F463203

General Info

Members Datasets Scaffolds Average Seq Length
556 188 1112 215

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100006932|Ga0075428_10000693213
Length 225
Sequence VGRCLGGAAMTLPFVTESEQRDAVPKVIAHLRGGGLLAYPTETVYGLGSLPTPEGLTALIRLKGRAPNKPFLLLISSRAMAESAGLTFNASASALASAFWPGPLTLVLPGGEGQLPDALRGVEGGIAVRHTSHAGIAHLVAELGTPLTSTSANRPGHPAAPGVTSLVDSFRSAVEAGQLLVLDGGVLGNVPPSTVLDCTGVIPKMIRAGAIPVAELRSAVGSLAP

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
107 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
164 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
165 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
169 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.81
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100006932 3300006844 Bacteria 12584
2 rootL2_10270994 3300003322 Bacteria 2327
3 Ga0065707_10288023 3300005295 Bacteria 1032
4 Ga0070683_100186315 3300005329 Unclassified 1970
5 Ga0070670_100095456 3300005331 Bacteria 2558
6 Ga0070670_100869236 3300005331 Unclassified 816
7 Ga0070677_10007601 3300005333 Bacteria 3624
8 Ga0070677_10280323 3300005333 Unclassified 839
9 Ga0070680_100013761 3300005336 Bacteria 6310
10 Ga0070680_100443269 3300005336 Unclassified 1109
11 Ga0070689_100236527 3300005340 Bacteria 1503
12 Ga0070687_100284625 3300005343 Bacteria 1042
13 Ga0070692_10133279 3300005345 Bacteria 1399
14 Ga0070692_10140010 3300005345 Bacteria 1368
15 Ga0070668_100135022 3300005347 Archaea 1983
16 Ga0070669_100596783 3300005353 Bacteria 925
17 Ga0070675_100173243 3300005354 Unclassified 1862
18 Ga0070674_100171459 3300005356 Archaea 1655
19 Ga0070673_100015550 3300005364 Bacteria 5350
20 Ga0070703_10006779 3300005406 Bacteria 3214
21 Ga0070703_10033384 3300005406 Bacteria 1566
22 Ga0070709_10001155 3300005434 Bacteria 14508
23 Ga0070709_10456507 3300005434 Archaea 963
24 Ga0070713_100711427 3300005436 Bacteria 959
25 Ga0070711_100000082 3300005439 Bacteria 52402
26 Ga0070711_100003415 3300005439 Bacteria 9252
27 Ga0070711_100191868 3300005439 Bacteria 1571
28 Ga0070705_100027461 3300005440 Bacteria 3108
29 Ga0070705_100070217 3300005440 Bacteria 2115
30 Ga0070705_100078670 3300005440 Bacteria 2017
31 Ga0070705_100369900 3300005440 Bacteria 1051
32 Ga0070700_100295771 3300005441 Bacteria 1180
33 Ga0070694_100006031 3300005444 Bacteria 7353
34 Ga0070694_100016989 3300005444 Bacteria 4591
35 Ga0070694_100034447 3300005444 Bacteria 3339
36 Ga0070694_100045472 3300005444 Bacteria 2942
37 Ga0070694_100065679 3300005444 Bacteria 2487
38 Ga0070694_100109349 3300005444 Bacteria 1967
39 Ga0070694_100114547 3300005444 Bacteria 1925
40 Ga0070694_100115072 3300005444 Bacteria 1921
41 Ga0070694_100183156 3300005444 Bacteria 1550
42 Ga0070694_100195153 3300005444 Bacteria 1506
43 Ga0070694_100471243 3300005444 Bacteria 995
44 Ga0070694_100552518 3300005444 Bacteria 922
45 Ga0070708_100034011 3300005445 Bacteria 4431
46 Ga0070708_100283046 3300005445 Unclassified 1561
47 Ga0070708_100346839 3300005445 Bacteria 1399
48 Ga0070708_100710937 3300005445 Bacteria 945
49 Ga0070708_100882770 3300005445 Unclassified 840
50 Ga0070663_100518717 3300005455 Bacteria 992
51 Ga0070662_100279657 3300005457 Archaea 1350
52 Ga0070662_100288802 3300005457 Archaea 1329
53 Ga0070681_10129356 3300005458 Bacteria 2457
54 Ga0068867_100023712 3300005459 Bacteria 4394
55 Ga0070706_100009397 3300005467 Bacteria 9103
56 Ga0070706_100029025 3300005467 Bacteria 5095
57 Ga0070706_100064918 3300005467 Bacteria 3375
58 Ga0070706_100091011 3300005467 Bacteria 2829
59 Ga0070706_100093994 3300005467 Bacteria 2782
60 Ga0070706_100159161 3300005467 Bacteria 2108
61 Ga0070706_100240907 3300005467 Bacteria 1689
62 Ga0070706_100273187 3300005467 Unclassified 1577
63 Ga0070706_100427313 3300005467 Bacteria 1233
64 Ga0070707_100003354 3300005468 Bacteria 15121
65 Ga0070707_100021360 3300005468 Bacteria 6117
66 Ga0070707_100035915 3300005468 Bacteria 4729
67 Ga0070707_100037418 3300005468 Bacteria 4630
68 Ga0070707_100074899 3300005468 Bacteria 3264
69 Ga0070707_100187426 3300005468 Bacteria 2017
70 Ga0070707_100355996 3300005468 Bacteria 1422
71 Ga0070707_100753469 3300005468 Bacteria 937
72 Ga0070698_100001343 3300005471 Bacteria 27340
73 Ga0070698_100072774 3300005471 Bacteria 3444
74 Ga0070698_100339018 3300005471 Bacteria 1435
75 Ga0070698_100689746 3300005471 Bacteria 963
76 Ga0070698_100775704 3300005471 Bacteria 902
77 Ga0070699_100001873 3300005518 Bacteria 19028
78 Ga0070699_100007511 3300005518 Bacteria 9480
79 Ga0070699_100026868 3300005518 Bacteria 4965
80 Ga0070699_100027364 3300005518 Bacteria 4918
81 Ga0070699_100028116 3300005518 Bacteria 4849
82 Ga0070699_100033594 3300005518 Bacteria 4432
83 Ga0070699_100044853 3300005518 Bacteria 3828
84 Ga0070699_100061183 3300005518 Bacteria 3264
85 Ga0070699_100085015 3300005518 Bacteria 2761
86 Ga0070699_100248890 3300005518 Bacteria 1587
87 Ga0070699_100295102 3300005518 Bacteria 1454
88 Ga0070699_100560149 3300005518 Bacteria 1041
89 Ga0070679_100009584 3300005530 Bacteria 9158
90 Ga0070684_100182784 3300005535 Bacteria 1907
91 Ga0070697_100006203 3300005536 Bacteria 9253
92 Ga0070697_100055184 3300005536 Bacteria 3230
93 Ga0070697_100055450 3300005536 Bacteria 3222
94 Ga0070697_100062595 3300005536 Bacteria 3037
95 Ga0070697_100067958 3300005536 Bacteria 2916
96 Ga0070697_100092419 3300005536 Bacteria 2503
97 Ga0070697_100101852 3300005536 Bacteria 2386
98 Ga0070697_100154266 3300005536 Unclassified 1937
99 Ga0070672_100009975 3300005543 Bacteria 6571
100 Ga0070672_100022954 3300005543 Bacteria 4592
101 Ga0070686_100061452 3300005544 Bacteria 2428
102 Ga0070695_100005604 3300005545 Bacteria 7393
103 Ga0070695_100008238 3300005545 Bacteria 6183
104 Ga0070695_100119382 3300005545 Bacteria 1802
105 Ga0070696_100000865 3300005546 Bacteria 19565
106 Ga0070696_100001363 3300005546 Bacteria 15920
107 Ga0070696_100005546 3300005546 Bacteria 8425
108 Ga0070696_100012132 3300005546 Bacteria 5775
109 Ga0070696_100047417 3300005546 Bacteria 2981
110 Ga0070696_100677736 3300005546 Bacteria 838
111 Ga0070665_100246984 3300005548 Unclassified 1785
112 Ga0070704_100000226 3300005549 Bacteria 23807
113 Ga0070704_100002023 3300005549 Bacteria 11239
114 Ga0070704_100005553 3300005549 Bacteria 7352
115 Ga0070704_100007976 3300005549 Bacteria 6324
116 Ga0070704_100056431 3300005549 Bacteria 2788
117 Ga0070704_100111845 3300005549 Bacteria 2080
118 Ga0070704_100372178 3300005549 Bacteria 1212
119 Ga0070704_100679203 3300005549 Bacteria 911
120 Ga0070664_100020541 3300005564 Bacteria 5438
121 Ga0070702_100117961 3300005615 Bacteria 1657
122 Ga0068859_100033329 3300005617 Bacteria 5173
123 Ga0068864_100062034 3300005618 Bacteria 3239
124 Ga0068864_100087695 3300005618 Bacteria 2740
125 Ga0068861_100402986 3300005719 Bacteria 1214
126 Ga0068863_100351843 3300005841 Bacteria 1435
127 Ga0070716_100002941 3300006173 Bacteria 7943
128 Ga0070716_100041089 3300006173 Bacteria 2575
129 Ga0075428_100008968 3300006844 Bacteria 11097
130 Ga0075428_100048520 3300006844 Bacteria 4660
131 Ga0075428_100266830 3300006844 Bacteria 1842
132 Ga0075428_100279631 3300006844 Bacteria 1796
133 Ga0075430_100038485 3300006846 Bacteria 4050
134 Ga0075430_100323332 3300006846 Bacteria 1275
135 Ga0075431_100058587 3300006847 Bacteria 3975
136 Ga0075431_100060229 3300006847 Bacteria 3917
137 Ga0075431_100086594 3300006847 Bacteria 3233
138 Ga0075431_100089507 3300006847 Bacteria 3177
139 Ga0075431_100173782 3300006847 Bacteria 2213
140 Ga0075431_100181998 3300006847 Bacteria 2156
141 Ga0075431_100645706 3300006847 Bacteria 1039
142 Ga0075431_101032508 3300006847 Bacteria 788
143 Ga0075433_10000474 3300006852 Bacteria 26163
144 Ga0075433_10004951 3300006852 Bacteria 10432
145 Ga0075433_10005177 3300006852 Bacteria 10216
146 Ga0075433_10006922 3300006852 Bacteria 8983
147 Ga0075433_10034790 3300006852 Bacteria 4329
148 Ga0075433_10057634 3300006852 Bacteria 3395
149 Ga0075433_10080818 3300006852 Bacteria 2865
150 Ga0075433_10172085 3300006852 Bacteria 1927
151 Ga0075433_10304776 3300006852 Bacteria 1410
152 Ga0075434_100003038 3300006871 Bacteria 14923
153 Ga0075434_100005854 3300006871 Bacteria 11228
154 Ga0075434_100011364 3300006871 Bacteria 8396
155 Ga0075434_100013907 3300006871 Bacteria 7677
156 Ga0075434_100035694 3300006871 Bacteria 4915
157 Ga0075434_100045965 3300006871 Bacteria 4332
158 Ga0075434_100077236 3300006871 Bacteria 3325
159 Ga0075434_100456794 3300006871 Bacteria 1298
160 Ga0075429_100030547 3300006880 Bacteria 4681
161 Ga0075429_100615172 3300006880 Bacteria 952
162 Ga0075436_100009664 3300006914 Bacteria 6602
163 Ga0075436_100024835 3300006914 Bacteria 4122
164 Ga0075436_100029606 3300006914 Bacteria 3765
165 Ga0075436_100073001 3300006914 Bacteria 2374
166 Ga0075436_100099990 3300006914 Unclassified 2019
167 Ga0075436_100178972 3300006914 Unclassified 1498
168 Ga0075436_100230010 3300006914 Bacteria 1317
169 Ga0075436_100404659 3300006914 Archaea 989
170 Ga0075436_100684518 3300006914 Unclassified 759
171 Ga0097620_100033329 3300006931 Bacteria 5173
172 Ga0075435_100005770 3300007076 Bacteria 8695
173 Ga0075435_100050605 3300007076 Bacteria 3344
174 Ga0075435_100114217 3300007076 Bacteria 2248
175 Ga0075435_100185992 3300007076 Bacteria 1757
176 Ga0075435_100408892 3300007076 Bacteria 1168
177 Ga0099794_10000392 3300007265 Bacteria 14789
178 Ga0099794_10000598 3300007265 Bacteria 12091
179 Ga0111539_10170984 3300009094 Bacteria 2539
180 Ga0111539_11110205 3300009094 Bacteria 919
181 Ga0105245_11393753 3300009098 Bacteria 751
182 Ga0114129_10000112 3300009147 Bacteria 80956
183 Ga0114129_10039875 3300009147 Bacteria 6625
184 Ga0114129_10106139 3300009147 Bacteria 3880
185 Ga0114129_10246906 3300009147 Bacteria 2397
186 Ga0114129_10733528 3300009147 Unclassified 1266
187 Ga0114129_10764319 3300009147 Unclassified 1236
188 Ga0105248_10043901 3300009177 Bacteria 5013
189 Ga0105248_10628097 3300009177 Unclassified 1212
190 Ga0105237_10445893 3300009545 Bacteria 1300
191 Ga0105239_10005218 3300010375 Bacteria 15292
192 Ga0163163_10167676 3300014325 Unclassified 2242
193 Ga0163163_10872472 3300014325 Unclassified 963
194 Ga0157379_10457347 3300014968 Bacteria 1179
195 Ga0207653_10000037 3300025885 Bacteria 99765
196 Ga0207653_10109708 3300025885 Bacteria 984
197 Ga0207682_10015500 3300025893 Bacteria 2966
198 Ga0207699_10001892 3300025906 Bacteria 9849
199 Ga0207699_10073660 3300025906 Bacteria 2095
200 Ga0207645_10079016 3300025907 Bacteria 2108
201 Ga0207684_10008952 3300025910 Bacteria 8879
202 Ga0207684_10012582 3300025910 Bacteria 7355
203 Ga0207684_10024451 3300025910 Bacteria 5149
204 Ga0207684_10321375 3300025910 Bacteria 1334
205 Ga0207684_10359826 3300025910 Unclassified 1252
206 Ga0207707_10000702 3300025912 Bacteria 33259
207 Ga0207707_10250065 3300025912 Unclassified 1540
208 Ga0207707_10470140 3300025912 Bacteria 1075
209 Ga0207671_10212937 3300025914 Bacteria 1512
210 Ga0207663_10000338 3300025916 Bacteria 20484
211 Ga0207663_10092678 3300025916 Bacteria 2009
212 Ga0207662_10271497 3300025918 Bacteria 1119
213 Ga0207652_10131692 3300025921 Bacteria 2230
214 Ga0207646_10001365 3300025922 Bacteria 30231
215 Ga0207646_10004181 3300025922 Bacteria 15815
216 Ga0207646_10022481 3300025922 Bacteria 5809
217 Ga0207646_10024783 3300025922 Bacteria 5492
218 Ga0207646_10040124 3300025922 Bacteria 4211
219 Ga0207646_10055565 3300025922 Bacteria 3540
220 Ga0207646_10106781 3300025922 Bacteria 2511
221 Ga0207646_10131136 3300025922 Bacteria 2256
222 Ga0207646_10228276 3300025922 Bacteria 1682
223 Ga0207646_10316246 3300025922 Archaea 1411
224 Ga0207646_10340527 3300025922 Bacteria 1355
225 Ga0207646_10455635 3300025922 Bacteria 1154
226 Ga0207650_10136722 3300025925 Bacteria 1923
227 Ga0207659_10142159 3300025926 Archaea 1864
228 Ga0207659_10857838 3300025926 Bacteria 781
229 Ga0207644_10091351 3300025931 Bacteria 2270
230 Ga0207690_10685347 3300025932 Bacteria 842
231 Ga0207706_10386946 3300025933 Archaea 1213
232 Ga0207669_10157895 3300025937 Bacteria 1598
233 Ga0207669_10333529 3300025937 Archaea 1165
234 Ga0207665_10001566 3300025939 Bacteria 15425
235 Ga0207665_10044760 3300025939 Bacteria 2961
236 Ga0207665_10397898 3300025939 Bacteria 1048
237 Ga0207691_10016924 3300025940 Bacteria 6917
238 Ga0207691_10212164 3300025940 Archaea 1681
239 Ga0207651_10056084 3300025960 Bacteria 2710
240 Ga0207668_10133255 3300025972 Archaea 1900
241 Ga0207678_10098807 3300026067 Bacteria 2493
242 Ga0207708_10045004 3300026075 Bacteria 3363
243 Ga0207708_10045793 3300026075 Bacteria 3333
244 Ga0207641_10167889 3300026088 Bacteria 2000
245 Ga0207648_10024736 3300026089 Bacteria 5356
246 Ga0207648_10123313 3300026089 Bacteria 2279
247 Ga0207676_10023297 3300026095 Bacteria 4566
248 Ga0207675_100023374 3300026118 Bacteria 5749
249 Ga0207675_100283401 3300026118 Bacteria 1610
250 Ga0209588_1000641 3300027671 Bacteria 8830
251 Ga0209974_10026755 3300027876 Bacteria 1908
252 Ga0268266_10249590 3300028379 Unclassified 1641
253 Ga0307408_100007525 3300031548 Bacteria 7199
254 Ga0307408_100074005 3300031548 Bacteria 2526
255 Ga0307408_100131752 3300031548 Bacteria 1951
256 Ga0307408_100150603 3300031548 Bacteria 1836
257 Ga0307408_100292163 3300031548 Bacteria 1362
258 Ga0307413_10007180 3300031824 Bacteria 5153
259 Ga0307413_10017790 3300031824 Bacteria 3711
260 Ga0307413_10039152 3300031824 Bacteria 2754
261 Ga0307413_10243519 3300031824 Bacteria 1329
262 Ga0307410_10007917 3300031852 Bacteria 5855
263 Ga0307410_10009184 3300031852 Bacteria 5533
264 Ga0307410_10014884 3300031852 Bacteria 4595
265 Ga0307410_10023988 3300031852 Bacteria 3804
266 Ga0307410_10114528 3300031852 Bacteria 1956
267 Ga0307410_10211680 3300031852 Bacteria 1486
268 Ga0307410_10231743 3300031852 Bacteria 1426
269 Ga0307410_10341671 3300031852 Bacteria 1193
270 Ga0307406_10015310 3300031901 Bacteria 4435
271 Ga0307406_10238353 3300031901 Bacteria 1363
272 Ga0307406_10721153 3300031901 Bacteria 834
273 Ga0307407_10031401 3300031903 Bacteria 2876
274 Ga0307407_10219649 3300031903 Bacteria 1284
275 Ga0307407_10234016 3300031903 Bacteria 1249
276 Ga0307407_10294577 3300031903 Bacteria 1129
277 Ga0307412_10092372 3300031911 Bacteria 2121
278 Ga0307412_10229311 3300031911 Bacteria 1429
279 Ga0307412_10399685 3300031911 Bacteria 1118
280 Ga0307412_10529167 3300031911 Bacteria 986
281 Ga0307409_100000894 3300031995 Bacteria 13819
282 Ga0307409_100041213 3300031995 Bacteria 3446
283 Ga0307409_100079024 3300031995 Bacteria 2649
284 Ga0307409_100081185 3300031995 Bacteria 2620
285 Ga0307409_100103214 3300031995 Unclassified 2371
286 Ga0307409_100165301 3300031995 Unclassified 1941
287 Ga0307409_100186129 3300031995 Bacteria 1843
288 Ga0307409_100640249 3300031995 Bacteria 1056
289 Ga0307416_100002206 3300032002 Bacteria 11074
290 Ga0307416_100003668 3300032002 Bacteria 9085
291 Ga0307416_100077096 3300032002 Bacteria 2798
292 Ga0307416_100096793 3300032002 Bacteria 2553
293 Ga0307416_100142954 3300032002 Bacteria 2178
294 Ga0307416_100459922 3300032002 Bacteria 1327
295 Ga0307416_101150330 3300032002 Unclassified 881
296 Ga0307416_101711852 3300032002 Bacteria 733
297 Ga0307414_10054121 3300032004 Bacteria 2803
298 Ga0307414_10145812 3300032004 Bacteria 1860
299 Ga0307414_10186756 3300032004 Unclassified 1673
300 Ga0307414_10312168 3300032004 Bacteria 1335
301 Ga0307411_10003661 3300032005 Bacteria 7192
302 Ga0307411_10005322 3300032005 Bacteria 6304
303 Ga0307411_10015738 3300032005 Bacteria 4259
304 Ga0307411_10064022 3300032005 Bacteria 2460
305 Ga0307411_10066756 3300032005 Unclassified 2418
306 Ga0307411_10118013 3300032005 Bacteria 1913
307 Ga0307411_10278912 3300032005 Bacteria 1329
308 Ga0307411_10389592 3300032005 Bacteria 1148
309 Ga0307411_10466794 3300032005 Bacteria 1060
310 Ga0307415_100003278 3300032126 Bacteria 8231
311 Ga0307415_100006781 3300032126 Bacteria 6213
312 Ga0307415_100013088 3300032126 Bacteria 4827
313 Ga0307415_100074812 3300032126 Bacteria 2395
314 Ga0307415_100164194 3300032126 Bacteria 1725
315 Ga0307415_100371014 3300032126 Bacteria 1212
316 Ga0307415_100745568 3300032126 Bacteria 888
317 Ga0307415_100884008 3300032126 Bacteria 822
318 Ga0373959_0087627 3300034820 Bacteria 726
319 Ga0373929_0023940 3300035085 Bacteria 1258
320 Ga0373929_0064733 3300035085 Bacteria 863
321 Ga0373940_0092479 3300035088 Bacteria 908
322 Ga0373952_0051337 3300035092 Bacteria 984
323 Ga0373941_0172818 3300035115 Bacteria 806
324 Ga0373961_0116296 3300035241 Bacteria 881
325 Ga0373962_0018335 3300035242 Bacteria 1821
326 Ga0373931_0025110 3300035691 Bacteria 3026
327 Ga0373931_0029922 3300035691 Bacteria 2800
328 Ga0373927_0072868 3300035695 Bacteria 2224
329 Ga0395905_0017294 3300037471 Bacteria 6848
330 Ga0395905_0415461 3300037471 Bacteria 1241
331 Ga0395905_0433001 3300037471 Bacteria 1212
332 Ga0395905_1001628 3300037471 Bacteria 739
333 Ga0242420_004082 3300038996 Unclassified 2190
334 Ga0242420_022643 3300038996 Bacteria 1130
335 Ga0451577_0032266 3300042876 Bacteria 4719
336 Ga0451577_0165486 3300042876 Bacteria 1992
337 Ga0451577_0776617 3300042876 Bacteria 866
338 Ga0453683_0117508 3300044673 Bacteria 1674
339 Ga0453683_0215333 3300044673 Bacteria 1221
340 Ga0453684_0274806 3300044712 Bacteria 1924
341 Ga0466959_0125052 3300045049 Bacteria 1826
342 Ga0451576_0002272 3300045051 Bacteria 29329
343 Ga0451576_0005642 3300045051 Bacteria 15626
344 Ga0451576_0007510 3300045051 Bacteria 13011
345 Ga0451576_0041491 3300045051 Bacteria 4864
346 Ga0451576_0072506 3300045051 Bacteria 3583
347 Ga0451576_0133907 3300045051 Bacteria 2584
348 Ga0451576_0238966 3300045051 Unclassified 1897
349 Ga0451576_1049857 3300045051 Bacteria 853
350 Ga0495582_0219034 3300046473 Bacteria 1089
351 Ga0495582_0240313 3300046473 Bacteria 1038
352 Ga0496100_0017313 3300048903 Bacteria 4252
353 Ga0496100_0039824 3300048903 Bacteria 2986
354 Ga0496101_0119724 3300048904 Bacteria 1989
355 Ga0496101_0196815 3300048904 Bacteria 1557
356 Ga0496101_0209603 3300048904 Bacteria 1509
357 Ga0496101_0254729 3300048904 Bacteria 1368
358 Ga0496101_0561278 3300048904 Unclassified 903
359 Ga0496102_0000926 3300048905 Bacteria 27614
360 Ga0496102_0051408 3300048905 Bacteria 3754
361 Ga0496102_0208306 3300048905 Bacteria 1843
362 Ga0496103_0033138 3300048906 Bacteria 3155
363 Ga0496104_0012653 3300048907 Bacteria 7598
364 Ga0496104_0017162 3300048907 Bacteria 6584
365 Ga0496104_0043252 3300048907 Bacteria 4231
366 Ga0496104_0045956 3300048907 Bacteria 4108
367 Ga0496105_0069606 3300048908 Bacteria 2908
368 Ga0496105_0421715 3300048908 Bacteria 1056
369 Ga0496106_0029434 3300048909 Bacteria 4093
370 Ga0496106_0099599 3300048909 Bacteria 2253
371 Ga0496106_0100826 3300048909 Bacteria 2239
372 Ga0496106_0381811 3300048909 Bacteria 1132
373 Ga0496107_0115324 3300048910 Bacteria 1977
374 Ga0496107_0719779 3300048910 Bacteria 733
375 Ga0496108_0001523 3300048911 Bacteria 18335
376 Ga0496108_0026079 3300048911 Bacteria 4820
377 Ga0496108_0028443 3300048911 Bacteria 4625
378 Ga0496108_0112399 3300048911 Bacteria 2330
379 Ga0496109_0001242 3300048912 Bacteria 21132
380 Ga0496109_0009579 3300048912 Bacteria 8261
381 Ga0496109_0018976 3300048912 Bacteria 6055
382 Ga0496109_0149099 3300048912 Bacteria 2189
383 Ga0496109_0171813 3300048912 Bacteria 2034
384 Ga0496110_0074530 3300048913 Bacteria 3014
385 Ga0496110_0082974 3300048913 Bacteria 2859
386 Ga0496111_0003437 3300048914 Bacteria 9794
387 Ga0496111_0048992 3300048914 Bacteria 3046
388 Ga0496111_0077975 3300048914 Unclassified 2416
389 Ga0496112_0010947 3300048915 Bacteria 8260
390 Ga0496112_0011090 3300048915 Bacteria 8213
391 Ga0496112_0083072 3300048915 Bacteria 3167
392 Ga0496112_0275410 3300048915 Bacteria 1630
393 Ga0496112_0656932 3300048915 Bacteria 978
394 Ga0496113_0002551 3300048916 Bacteria 10629
395 Ga0496113_0003509 3300048916 Bacteria 9407
396 Ga0496113_0005664 3300048916 Bacteria 7821
397 Ga0496113_0028104 3300048916 Bacteria 4041
398 Ga0496114_0086057 3300048917 Bacteria 2663
399 Ga0496115_0083848 3300048918 Unclassified 2598
400 Ga0496115_0144655 3300048918 Bacteria 1962
401 Ga0501031_0112331 3300049568 Bacteria 1779
402 Ga0501031_0157667 3300049568 Bacteria 1484
403 Ga0501033_0388244 3300049570 Bacteria 975
404 Ga0501036_0218527 3300049572 Bacteria 1600
405 Ga0501036_0301993 3300049572 Bacteria 1339
406 Ga0501037_0043170 3300049573 Bacteria 3314
407 Ga0501038_0097517 3300049574 Bacteria 2452
408 Ga0501039_0028298 3300049575 Bacteria 4314
409 Ga0501040_0040554 3300049576 Bacteria 3168
410 Ga0501040_0056605 3300049576 Bacteria 2691
411 Ga0501041_0009554 3300049577 Bacteria 5719
412 Ga0501041_0290078 3300049577 Bacteria 1030
413 Ga0501041_0360425 3300049577 Bacteria 919
414 Ga0501041_0438648 3300049577 Bacteria 829
415 Ga0501042_0123401 3300049578 Bacteria 1865
416 Ga0501043_0243960 3300049579 Bacteria 1385
417 Ga0501046_0032724 3300049580 Bacteria 4208
418 Ga0501046_0204037 3300049580 Bacteria 1470
419 Ga0501047_0030200 3300049581 Bacteria 5226
420 Ga0501048_0024439 3300049582 Bacteria 4410
421 Ga0501048_0138703 3300049582 Bacteria 1719
422 Ga0501067_0000084 3300049583 Bacteria 54706
423 Ga0501067_0010371 3300049583 Bacteria 5156
424 Ga0501067_0111821 3300049583 Bacteria 1519
425 Ga0501067_0192154 3300049583 Bacteria 1137
426 Ga0501068_0000215 3300049584 Bacteria 27955
427 Ga0501068_0000885 3300049584 Bacteria 15629
428 Ga0501068_0041163 3300049584 Bacteria 2776
429 Ga0501068_0350933 3300049584 Bacteria 948
430 Ga0501069_0000067 3300049585 Bacteria 54874
431 Ga0501069_0051422 3300049585 Bacteria 2293
432 Ga0501069_0124403 3300049585 Bacteria 1474
433 Ga0501070_0000522 3300049586 Bacteria 35229
434 Ga0501070_0005295 3300049586 Bacteria 11007
435 Ga0501070_0029982 3300049586 Bacteria 4558
436 Ga0501070_0031629 3300049586 Bacteria 4434
437 Ga0501070_0359733 3300049586 Bacteria 1181
438 Ga0501070_0379627 3300049586 Bacteria 1145
439 Ga0501071_0000022 3300049587 Bacteria 51892
440 Ga0501071_0000194 3300049587 Bacteria 27399
441 Ga0501071_0008868 3300049587 Bacteria 6667
442 Ga0501072_0000039 3300049588 Bacteria 113463
443 Ga0501072_0030052 3300049588 Bacteria 4247
444 Ga0501072_0178397 3300049588 Bacteria 1694
445 Ga0501072_0318162 3300049588 Bacteria 1237
446 Ga0501073_0000175 3300049589 Bacteria 42009
447 Ga0501073_0007402 3300049589 Bacteria 8160
448 Ga0501074_0000139 3300049590 Bacteria 37885
449 Ga0501074_0000311 3300049590 Bacteria 28230
450 Ga0501074_0203504 3300049590 Bacteria 1411
451 Ga0501075_0131458 3300049591 Bacteria 1907
452 Ga0501075_0603235 3300049591 Bacteria 837
453 Ga0501076_0030192 3300049592 Bacteria 4222
454 Ga0501076_0032189 3300049592 Bacteria 4093
455 Ga0501076_0048536 3300049592 Bacteria 3355
456 Ga0501076_0152974 3300049592 Bacteria 1877
457 Ga0501076_0232150 3300049592 Bacteria 1508
458 Ga0501077_0003255 3300049593 Bacteria 9786
459 Ga0501077_0027350 3300049593 Bacteria 3622
460 Ga0501202_017455 3300049652 Bacteria 1402
461 Ga0501209_002430 3300049656 Bacteria 2869
462 Ga0501217_016034 3300049661 Bacteria 1712
463 Ga0501233_008989 3300049668 Bacteria 1941
464 Ga0501235_008020 3300049669 Bacteria 2302
465 Ga0501249_037562 3300049679 Bacteria 1093
466 Ga0501225_0120241 3300049705 Bacteria 780
467 Ga0501079_0040994 3300049741 Bacteria 3573
468 Ga0501079_0041856 3300049741 Bacteria 3537
469 Ga0501079_0070056 3300049741 Bacteria 2707
470 Ga0501079_0185174 3300049741 Bacteria 1625
471 Ga0501079_0330772 3300049741 Bacteria 1193
472 Ga0501079_0367933 3300049741 Bacteria 1127
473 Ga0501080_0000621 3300049742 Bacteria 28081
474 Ga0501080_0006954 3300049742 Bacteria 10205
475 Ga0501080_0016072 3300049742 Bacteria 6908
476 Ga0501080_0016591 3300049742 Bacteria 6804
477 Ga0501080_0053800 3300049742 Bacteria 3749
478 Ga0501080_0064806 3300049742 Bacteria 3399
479 Ga0501080_0269396 3300049742 Bacteria 1550
480 Ga0501081_0011406 3300049743 Bacteria 5815
481 Ga0501081_0037299 3300049743 Bacteria 3316
482 Ga0501081_0048202 3300049743 Bacteria 2932
483 Ga0501081_0104562 3300049743 Bacteria 2005
484 Ga0501081_0272482 3300049743 Bacteria 1238
485 Ga0501083_0002061 3300049744 Bacteria 13828
486 Ga0501083_0006186 3300049744 Bacteria 8492
487 Ga0501268_002437 3300049765 Bacteria 2451
488 Ga0501045_0002828 3300049824 Bacteria 11848
489 Ga0501045_0037905 3300049824 Bacteria 3506
490 nmdc:mga05p37_187810_c1 3300050507 Bacteria 2511
491 nmdc:mga05p37_199192_c1 3300050507 Bacteria 2426
492 nmdc:mga05p37_22624_c1 3300050507 Bacteria 7623
493 nmdc:mga05p37_250588_c1 3300050507 Bacteria 2124
494 nmdc:mga05p37_256451_c1 3300050507 Bacteria 2095
495 nmdc:mga05p37_440234_c1 3300050507 Bacteria 1512
496 nmdc:mga05p37_48674_c1 3300050507 Bacteria 5213
497 nmdc:mga05p37_51295_c1 3300050507 Bacteria 5074
498 nmdc:mga05p37_6185_c1 3300050507 Bacteria 14092
499 nmdc:mga09592_12901_c1 3300050508 Bacteria 6814
500 nmdc:mga0qj67_278706_c1 3300050509 Bacteria 1355
501 nmdc:mga06r32_144601_c1 3300050510 Bacteria 2355
502 nmdc:mga06r32_166673_c1 3300050510 Bacteria 2186
503 nmdc:mga06r32_200987_c1 3300050510 Bacteria 1981
504 nmdc:mga06r32_336648_c1 3300050510 Bacteria 1494
505 nmdc:mga06r32_52664_c1 3300050510 Bacteria 3898
506 nmdc:mga06r32_90101_c1 3300050510 Bacteria 2995
507 nmdc:mga08y16_144859_c1 3300050511 Bacteria 2469
508 nmdc:mga0n895_1261_c1 3300050512 Bacteria 18698
509 nmdc:mga0n895_19822_c1 3300050512 Bacteria 6259
510 nmdc:mga0n895_36188_c1 3300050512 Bacteria 4766
511 nmdc:mga0n895_4080_c1 3300050512 Bacteria 11894
512 nmdc:mga0n895_48946_c1 3300050512 Bacteria 4140
513 nmdc:mga0n895_57685_c1 3300050512 Bacteria 3828
514 nmdc:mga0n895_7788_c1 3300050512 Bacteria 9230
515 nmdc:mga0n895_85978_c1 3300050512 Unclassified 3141
516 nmdc:mga0n895_879101_c1 3300050512 Bacteria 883
517 nmdc:mga0rr50_17492_c1 3300050513 Bacteria 4788
518 nmdc:mga0rr50_18798_c1 3300050513 Bacteria 4651
519 nmdc:mga0rr50_198165_c1 3300050513 Bacteria 1649
520 nmdc:mga0rr50_509550_c1 3300050513 Bacteria 1023
521 nmdc:mga0rr50_511474_c1 3300050513 Archaea 1021
522 nmdc:mga0rr50_522853_c1 3300050513 Bacteria 1010
523 nmdc:mga0rr50_794456_c1 3300050513 Bacteria 807
524 nmdc:mga0rr50_84284_c1 3300050513 Bacteria 2460
525 nmdc:mga0rr50_89008_c1 3300050513 Bacteria 2400
526 nmdc:mga08x19_116440_c1 3300050514 Bacteria 1787
527 nmdc:mga08x19_24499_c1 3300050514 Bacteria 3752
528 nmdc:mga08x19_28132_c1 3300050514 Bacteria 3519
529 nmdc:mga08x19_34592_c1 3300050514 Bacteria 3195
530 nmdc:mga08x19_86848_c1 3300050514 Bacteria 2060
531 nmdc:mga08x19_94272_c1 3300050514 Bacteria 1979
532 nmdc:mga0a205_1014398_c1 3300050515 Unclassified 677
533 nmdc:mga0a205_40676_c1 3300050515 Bacteria 4476
534 nmdc:mga0a205_427989_c1 3300050515 Bacteria 1185
535 nmdc:mga0a205_428211_c1 3300050515 Bacteria 1185
536 nmdc:mga0a205_47294_c1 3300050515 Bacteria 4151
537 nmdc:mga0a205_56884_c1 3300050515 Bacteria 3776
538 nmdc:mga0a205_668304_c1 3300050515 Bacteria 890
539 nmdc:mga0a205_67441_c1 3300050515 Bacteria 3457
540 nmdc:mga0a205_81602_c1 3300050515 Bacteria 3124
541 nmdc:mga0a205_948_c1 3300050515 Bacteria 23916
542 Ga0501084_0000845 3300054114 Bacteria 23657
543 Ga0501084_0001192 3300054114 Bacteria 20355
544 Ga0501084_0005089 3300054114 Bacteria 10763
545 Ga0501084_0023501 3300054114 Bacteria 5143
546 Ga0501084_0093063 3300054114 Bacteria 2530
547 Ga0501084_0474292 3300054114 Bacteria 1058
548 Ga0590075_007601 3300059424 Bacteria 2580
549 Ga0590075_026670 3300059424 Bacteria 1455
550 Ga0501082_0000449 3300060353 Bacteria 36432
551 Ga0501082_0009401 3300060353 Bacteria 8416
552 Ga0501082_0104199 3300060353 Bacteria 2454
553 Ga0501082_0189924 3300060353 Bacteria 1787
554 Ga0530510_0031072 3300061734 Bacteria 3839
555 Ga0530510_0084003 3300061734 Bacteria 2319
556 Ga0530510_0162539 3300061734 Bacteria 1652
557 Ga0075428_100006932
558 rootL2_10270994
559 Ga0065707_10288023
560 Ga0070683_100186315
561 Ga0070670_100095456
562 Ga0070670_100869236
563 Ga0070677_10007601
564 Ga0070677_10280323
565 Ga0070680_100013761
566 Ga0070680_100443269
567 Ga0070689_100236527
568 Ga0070687_100284625
569 Ga0070692_10133279
570 Ga0070692_10140010
571 Ga0070668_100135022
572 Ga0070669_100596783
573 Ga0070675_100173243
574 Ga0070674_100171459
575 Ga0070673_100015550
576 Ga0070703_10006779
577 Ga0070703_10033384
578 Ga0070709_10001155
579 Ga0070709_10456507
580 Ga0070713_100711427
581 Ga0070711_100000082
582 Ga0070711_100003415
583 Ga0070711_100191868
584 Ga0070705_100027461
585 Ga0070705_100070217
586 Ga0070705_100078670
587 Ga0070705_100369900
588 Ga0070700_100295771
589 Ga0070694_100006031
590 Ga0070694_100016989
591 Ga0070694_100034447
592 Ga0070694_100045472
593 Ga0070694_100065679
594 Ga0070694_100109349
595 Ga0070694_100114547
596 Ga0070694_100115072
597 Ga0070694_100183156
598 Ga0070694_100195153
599 Ga0070694_100471243
600 Ga0070694_100552518
601 Ga0070708_100034011
602 Ga0070708_100283046
603 Ga0070708_100346839
604 Ga0070708_100710937
605 Ga0070708_100882770
606 Ga0070663_100518717
607 Ga0070662_100279657
608 Ga0070662_100288802
609 Ga0070681_10129356
610 Ga0068867_100023712
611 Ga0070706_100009397
612 Ga0070706_100029025
613 Ga0070706_100064918
614 Ga0070706_100091011
615 Ga0070706_100093994
616 Ga0070706_100159161
617 Ga0070706_100240907
618 Ga0070706_100273187
619 Ga0070706_100427313
620 Ga0070707_100003354
621 Ga0070707_100021360
622 Ga0070707_100035915
623 Ga0070707_100037418
624 Ga0070707_100074899
625 Ga0070707_100187426
626 Ga0070707_100355996
627 Ga0070707_100753469
628 Ga0070698_100001343
629 Ga0070698_100072774
630 Ga0070698_100339018
631 Ga0070698_100689746
632 Ga0070698_100775704
633 Ga0070699_100001873
634 Ga0070699_100007511
635 Ga0070699_100026868
636 Ga0070699_100027364
637 Ga0070699_100028116
638 Ga0070699_100033594
639 Ga0070699_100044853
640 Ga0070699_100061183
641 Ga0070699_100085015
642 Ga0070699_100248890
643 Ga0070699_100295102
644 Ga0070699_100560149
645 Ga0070679_100009584
646 Ga0070684_100182784
647 Ga0070697_100006203
648 Ga0070697_100055184
649 Ga0070697_100055450
650 Ga0070697_100062595
651 Ga0070697_100067958
652 Ga0070697_100092419
653 Ga0070697_100101852
654 Ga0070697_100154266
655 Ga0070672_100009975
656 Ga0070672_100022954
657 Ga0070686_100061452
658 Ga0070695_100005604
659 Ga0070695_100008238
660 Ga0070695_100119382
661 Ga0070696_100000865
662 Ga0070696_100001363
663 Ga0070696_100005546
664 Ga0070696_100012132
665 Ga0070696_100047417
666 Ga0070696_100677736
667 Ga0070665_100246984
668 Ga0070704_100000226
669 Ga0070704_100002023
670 Ga0070704_100005553
671 Ga0070704_100007976
672 Ga0070704_100056431
673 Ga0070704_100111845
674 Ga0070704_100372178
675 Ga0070704_100679203
676 Ga0070664_100020541
677 Ga0070702_100117961
678 Ga0068859_100033329
679 Ga0068864_100062034
680 Ga0068864_100087695
681 Ga0068861_100402986
682 Ga0068863_100351843
683 Ga0070716_100002941
684 Ga0070716_100041089
685 Ga0075428_100008968
686 Ga0075428_100048520
687 Ga0075428_100266830
688 Ga0075428_100279631
689 Ga0075430_100038485
690 Ga0075430_100323332
691 Ga0075431_100058587
692 Ga0075431_100060229
693 Ga0075431_100086594
694 Ga0075431_100089507
695 Ga0075431_100173782
696 Ga0075431_100181998
697 Ga0075431_100645706
698 Ga0075431_101032508
699 Ga0075433_10000474
700 Ga0075433_10004951
701 Ga0075433_10005177
702 Ga0075433_10006922
703 Ga0075433_10034790
704 Ga0075433_10057634
705 Ga0075433_10080818
706 Ga0075433_10172085
707 Ga0075433_10304776
708 Ga0075434_100003038
709 Ga0075434_100005854
710 Ga0075434_100011364
711 Ga0075434_100013907
712 Ga0075434_100035694
713 Ga0075434_100045965
714 Ga0075434_100077236
715 Ga0075434_100456794
716 Ga0075429_100030547
717 Ga0075429_100615172
718 Ga0075436_100009664
719 Ga0075436_100024835
720 Ga0075436_100029606
721 Ga0075436_100073001
722 Ga0075436_100099990
723 Ga0075436_100178972
724 Ga0075436_100230010
725 Ga0075436_100404659
726 Ga0075436_100684518
727 Ga0097620_100033329
728 Ga0075435_100005770
729 Ga0075435_100050605
730 Ga0075435_100114217
731 Ga0075435_100185992
732 Ga0075435_100408892
733 Ga0099794_10000392
734 Ga0099794_10000598
735 Ga0111539_10170984
736 Ga0111539_11110205
737 Ga0105245_11393753
738 Ga0114129_10000112
739 Ga0114129_10039875
740 Ga0114129_10106139
741 Ga0114129_10246906
742 Ga0114129_10733528
743 Ga0114129_10764319
744 Ga0105248_10043901
745 Ga0105248_10628097
746 Ga0105237_10445893
747 Ga0105239_10005218
748 Ga0163163_10167676
749 Ga0163163_10872472
750 Ga0157379_10457347
751 Ga0207653_10000037
752 Ga0207653_10109708
753 Ga0207682_10015500
754 Ga0207699_10001892
755 Ga0207699_10073660
756 Ga0207645_10079016
757 Ga0207684_10008952
758 Ga0207684_10012582
759 Ga0207684_10024451
760 Ga0207684_10321375
761 Ga0207684_10359826
762 Ga0207707_10000702
763 Ga0207707_10250065
764 Ga0207707_10470140
765 Ga0207671_10212937
766 Ga0207663_10000338
767 Ga0207663_10092678
768 Ga0207662_10271497
769 Ga0207652_10131692
770 Ga0207646_10001365
771 Ga0207646_10004181
772 Ga0207646_10022481
773 Ga0207646_10024783
774 Ga0207646_10040124
775 Ga0207646_10055565
776 Ga0207646_10106781
777 Ga0207646_10131136
778 Ga0207646_10228276
779 Ga0207646_10316246
780 Ga0207646_10340527
781 Ga0207646_10455635
782 Ga0207650_10136722
783 Ga0207659_10142159
784 Ga0207659_10857838
785 Ga0207644_10091351
786 Ga0207690_10685347
787 Ga0207706_10386946
788 Ga0207669_10157895
789 Ga0207669_10333529
790 Ga0207665_10001566
791 Ga0207665_10044760
792 Ga0207665_10397898
793 Ga0207691_10016924
794 Ga0207691_10212164
795 Ga0207651_10056084
796 Ga0207668_10133255
797 Ga0207678_10098807
798 Ga0207708_10045004
799 Ga0207708_10045793
800 Ga0207641_10167889
801 Ga0207648_10024736
802 Ga0207648_10123313
803 Ga0207676_10023297
804 Ga0207675_100023374
805 Ga0207675_100283401
806 Ga0209588_1000641
807 Ga0209974_10026755
808 Ga0268266_10249590
809 Ga0307408_100007525
810 Ga0307408_100074005
811 Ga0307408_100131752
812 Ga0307408_100150603
813 Ga0307408_100292163
814 Ga0307413_10007180
815 Ga0307413_10017790
816 Ga0307413_10039152
817 Ga0307413_10243519
818 Ga0307410_10007917
819 Ga0307410_10009184
820 Ga0307410_10014884
821 Ga0307410_10023988
822 Ga0307410_10114528
823 Ga0307410_10211680
824 Ga0307410_10231743
825 Ga0307410_10341671
826 Ga0307406_10015310
827 Ga0307406_10238353
828 Ga0307406_10721153
829 Ga0307407_10031401
830 Ga0307407_10219649
831 Ga0307407_10234016
832 Ga0307407_10294577
833 Ga0307412_10092372
834 Ga0307412_10229311
835 Ga0307412_10399685
836 Ga0307412_10529167
837 Ga0307409_100000894
838 Ga0307409_100041213
839 Ga0307409_100079024
840 Ga0307409_100081185
841 Ga0307409_100103214
842 Ga0307409_100165301
843 Ga0307409_100186129
844 Ga0307409_100640249
845 Ga0307416_100002206
846 Ga0307416_100003668
847 Ga0307416_100077096
848 Ga0307416_100096793
849 Ga0307416_100142954
850 Ga0307416_100459922
851 Ga0307416_101150330
852 Ga0307416_101711852
853 Ga0307414_10054121
854 Ga0307414_10145812
855 Ga0307414_10186756
856 Ga0307414_10312168
857 Ga0307411_10003661
858 Ga0307411_10005322
859 Ga0307411_10015738
860 Ga0307411_10064022
861 Ga0307411_10066756
862 Ga0307411_10118013
863 Ga0307411_10278912
864 Ga0307411_10389592
865 Ga0307411_10466794
866 Ga0307415_100003278
867 Ga0307415_100006781
868 Ga0307415_100013088
869 Ga0307415_100074812
870 Ga0307415_100164194
871 Ga0307415_100371014
872 Ga0307415_100745568
873 Ga0307415_100884008
874 Ga0373959_0087627
875 Ga0373929_0023940
876 Ga0373929_0064733
877 Ga0373940_0092479
878 Ga0373952_0051337
879 Ga0373941_0172818
880 Ga0373961_0116296
881 Ga0373962_0018335
882 Ga0373931_0025110
883 Ga0373931_0029922
884 Ga0373927_0072868
885 Ga0395905_0017294
886 Ga0395905_0415461
887 Ga0395905_0433001
888 Ga0395905_1001628
889 Ga0242420_004082
890 Ga0242420_022643
891 Ga0451577_0032266
892 Ga0451577_0165486
893 Ga0451577_0776617
894 Ga0453683_0117508
895 Ga0453683_0215333
896 Ga0453684_0274806
897 Ga0466959_0125052
898 Ga0451576_0002272
899 Ga0451576_0005642
900 Ga0451576_0007510
901 Ga0451576_0041491
902 Ga0451576_0072506
903 Ga0451576_0133907
904 Ga0451576_0238966
905 Ga0451576_1049857
906 Ga0495582_0219034
907 Ga0495582_0240313
908 Ga0496100_0017313
909 Ga0496100_0039824
910 Ga0496101_0119724
911 Ga0496101_0196815
912 Ga0496101_0209603
913 Ga0496101_0254729
914 Ga0496101_0561278
915 Ga0496102_0000926
916 Ga0496102_0051408
917 Ga0496102_0208306
918 Ga0496103_0033138
919 Ga0496104_0012653
920 Ga0496104_0017162
921 Ga0496104_0043252
922 Ga0496104_0045956
923 Ga0496105_0069606
924 Ga0496105_0421715
925 Ga0496106_0029434
926 Ga0496106_0099599
927 Ga0496106_0100826
928 Ga0496106_0381811
929 Ga0496107_0115324
930 Ga0496107_0719779
931 Ga0496108_0001523
932 Ga0496108_0026079
933 Ga0496108_0028443
934 Ga0496108_0112399
935 Ga0496109_0001242
936 Ga0496109_0009579
937 Ga0496109_0018976
938 Ga0496109_0149099
939 Ga0496109_0171813
940 Ga0496110_0074530
941 Ga0496110_0082974
942 Ga0496111_0003437
943 Ga0496111_0048992
944 Ga0496111_0077975
945 Ga0496112_0010947
946 Ga0496112_0011090
947 Ga0496112_0083072
948 Ga0496112_0275410
949 Ga0496112_0656932
950 Ga0496113_0002551
951 Ga0496113_0003509
952 Ga0496113_0005664
953 Ga0496113_0028104
954 Ga0496114_0086057
955 Ga0496115_0083848
956 Ga0496115_0144655
957 Ga0501031_0112331
958 Ga0501031_0157667
959 Ga0501033_0388244
960 Ga0501036_0218527
961 Ga0501036_0301993
962 Ga0501037_0043170
963 Ga0501038_0097517
964 Ga0501039_0028298
965 Ga0501040_0040554
966 Ga0501040_0056605
967 Ga0501041_0009554
968 Ga0501041_0290078
969 Ga0501041_0360425
970 Ga0501041_0438648
971 Ga0501042_0123401
972 Ga0501043_0243960
973 Ga0501046_0032724
974 Ga0501046_0204037
975 Ga0501047_0030200
976 Ga0501048_0024439
977 Ga0501048_0138703
978 Ga0501067_0000084
979 Ga0501067_0010371
980 Ga0501067_0111821
981 Ga0501067_0192154
982 Ga0501068_0000215
983 Ga0501068_0000885
984 Ga0501068_0041163
985 Ga0501068_0350933
986 Ga0501069_0000067
987 Ga0501069_0051422
988 Ga0501069_0124403
989 Ga0501070_0000522
990 Ga0501070_0005295
991 Ga0501070_0029982
992 Ga0501070_0031629
993 Ga0501070_0359733
994 Ga0501070_0379627
995 Ga0501071_0000022
996 Ga0501071_0000194
997 Ga0501071_0008868
998 Ga0501072_0000039
999 Ga0501072_0030052
1000 Ga0501072_0178397
1001 Ga0501072_0318162
1002 Ga0501073_0000175
1003 Ga0501073_0007402
1004 Ga0501074_0000139
1005 Ga0501074_0000311
1006 Ga0501074_0203504
1007 Ga0501075_0131458
1008 Ga0501075_0603235
1009 Ga0501076_0030192
1010 Ga0501076_0032189
1011 Ga0501076_0048536
1012 Ga0501076_0152974
1013 Ga0501076_0232150
1014 Ga0501077_0003255
1015 Ga0501077_0027350
1016 Ga0501202_017455
1017 Ga0501209_002430
1018 Ga0501217_016034
1019 Ga0501233_008989
1020 Ga0501235_008020
1021 Ga0501249_037562
1022 Ga0501225_0120241
1023 Ga0501079_0040994
1024 Ga0501079_0041856
1025 Ga0501079_0070056
1026 Ga0501079_0185174
1027 Ga0501079_0330772
1028 Ga0501079_0367933
1029 Ga0501080_0000621
1030 Ga0501080_0006954
1031 Ga0501080_0016072
1032 Ga0501080_0016591
1033 Ga0501080_0053800
1034 Ga0501080_0064806
1035 Ga0501080_0269396
1036 Ga0501081_0011406
1037 Ga0501081_0037299
1038 Ga0501081_0048202
1039 Ga0501081_0104562
1040 Ga0501081_0272482
1041 Ga0501083_0002061
1042 Ga0501083_0006186
1043 Ga0501268_002437
1044 Ga0501045_0002828
1045 Ga0501045_0037905
1046 nmdc:mga05p37_187810_c1
1047 nmdc:mga05p37_199192_c1
1048 nmdc:mga05p37_22624_c1
1049 nmdc:mga05p37_250588_c1
1050 nmdc:mga05p37_256451_c1
1051 nmdc:mga05p37_440234_c1
1052 nmdc:mga05p37_48674_c1
1053 nmdc:mga05p37_51295_c1
1054 nmdc:mga05p37_6185_c1
1055 nmdc:mga09592_12901_c1
1056 nmdc:mga0qj67_278706_c1
1057 nmdc:mga06r32_144601_c1
1058 nmdc:mga06r32_166673_c1
1059 nmdc:mga06r32_200987_c1
1060 nmdc:mga06r32_336648_c1
1061 nmdc:mga06r32_52664_c1
1062 nmdc:mga06r32_90101_c1
1063 nmdc:mga08y16_144859_c1
1064 nmdc:mga0n895_1261_c1
1065 nmdc:mga0n895_19822_c1
1066 nmdc:mga0n895_36188_c1
1067 nmdc:mga0n895_4080_c1
1068 nmdc:mga0n895_48946_c1
1069 nmdc:mga0n895_57685_c1
1070 nmdc:mga0n895_7788_c1
1071 nmdc:mga0n895_85978_c1
1072 nmdc:mga0n895_879101_c1
1073 nmdc:mga0rr50_17492_c1
1074 nmdc:mga0rr50_18798_c1
1075 nmdc:mga0rr50_198165_c1
1076 nmdc:mga0rr50_509550_c1
1077 nmdc:mga0rr50_511474_c1
1078 nmdc:mga0rr50_522853_c1
1079 nmdc:mga0rr50_794456_c1
1080 nmdc:mga0rr50_84284_c1
1081 nmdc:mga0rr50_89008_c1
1082 nmdc:mga08x19_116440_c1
1083 nmdc:mga08x19_24499_c1
1084 nmdc:mga08x19_28132_c1
1085 nmdc:mga08x19_34592_c1
1086 nmdc:mga08x19_86848_c1
1087 nmdc:mga08x19_94272_c1
1088 nmdc:mga0a205_1014398_c1
1089 nmdc:mga0a205_40676_c1
1090 nmdc:mga0a205_427989_c1
1091 nmdc:mga0a205_428211_c1
1092 nmdc:mga0a205_47294_c1
1093 nmdc:mga0a205_56884_c1
1094 nmdc:mga0a205_668304_c1
1095 nmdc:mga0a205_67441_c1
1096 nmdc:mga0a205_81602_c1
1097 nmdc:mga0a205_948_c1
1098 Ga0501084_0000845
1099 Ga0501084_0001192
1100 Ga0501084_0005089
1101 Ga0501084_0023501
1102 Ga0501084_0093063
1103 Ga0501084_0474292
1104 Ga0590075_007601
1105 Ga0590075_026670
1106 Ga0501082_0000449
1107 Ga0501082_0009401
1108 Ga0501082_0104199
1109 Ga0501082_0189924
1110 Ga0530510_0031072
1111 Ga0530510_0084003
1112 Ga0530510_0162539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

29

209

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.8727 1 200
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.8555 1 200
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.8527 1 200
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.8519 1 200
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.8476 1 195
ID Description Score Start End Superfamily
af_Q60369_7_206_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.85 7 195 3.90.870.10
3vthA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase; 0.8474 15 150 3.90.870.50
af_A0A1D8PQL4_32_243_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8456 7 202 3.90.870.10
af_P9WGC9_2_211_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8348 1 200 3.90.870.10
af_A0A0R0FM15_62_254_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8345 1 188 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A838QIN4-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.978 1 204 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A838QIN4-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9733 1 204 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-C1A915-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9696 2 198 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A2V7SBY6-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9691 3 147 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A2V7KUZ0-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9639 3 129 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779

Map