ga0495600_0002578_2939_3262 | 107 |
| 425 | 3300046809 | Ga0495600_0374397 | Ga0495600_0374397_214_549 | 107 |
| 426 | 3300047315 | Ga0495581_0025564 | Ga0495581_0025564_931_1254 | 107 |
| 427 | 3300047317 | Ga0495604_0007008 | Ga0495604_0007008_4705_5028 | 107 |
| 428 | 3300047317 | Ga0495604_0070158 | Ga0495604_0070158_822_1145 | 107 |
| 429 | 3300047317 | Ga0495604_0595664 | Ga0495604_0595664_328_663 | 107 |
| 430 | 3300047319 | Ga0495674_0208247 | Ga0495674_0208247_739_1062 | 107 |
| 431 | 3300047319 | Ga0495674_1488979 | Ga0495674_1488979_71_394 | 107 |
| 432 | 3300047322 | Ga0495680_0005001 | Ga0495680_0005001_3688_4011 | 107 |
| 433 | 3300047444 | Ga0495675_0008107 | Ga0495675_0008107_4139_4462 | 107 |
| 434 | 3300047471 | Ga0495684_0023087 | Ga0495684_0023087_1523_1846 | 107 |
| 435 | 3300047471 | Ga0495684_0201868 | Ga0495684_0201868_461_784 | 107 |
| 436 | 3300047673 | Ga0495593_0025411 | Ga0495593_0025411_2282_2605 | 107 |
| 437 | 3300048088 | Ga0495602_0043423 | Ga0495602_0043423_3027_3350 | 107 |
| 438 | 3300048089 | Ga0495614_0089254 | Ga0495614_0089254_571_894 | 107 |
| 439 | 3300048903 | Ga0496100_0011668 | Ga0496100_0011668_3126_3449 | 107 |
| 440 | 3300048903 | Ga0496100_0077541 | Ga0496100_0077541_1132_1455 | 107 |
| 441 | 3300048903 | Ga0496100_0190479 | Ga0496100_0190479_358_690 | 107 |
| 442 | 3300048903 | Ga0496100_0493225 | Ga0496100_0493225_337_660 | 107 |
| 443 | 3300048904 | Ga0496101_0007767 | Ga0496101_0007767_1225_1548 | 107 |
| 444 | 3300048904 | Ga0496101_0018299 | Ga0496101_0018299_1801_2124 | 107 |
| 445 | 3300048904 | Ga0496101_0218640 | Ga0496101_0218640_606_929 | 107 |
| 446 | 3300048904 | Ga0496101_1280952 | Ga0496101_1280952_83_415 | 107 |
| 447 | 3300048905 | Ga0496102_0005237 | Ga0496102_0005237_8214_8537 | 107 |
| 448 | 3300048905 | Ga0496102_0017166 | Ga0496102_0017166_408_731 | 107 |
| 449 | 3300048905 | Ga0496102_0088358 | Ga0496102_0088358_2145_2468 | 107 |
| 450 | 3300048905 | Ga0496102_0153363 | Ga0496102_0153363_1404_1727 | 107 |
| 451 | 3300048905 | Ga0496102_0691661 | Ga0496102_0691661_372_704 | 107 |
| 452 | 3300048906 | Ga0496103_0020975 | Ga0496103_0020975_3122_3445 | 107 |
| 453 | 3300048906 | Ga0496103_0091521 | Ga0496103_0091521_1297_1620 | 107 |
| 454 | 3300048906 | Ga0496103_0733135 | Ga0496103_0733135_43_366 | 107 |
| 455 | 3300048906 | Ga0496103_0941696 | Ga0496103_0941696_195_518 | 107 |
| 456 | 3300048907 | Ga0496104_0011267 | Ga0496104_0011267_4025_4348 | 107 |
| 457 | 3300048907 | Ga0496104_0025980 | Ga0496104_0025980_1836_2168 | 107 |
| 458 | 3300048907 | Ga0496104_0050371 | Ga0496104_0050371_3580_3903 | 107 |
| 459 | 3300048907 | Ga0496104_0637502 | Ga0496104_0637502_158_481 | 107 |
| 460 | 3300048907 | Ga0496104_1086371 | Ga0496104_1086371_312_689 | 107 |
| 461 | 3300048907 | Ga0496104_1229777 | Ga0496104_1229777_43_366 | 107 |
| 462 | 3300048908 | Ga0496105_0000987 | Ga0496105_0000987_10665_10988 | 107 |
| 463 | 3300048908 | Ga0496105_0001487 | Ga0496105_0001487_12761_13084 | 107 |
| 464 | 3300048908 | Ga0496105_0037868 | Ga0496105_0037868_773_1096 | 107 |
| 465 | 3300048908 | Ga0496105_0062755 | Ga0496105_0062755_2203_2535 | 107 |
| 466 | 3300048908 | Ga0496105_0076184 | Ga0496105_0076184_960_1283 | 107 |
| 467 | 3300048908 | Ga0496105_0479976 | Ga0496105_0479976_256_579 | 107 |
| 468 | 3300048908 | Ga0496105_1110087 | Ga0496105_1110087_79_408 | 107 |
| 469 | 3300048909 | Ga0496106_0028565 | Ga0496106_0028565_3683_4006 | 107 |
| 470 | 3300048909 | Ga0496106_0273092 | Ga0496106_0273092_278_601 | 107 |
| 471 | 3300048909 | Ga0496106_0339153 | Ga0496106_0339153_195_518 | 107 |
| 472 | 3300048909 | Ga0496106_0760672 | Ga0496106_0760672_18_341 | 107 |
| 473 | 3300048909 | Ga0496106_1112228 | Ga0496106_1112228_115_438 | 107 |
| 474 | 3300048910 | Ga0496107_0084786 | Ga0496107_0084786_1417_1740 | 107 |
| 475 | 3300048910 | Ga0496107_0376425 | Ga0496107_0376425_627_950 | 107 |
| 476 | 3300048910 | Ga0496107_0484857 | Ga0496107_0484857_171_494 | 107 |
| 477 | 3300048910 | Ga0496107_0555235 | Ga0496107_0555235_61_384 | 107 |
| 478 | 3300048910 | Ga0496107_0566122 | Ga0496107_0566122_122_445 | 107 |
| 479 | 3300048910 | Ga0496107_0960636 | Ga0496107_0960636_254_586 | 107 |
| 480 | 3300048911 | Ga0496108_0016673 | Ga0496108_0016673_29_352 | 107 |
| 481 | 3300048911 | Ga0496108_0034779 | Ga0496108_0034779_3606_3929 | 107 |
| 482 | 3300048911 | Ga0496108_0046940 | Ga0496108_0046940_2783_3106 | 107 |
| 483 | 3300048911 | Ga0496108_0701646 | Ga0496108_0701646_14_337 | 107 |
| 484 | 3300048912 | Ga0496109_0014871 | Ga0496109_0014871_4096_4419 | 107 |
| 485 | 3300048912 | Ga0496109_0027997 | Ga0496109_0027997_3496_3819 | 107 |
| 486 | 3300048912 | Ga0496109_0192336 | Ga0496109_0192336_1301_1624 | 107 |
| 487 | 3300048912 | Ga0496109_0275503 | Ga0496109_0275503_418_741 | 107 |
| 488 | 3300048912 | Ga0496109_0826834 | Ga0496109_0826834_114_491 | 107 |
| 489 | 3300048912 | Ga0496109_1319780 | Ga0496109_1319780_315_638 | 107 |
| 490 | 3300048912 | Ga0496109_1859614 | Ga0496109_1859614_143_478 | 107 |
| 491 | 3300048913 | Ga0496110_0012988 | Ga0496110_0012988_55_378 | 107 |
| 492 | 3300048913 | Ga0496110_0023891 | Ga0496110_0023891_4374_4697 | 107 |
| 493 | 3300048913 | Ga0496110_0067046 | Ga0496110_0067046_1936_2265 | 107 |
| 494 | 3300048913 | Ga0496110_0770476 | Ga0496110_0770476_227_550 | 107 |
| 495 | 3300048913 | Ga0496110_0774559 | Ga0496110_0774559_199_522 | 107 |
| 496 | 3300048913 | Ga0496110_0786753 | Ga0496110_0786753_341_664 | 107 |
| 497 | 3300048914 | Ga0496111_0017497 | Ga0496111_0017497_1268_1591 | 107 |
| 498 | 3300048914 | Ga0496111_0020929 | Ga0496111_0020929_527_850 | 107 |
| 499 | 3300048914 | Ga0496111_0072632 | Ga0496111_0072632_1632_1955 | 107 |
| 500 | 3300048914 | Ga0496111_1157743 | Ga0496111_1157743_63_386 | 107 |
| 501 | 3300048915 | Ga0496112_0001908 | Ga0496112_0001908_16047_16370 | 107 |
| 502 | 3300048915 | Ga0496112_0024686 | Ga0496112_0024686_3544_3867 | 107 |
| 503 | 3300048915 | Ga0496112_0600883 | Ga0496112_0600883_238_561 | 107 |
| 504 | 3300048915 | Ga0496112_1209764 | Ga0496112_1209764_269_592 | 107 |
| 505 | 3300048916 | Ga0496113_0020528 | Ga0496113_0020528_204_527 | 107 |
| 506 | 3300048916 | Ga0496113_0183034 | Ga0496113_0183034_946_1269 | 107 |
| 507 | 3300048916 | Ga0496113_0321476 | Ga0496113_0321476_853_1182 | 107 |
| 508 | 3300048917 | Ga0496114_0003588 | Ga0496114_0003588_2988_3311 | 107 |
| 509 | 3300048917 | Ga0496114_0007081 | Ga0496114_0007081_2654_2977 | 107 |
| 510 | 3300048917 | Ga0496114_0010348 | Ga0496114_0010348_2044_2376 | 107 |
| 511 | 3300048917 | Ga0496114_0056388 | Ga0496114_0056388_2887_3210 | 107 |
| 512 | 3300048917 | Ga0496114_0095672 | Ga0496114_0095672_2053_2376 | 107 |
| 513 | 3300048917 | Ga0496114_0305564 | Ga0496114_0305564_81_410 | 107 |
| 514 | 3300048917 | Ga0496114_0549214 | Ga0496114_0549214_616_939 | 107 |
| 515 | 3300048917 | Ga0496114_0738556 | Ga0496114_0738556_111_434 | 107 |
| 516 | 3300048917 | Ga0496114_0875287 | Ga0496114_0875287_272_595 | 107 |
| 517 | 3300048917 | Ga0496114_1135113 | Ga0496114_1135113_283_606 | 107 |
| 518 | 3300048917 | Ga0496114_1430400 | Ga0496114_1430400_214_537 | 107 |
| 519 | 3300048917 | Ga0496114_1448786 | Ga0496114_1448786_128_451 | 107 |
| 520 | 3300048917 | Ga0496114_1764171 | Ga0496114_1764171_90_419 | 107 |
| 521 | 3300048918 | Ga0496115_0231180 | Ga0496115_0231180_1061_1384 | 107 |
| 522 | 3300048929 | Ga0496126_0456924 | Ga0496126_0456924_336_671 | 107 |
| 523 | 3300049576 | Ga0501040_1090376 | Ga0501040_1090376_224_547 | 107 |
| 524 | 3300049583 | Ga0501067_0053080 | Ga0501067_0053080_1017_1340 | 107 |
| 525 | 3300049584 | Ga0501068_0118815 | Ga0501068_0118815_250_573 | 107 |
| 526 | 3300049585 | Ga0501069_0033958 | Ga0501069_0033958_1199_1522 | 107 |
| 527 | 3300049824 | Ga0501045_0143225 | Ga0501045_0143225_126_449 | 107 |
| 528 | 3300050490 | nmdc:mga03n38_30463_c1 | nmdc:mga03n38_30463_c1_42_371 | 107 |
| 529 | 3300050491 | nmdc:mga00v17_76444_c1 | nmdc:mga00v17_76444_c1_384_713 | 107 |
| 530 | 3300050494 | nmdc:mga06z11_32578_c1 | nmdc:mga06z11_32578_c1_603_932 | 107 |
| 531 | 3300050495 | nmdc:mga04h51_20444_c1 | nmdc:mga04h51_20444_c1_172_501 | 107 |
| 532 | 3300050507 | nmdc:mga05p37_1271663_c1 | nmdc:mga05p37_1271663_c1_121_456 | 107 |
| 533 | 3300050507 | nmdc:mga05p37_225573_c1 | nmdc:mga05p37_225573_c1_1258_1599 | 107 |
| 534 | 3300050508 | nmdc:mga09592_822492_c1 | nmdc:mga09592_822492_c1_190_531 | 107 |
| 535 | 3300050509 | nmdc:mga0qj67_524565_c1 | nmdc:mga0qj67_524565_c1_491_820 | 107 |
| 536 | 3300050512 | nmdc:mga0n895_612536_c1 | nmdc:mga0n895_612536_c1_520_843 | 107 |
| 537 | 3300050512 | nmdc:mga0n895_87868_c1 | nmdc:mga0n895_87868_c1_1108_1431 | 107 |
| 538 | 3300050513 | nmdc:mga0rr50_192639_c1 | nmdc:mga0rr50_192639_c1_1119_1442 | 107 |
| 539 | 3300050513 | nmdc:mga0rr50_212576_c1 | nmdc:mga0rr50_212576_c1_315_641 | 107 |
| 540 | 3300050514 | nmdc:mga08x19_568526_c1 | nmdc:mga08x19_568526_c1_180_503 | 107 |
| 541 | 3300050514 | nmdc:mga08x19_819724_c1 | nmdc:mga08x19_819724_c1_289_624 | 107 |
| 542 | 3300050515 | nmdc:mga0a205_164790_c1 | nmdc:mga0a205_164790_c1_114_449 | 107 |
| 543 | 3300053077 | Ga0495601_0047053 | Ga0495601_0047053_515_850 | 107 |
| 544 | 3300053077 | Ga0495601_0176540 | Ga0495601_0176540_68_391 | 107 |
| 545 | 3300053077 | Ga0495601_0192802 | Ga0495601_0192802_556_879 | 107 |
| 546 | 3300053078 | Ga0495612_0039973 | Ga0495612_0039973_678_1013 | 107 |
| 547 | 3300053080 | Ga0500635_0000073 | Ga0500635_0000073_45535_45879 | 107 |
| 548 | 3300053085 | Ga0495619_0073284 | Ga0495619_0073284_821_1144 | 107 |
| 549 | 3300053085 | Ga0495619_0420434 | Ga0495619_0420434_144_479 | 107 |
| 550 | 3300053088 | Ga0500644_0000299 | Ga0500644_0000299_8185_8514 | 107 |
| 551 | 3300053099 | Ga0500654_207985 | Ga0500654_207985_210_539 | 107 |
| 552 | 3300053104 | Ga0500556_0001027 | Ga0500556_0001027_12018_12341 | 107 |
| 553 | 3300053129 | Ga0500628_030718 | Ga0500628_030718_450_773 | 107 |
| 554 | 3300053140 | Ga0500573_0113042 | Ga0500573_0113042_456_779 | 107 |
| 555 | 3300053153 | Ga0500616_0000097 | Ga0500616_0000097_94636_94959 | 107 |
| 556 | 3300061719 | Ga0466962_0008377 | Ga0466962_0008377_3183_3509 | 107 |
| 557 | 3300061719 | Ga0466962_0193689 | Ga0466962_0193689_643_966 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7789 | 1 | 106 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7661 | 1 | 106 |
| 2qz8-assembly1.cif.gz_B-2 | crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) | 0.7412 | 2 | 107 |
| 2w29-assembly1.cif.gz_B | gly102thr mutant of rv3291c | 0.7252 | 2 | 107 |
| 2w25-assembly1.cif.gz_B | crystal structure of glu104ala mutant | 0.7228 | 2 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7789 | 1 | 106 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7661 | 1 | 106 | 3.30.70.1060 |
| af_P71888_58_138_3.30.70.920 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7381 | 2 | 104 | 3.30.70.920 |
| af_P0ACJ5_55_139_3.30.70.920 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7199 | 2 | 104 | 3.30.70.920 |
| 2w24A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7154 | 2 | 103 | 3.30.70.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M2RZ18-F1-model_v4 | YCII-related domain-containing protein | 0.9447 | 2 | 107 |
|
| AF-A0A316FIT7-F1-model_v4 | YCII-related domain-containing protein | 0.9406 | 1 | 107 |
|
| AF-A0A810LMP5-F1-model_v4 | deleted | 0.9371 | 2 | 107 |
|
| AF-A0A1H8SN34-F1-model_v4 | Uncharacterized conserved protein | 0.9359 | 1 | 107 |
|
| AF-A0A316FIT7-F1-model_v4 | YCII-related domain-containing protein | 0.9322 | 1 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar