F463146

General Info

Members Datasets Scaffolds Average Seq Length
555 334 1110 219

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0041262|Ga0495635_0041262_759_1466
Length 235
Sequence VNGAQDLGGTHGHGPVKPEPNEPVFHAEWEKRAFALTLAMGMPGGWNIDMGRFARENRPPAEYLSMSYYQIWFAALEHMIKERGLVSEDEIDAGHSLHTPKPVKRILSPGDVAKTLHRGGPTERDTNTAAIFKPGDKVRAKNINPLTHTRLPRYVRGHVGTIERVVGCHVFPDSNATGAGEDESLGRRLGTLSGGGLKWAWTRKGRCAPRSPCPACPAMRMARCSASRGKRKPLQ

Samples

Sample ID Description Type Environment
1 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
312 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
315 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
316 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
317 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
318 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
319 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
320 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
324 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
325 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
326 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
327 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
328 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
329 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
334 2643221651 Afipia sp. Root123D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.18
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 0.18
Rhizoplane 8.65
Rhizosphere 86.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495635_0041262 3300046663 Bacteria 3188
2 ARSoilYngRDRAFT_c00569 3300000042 Bacteria 4030
3 ARcpr5yngRDRAFT_c000106 3300000043 Bacteria 13127
4 ARSoilOldRDRAFT_c000122 3300000044 Bacteria 13867
5 ARCol0yngRDRAFT_1000135 3300000652 Bacteria 13147
6 Ga0065712_10001322 3300005290 Bacteria 6174
7 Ga0065712_10116508 3300005290 Bacteria 1734
8 Ga0070676_10281916 3300005328 Bacteria 1120
9 Ga0070676_10376442 3300005328 Bacteria 982
10 Ga0070690_100002682 3300005330 Bacteria 9598
11 Ga0070690_100060487 3300005330 Bacteria 2438
12 Ga0068869_100298149 3300005334 Bacteria 1301
13 Ga0070666_10092819 3300005335 Bacteria 2076
14 Ga0070682_100023541 3300005337 Bacteria 3657
15 Ga0070682_100061566 3300005337 Bacteria 2376
16 Ga0070682_100156155 3300005337 Bacteria 1571
17 Ga0068868_100619741 3300005338 Bacteria 960
18 Ga0070660_100105756 3300005339 Bacteria 2234
19 Ga0070660_100110773 3300005339 Bacteria 2183
20 Ga0070660_100383116 3300005339 Bacteria 1161
21 Ga0070691_10058371 3300005341 Bacteria 1853
22 Ga0070691_10137245 3300005341 Bacteria 1244
23 Ga0070687_100464585 3300005343 Bacteria 845
24 Ga0070668_100160785 3300005347 Bacteria 1822
25 Ga0070671_100249230 3300005355 Bacteria 1508
26 Ga0070671_100319043 3300005355 Bacteria 1324
27 Ga0070674_100083735 3300005356 Bacteria 2285
28 Ga0070673_100136684 3300005364 Bacteria 2063
29 Ga0070673_100903219 3300005364 Bacteria 819
30 Ga0070688_100005519 3300005365 Bacteria 6672
31 Ga0070659_100081837 3300005366 Bacteria 2579
32 Ga0070659_100091070 3300005366 Bacteria 2444
33 Ga0070659_100485611 3300005366 Bacteria 1051
34 Ga0070667_100253526 3300005367 Bacteria 1574
35 Ga0070703_10090992 3300005406 Bacteria 1058
36 Ga0070709_10005633 3300005434 Bacteria 6782
37 Ga0070709_10045449 3300005434 Bacteria 2725
38 Ga0070714_100093885 3300005435 Bacteria 2632
39 Ga0070714_100187717 3300005435 Bacteria 1884
40 Ga0070713_100002128 3300005436 Bacteria 12817
41 Ga0070710_10001349 3300005437 Bacteria 11587
42 Ga0070710_10077076 3300005437 Bacteria 1936
43 Ga0070701_10007638 3300005438 Bacteria 4634
44 Ga0070711_100117066 3300005439 Bacteria 1965
45 Ga0070705_100350171 3300005440 Bacteria 1077
46 Ga0070705_100593229 3300005440 Bacteria 856
47 Ga0070694_100022885 3300005444 Bacteria 4011
48 Ga0070663_100119783 3300005455 Bacteria 1987
49 Ga0070663_100480511 3300005455 Bacteria 1028
50 Ga0070678_100207456 3300005456 Bacteria 1621
51 Ga0070678_100818357 3300005456 Bacteria 847
52 Ga0070662_100563281 3300005457 Bacteria 956
53 Ga0070681_10128970 3300005458 Bacteria 2461
54 Ga0070707_100272614 3300005468 Bacteria 1645
55 Ga0070684_100012301 3300005535 Bacteria 6854
56 Ga0070684_100964197 3300005535 Bacteria 800
57 Ga0070697_100438264 3300005536 Bacteria 1137
58 Ga0068853_100185225 3300005539 Bacteria 1889
59 Ga0070686_100014548 3300005544 Bacteria 4539
60 Ga0070686_100217660 3300005544 Bacteria 1378
61 Ga0070695_100012420 3300005545 Bacteria 5110
62 Ga0070696_100093203 3300005546 Bacteria 2147
63 Ga0070693_100097573 3300005547 Bacteria 1784
64 Ga0068855_100094226 3300005563 Bacteria 3453
65 Ga0070664_100079933 3300005564 Bacteria 2815
66 Ga0068856_100138588 3300005614 Bacteria 2439
67 Ga0068856_100494759 3300005614 Bacteria 1244
68 Ga0068856_100561414 3300005614 Bacteria 1163
69 Ga0070702_100021367 3300005615 Bacteria 3404
70 Ga0068852_100025662 3300005616 Bacteria 4778
71 Ga0068852_100392437 3300005616 Bacteria 1364
72 Ga0068852_100975293 3300005616 Bacteria 866
73 Ga0068859_100151514 3300005617 Bacteria 2394
74 Ga0068864_100034287 3300005618 Bacteria 4317
75 Ga0068866_10182342 3300005718 Bacteria 1241
76 Ga0068861_100101742 3300005719 Bacteria 2286
77 Ga0068851_10080501 3300005834 Bacteria 1700
78 Ga0068858_100141335 3300005842 Bacteria 2260
79 Ga0068858_100421567 3300005842 Bacteria 1283
80 Ga0068860_100023065 3300005843 Bacteria 6019
81 Ga0068860_100306816 3300005843 Bacteria 1556
82 Ga0068860_100344740 3300005843 Bacteria 1465
83 Ga0068860_100473476 3300005843 Bacteria 1247
84 Ga0081455_10003678 3300005937 Bacteria 17548
85 Ga0081455_10184760 3300005937 Bacteria 1575
86 Ga0081538_10014544 3300005981 Bacteria 6153
87 Ga0081538_10065061 3300005981 Bacteria 2057
88 Ga0081540_1041140 3300005983 Bacteria 2399
89 Ga0070717_10175432 3300006028 Bacteria 1866
90 Ga0070717_10799040 3300006028 Bacteria 858
91 Ga0075432_10079666 3300006058 Bacteria 1186
92 Ga0070715_10001134 3300006163 Bacteria 7602
93 Ga0070715_10167702 3300006163 Bacteria 1091
94 Ga0070716_100010186 3300006173 Bacteria 4709
95 Ga0070712_100201657 3300006175 Bacteria 1563
96 Ga0070712_100253037 3300006175 Bacteria 1409
97 Ga0070712_100496064 3300006175 Bacteria 1023
98 Ga0097621_100088221 3300006237 Bacteria 2591
99 Ga0097621_100381565 3300006237 Bacteria 1259
100 Ga0075370_10214521 3300006353 Bacteria 1137
101 Ga0068871_100104453 3300006358 Bacteria 2376
102 Ga0068871_100425142 3300006358 Bacteria 1187
103 Ga0075428_100020338 3300006844 Bacteria 7351
104 Ga0075430_100000327 3300006846 Bacteria 34023
105 Ga0075431_100000249 3300006847 Bacteria 40919
106 Ga0075431_100006602 3300006847 Bacteria 11526
107 Ga0075433_10004975 3300006852 Bacteria 10405
108 Ga0075433_10202243 3300006852 Bacteria 1766
109 Ga0075433_10534647 3300006852 Bacteria 1031
110 Ga0075433_10537766 3300006852 Bacteria 1027
111 Ga0075434_100118811 3300006871 Bacteria 2658
112 Ga0075434_100183071 3300006871 Bacteria 2116
113 Ga0075429_100001383 3300006880 Bacteria 19818
114 Ga0075429_100001736 3300006880 Bacteria 18048
115 Ga0068865_100491382 3300006881 Bacteria 1022
116 Ga0075436_100093484 3300006914 Bacteria 2091
117 Ga0075436_100102005 3300006914 Bacteria 1998
118 Ga0097620_100151508 3300006931 Bacteria 2394
119 Ga0097620_100387091 3300006931 Bacteria 1494
120 Ga0075435_100027539 3300007076 Bacteria 4448
121 Ga0075435_100086867 3300007076 Bacteria 2576
122 Ga0099795_10157873 3300007788 Bacteria 934
123 Ga0105251_10009966 3300009011 Bacteria 5561
124 Ga0105240_10582077 3300009093 Bacteria 1235
125 Ga0105240_10721054 3300009093 Bacteria 1087
126 Ga0111539_10000514 3300009094 Bacteria 49127
127 Ga0111539_10013120 3300009094 Bacteria 10364
128 Ga0111539_10013188 3300009094 Bacteria 10333
129 Ga0105245_10077429 3300009098 Bacteria 3032
130 Ga0105245_10396042 3300009098 Bacteria 1379
131 Ga0105245_10569461 3300009098 Bacteria 1156
132 Ga0105247_10079083 3300009101 Bacteria 2069
133 Ga0114129_10000242 3300009147 Bacteria 61249
134 Ga0114129_10016687 3300009147 Bacteria 10458
135 Ga0114129_10019987 3300009147 Bacteria 9533
136 Ga0105243_10064955 3300009148 Bacteria 2930
137 Ga0105241_10311337 3300009174 Bacteria 1355
138 Ga0105242_10056227 3300009176 Bacteria 3220
139 Ga0105242_10094702 3300009176 Bacteria 2520
140 Ga0105248_11450369 3300009177 Bacteria 777
141 Ga0105237_10159415 3300009545 Bacteria 2254
142 Ga0105249_10016871 3300009553 Bacteria 6480
143 Ga0105249_10041405 3300009553 Bacteria 4188
144 Ga0099796_10211971 3300010159 Bacteria 790
145 Ga0105239_10486234 3300010375 Bacteria 1403
146 Ga0157369_11032024 3300013105 Bacteria 841
147 Ga0157374_10666199 3300013296 Bacteria 1053
148 Ga0163162_10044532 3300013306 Bacteria 4445
149 Ga0157372_10200303 3300013307 Bacteria 2312
150 Ga0157372_11220653 3300013307 Bacteria 869
151 Ga0157375_10051674 3300013308 Bacteria 4037
152 Ga0157375_10939624 3300013308 Bacteria 1007
153 Ga0163163_10000482 3300014325 Bacteria 36134
154 Ga0157380_10024613 3300014326 Bacteria 4558
155 Ga0182008_10055432 3300014497 Bacteria 1960
156 Ga0157379_10248109 3300014968 Bacteria 1616
157 Ga0163161_10111136 3300017792 Bacteria 2049
158 Ga0206353_12051050 3300020082 Bacteria 2307
159 Ga0207697_10060487 3300025315 Bacteria 1575
160 Ga0207656_10201669 3300025321 Bacteria 961
161 Ga0207713_1045111 3300025735 Bacteria 1803
162 Ga0207692_10003105 3300025898 Bacteria 6448
163 Ga0207642_10230846 3300025899 Bacteria 1040
164 Ga0207710_10006493 3300025900 Bacteria 4988
165 Ga0207710_10054068 3300025900 Bacteria 1807
166 Ga0207680_10010979 3300025903 Bacteria 4556
167 Ga0207685_10005948 3300025905 Bacteria 3274
168 Ga0207699_10004926 3300025906 Bacteria 6392
169 Ga0207699_10062285 3300025906 Bacteria 2248
170 Ga0207645_10338779 3300025907 Bacteria 1005
171 Ga0207684_10105630 3300025910 Bacteria 2409
172 Ga0207684_10199735 3300025910 Bacteria 1725
173 Ga0207654_10626365 3300025911 Bacteria 769
174 Ga0207707_10011908 3300025912 Bacteria 7568
175 Ga0207695_10234965 3300025913 Bacteria 1736
176 Ga0207693_10002773 3300025915 Bacteria 15164
177 Ga0207693_10003927 3300025915 Bacteria 12659
178 Ga0207693_10092686 3300025915 Bacteria 2367
179 Ga0207693_10569545 3300025915 Bacteria 883
180 Ga0207663_10072473 3300025916 Bacteria 2226
181 Ga0207660_10131914 3300025917 Bacteria 1902
182 Ga0207662_10172526 3300025918 Bacteria 1387
183 Ga0207662_10235753 3300025918 Bacteria 1196
184 Ga0207657_10009809 3300025919 Bacteria 9595
185 Ga0207657_10287507 3300025919 Bacteria 1304
186 Ga0207652_10108046 3300025921 Bacteria 2465
187 Ga0207652_10270601 3300025921 Bacteria 1532
188 Ga0207646_10196515 3300025922 Bacteria 1822
189 Ga0207681_10717175 3300025923 Bacteria 832
190 Ga0207694_10662782 3300025924 Bacteria 879
191 Ga0207659_10118033 3300025926 Bacteria 2028
192 Ga0207659_10180060 3300025926 Bacteria 1674
193 Ga0207659_10291770 3300025926 Bacteria 1337
194 Ga0207687_10041650 3300025927 Bacteria 3155
195 Ga0207687_10283825 3300025927 Bacteria 1328
196 Ga0207700_10001520 3300025928 Bacteria 13129
197 Ga0207700_10034156 3300025928 Bacteria 3648
198 Ga0207700_10088671 3300025928 Bacteria 2436
199 Ga0207700_10396875 3300025928 Bacteria 1208
200 Ga0207664_10095433 3300025929 Bacteria 2446
201 Ga0207664_10129984 3300025929 Bacteria 2119
202 Ga0207644_10056415 3300025931 Bacteria 2834
203 Ga0207644_10119011 3300025931 Bacteria 2008
204 Ga0207644_10536846 3300025931 Bacteria 967
205 Ga0207690_10056157 3300025932 Bacteria 2655
206 Ga0207690_10249877 3300025932 Bacteria 1369
207 Ga0207706_10007082 3300025933 Bacteria 10370
208 Ga0207686_10018729 3300025934 Bacteria 3923
209 Ga0207686_10228885 3300025934 Bacteria 1346
210 Ga0207709_10005019 3300025935 Bacteria 7560
211 Ga0207709_10264709 3300025935 Bacteria 1262
212 Ga0207704_10023507 3300025938 Bacteria 3323
213 Ga0207704_10165427 3300025938 Bacteria 1579
214 Ga0207665_10000860 3300025939 Bacteria 20521
215 Ga0207665_10088690 3300025939 Bacteria 2140
216 Ga0207711_10126919 3300025941 Bacteria 2283
217 Ga0207689_10040891 3300025942 Bacteria 3836
218 Ga0207661_10235388 3300025944 Bacteria 1623
219 Ga0207679_10582861 3300025945 Bacteria 1006
220 Ga0207667_10093325 3300025949 Bacteria 3108
221 Ga0207712_10032090 3300025961 Bacteria 3543
222 Ga0207712_10236592 3300025961 Bacteria 1469
223 Ga0207668_10012372 3300025972 Bacteria 5223
224 Ga0207703_10131004 3300026035 Bacteria 2166
225 Ga0207639_10476191 3300026041 Bacteria 1137
226 Ga0207678_10014676 3300026067 Bacteria 6894
227 Ga0207678_10116498 3300026067 Bacteria 2279
228 Ga0207708_10026633 3300026075 Bacteria 4378
229 Ga0207702_10106426 3300026078 Bacteria 2485
230 Ga0207702_10265908 3300026078 Bacteria 1616
231 Ga0207702_10949697 3300026078 Bacteria 852
232 Ga0207641_10370422 3300026088 Bacteria 1369
233 Ga0207676_10020878 3300026095 Bacteria 4799
234 Ga0207676_10065808 3300026095 Bacteria 2887
235 Ga0207675_100216650 3300026118 Bacteria 1843
236 Ga0207683_10010487 3300026121 Bacteria 7906
237 Ga0207683_10148103 3300026121 Bacteria 2118
238 Ga0207698_10185973 3300026142 Bacteria 1845
239 Ga0209971_1047034 3300027682 Bacteria 1041
240 Ga0209966_1054728 3300027695 Bacteria 854
241 Ga0209998_10011782 3300027717 Bacteria 1814
242 Ga0209974_10072437 3300027876 Bacteria 1177
243 Ga0207428_10000287 3300027907 Bacteria 68018
244 Ga0207428_10000364 3300027907 Bacteria 58354
245 Ga0207428_10004946 3300027907 Bacteria 12547
246 Ga0268266_10058022 3300028379 Bacteria 3332
247 Ga0268265_10063494 3300028380 Bacteria 2841
248 Ga0268264_10132655 3300028381 Bacteria 2210
249 Ga0268264_10317059 3300028381 Bacteria 1473
250 Ga0268264_10521402 3300028381 Bacteria 1162
251 Ga0265318_10150153 3300028577 Bacteria 855
252 Ga0265330_10016297 3300031235 Bacteria 3430
253 Ga0265330_10138557 3300031235 Bacteria 1035
254 Ga0265332_10029767 3300031238 Bacteria 2386
255 Ga0265325_10000377 3300031241 Bacteria 31339
256 Ga0265325_10020437 3300031241 Bacteria 3649
257 Ga0265325_10062280 3300031241 Bacteria 1890
258 Ga0265340_10037935 3300031247 Bacteria 2385
259 Ga0265340_10142404 3300031247 Bacteria 1096
260 Ga0265339_10003705 3300031249 Bacteria 10656
261 Ga0265339_10244849 3300031249 Bacteria 870
262 Ga0265331_10010638 3300031250 Bacteria 5079
263 Ga0307408_100689308 3300031548 Bacteria 917
264 Ga0265313_10014709 3300031595 Bacteria 4606
265 Ga0265313_10020498 3300031595 Bacteria 3645
266 Ga0265313_10038364 3300031595 Bacteria 2386
267 Ga0265313_10070066 3300031595 Bacteria 1617
268 Ga0265314_10010054 3300031711 Bacteria 7930
269 Ga0265342_10274109 3300031712 Bacteria 895
270 Ga0307406_10079780 3300031901 Bacteria 2171
271 Ga0307412_10456055 3300031911 Bacteria 1054
272 Ga0307416_100379826 3300032002 Bacteria 1442
273 Ga0307411_10328188 3300032005 Bacteria 1239
274 Ga0373930_0000198 3300034816 Bacteria 7352
275 Ga0373948_0002798 3300034817 Bacteria 2617
276 Ga0373950_0000117 3300034818 Bacteria 14594
277 Ga0373958_0000359 3300034819 Bacteria 5477
278 Ga0373959_0001705 3300034820 Bacteria 3507
279 Ga0373938_0003708 3300034957 Bacteria 2517
280 Ga0373928_0009432 3300035084 Bacteria 1905
281 Ga0373929_0040808 3300035085 Bacteria 1030
282 Ga0373934_0081136 3300035086 Bacteria 1303
283 Ga0373934_0217619 3300035086 Bacteria 788
284 Ga0373944_0007373 3300035089 Bacteria 2946
285 Ga0373944_0047128 3300035089 Bacteria 1349
286 Ga0373949_0001805 3300035090 Bacteria 5853
287 Ga0373951_0000207 3300035091 Bacteria 21222
288 Ga0373951_0006062 3300035091 Bacteria 2778
289 Ga0373952_0006702 3300035092 Bacteria 2137
290 Ga0373923_0008639 3300035111 Bacteria 3644
291 Ga0373932_0002942 3300035112 Bacteria 4194
292 Ga0373932_0007719 3300035112 Bacteria 2567
293 Ga0373936_0009454 3300035113 Bacteria 3676
294 Ga0373939_0004093 3300035114 Bacteria 3434
295 Ga0373939_0029782 3300035114 Bacteria 1565
296 Ga0373941_0000017 3300035115 Bacteria 30339
297 Ga0373953_0253148 3300035117 Bacteria 765
298 Ga0373954_0009903 3300035118 Bacteria 4197
299 Ga0373956_0009551 3300035119 Bacteria 3951
300 Ga0373956_0024733 3300035119 Bacteria 2590
301 Ga0373956_0099399 3300035119 Bacteria 1348
302 Ga0373957_0009203 3300035120 Bacteria 3225
303 Ga0373943_0006569 3300035170 Bacteria 5217
304 Ga0373943_0222956 3300035170 Bacteria 1050
305 Ga0373946_0002134 3300035171 Bacteria 6932
306 Ga0373955_0006213 3300035172 Bacteria 5433
307 Ga0373955_0009408 3300035172 Bacteria 4571
308 Ga0373955_0013054 3300035172 Bacteria 4006
309 Ga0373942_0002430 3300035207 Bacteria 4526
310 Ga0373961_0005690 3300035241 Bacteria 2992
311 Ga0373924_0019050 3300035410 Bacteria 2654
312 Ga0373924_0033460 3300035410 Bacteria 2075
313 Ga0373924_0117733 3300035410 Bacteria 1151
314 Ga0373931_0031787 3300035691 Bacteria 2727
315 Ga0373931_0067024 3300035691 Bacteria 1949
316 Ga0373931_0173808 3300035691 Bacteria 1271
317 Ga0373935_0188292 3300035692 Bacteria 1420
318 Ga0373927_0116358 3300035695 Bacteria 1743
319 Ga0373927_0182774 3300035695 Bacteria 1375
320 Ga0373933_0006918 3300035724 Bacteria 6180
321 Ga0373933_0008657 3300035724 Bacteria 5548
322 Ga0373933_0364911 3300035724 Bacteria 939
323 Ga0373947_0202365 3300035725 Bacteria 1299
324 Ga0373937_0009754 3300036401 Bacteria 8370
325 Ga0373937_0014145 3300036401 Bacteria 7038
326 Ga0373937_0022870 3300036401 Bacteria 5623
327 Ga0373937_0026836 3300036401 Bacteria 5207
328 Ga0373937_0084682 3300036401 Bacteria 2933
329 Ga0373937_0658928 3300036401 Bacteria 992
330 Ga0373925_0081298 3300037068 Bacteria 2463
331 Ga0395900_0010716 3300037418 Bacteria 9377
332 Ga0395898_0023066 3300037466 Bacteria 6293
333 Ga0395901_0010295 3300038443 Bacteria 9471
334 Ga0439461_0026298 3300041410 Bacteria 1187
335 Ga0451577_0388928 3300042876 Bacteria 1266
336 Ga0453683_0182612 3300044673 Bacteria 1331
337 Ga0495592_0051786 3300046454 Bacteria 3049
338 Ga0495592_0078140 3300046454 Bacteria 2397
339 Ga0495592_0091630 3300046454 Bacteria 2179
340 Ga0495603_0176068 3300046455 Bacteria 1238
341 Ga0495629_0132306 3300046459 Bacteria 1737
342 Ga0495629_0257221 3300046459 Bacteria 1200
343 Ga0495641_0003584 3300046461 Bacteria 11514
344 Ga0495651_0009763 3300046462 Bacteria 7380
345 Ga0495651_0307532 3300046462 Bacteria 1061
346 Ga0495653_0042381 3300046463 Bacteria 3545
347 Ga0495653_0287692 3300046463 Bacteria 1076
348 Ga0495653_0328120 3300046463 Bacteria 990
349 Ga0495580_0031857 3300046472 Bacteria 3807
350 Ga0495582_0009087 3300046473 Bacteria 5481
351 Ga0495639_0112506 3300046475 Bacteria 1293
352 Ga0495664_0047693 3300046477 Bacteria 2542
353 Ga0495664_0047703 3300046477 Bacteria 2542
354 Ga0495584_0151096 3300046491 Bacteria 1180
355 Ga0495585_0000251 3300046492 Bacteria 55561
356 Ga0495607_0001699 3300046501 Bacteria 18921
357 Ga0495608_0002310 3300046511 Bacteria 13753
358 Ga0495608_0019643 3300046511 Bacteria 4649
359 Ga0495618_0028767 3300046514 Bacteria 3464
360 Ga0495618_0092290 3300046514 Bacteria 1936
361 Ga0495618_0124178 3300046514 Bacteria 1653
362 Ga0495628_0055226 3300046516 Bacteria 3128
363 Ga0495628_0210371 3300046516 Bacteria 1463
364 Ga0495630_0079387 3300046517 Bacteria 2475
365 Ga0495637_0032024 3300046520 Bacteria 2320
366 Ga0495644_0001507 3300046523 Bacteria 9495
367 Ga0495663_0009112 3300046525 Bacteria 2750
368 Ga0495666_0012798 3300046526 Bacteria 4182
369 Ga0495666_0201832 3300046526 Bacteria 914
370 Ga0495652_0004978 3300046529 Bacteria 12587
371 Ga0495652_0123699 3300046529 Bacteria 2058
372 Ga0495640_0057491 3300046533 Bacteria 2654
373 Ga0495640_0187550 3300046533 Bacteria 1315
374 Ga0495587_0010657 3300046536 Bacteria 5839
375 Ga0495587_0026783 3300046536 Bacteria 3512
376 Ga0495609_0028585 3300046538 Bacteria 2544
377 Ga0495621_0037320 3300046539 Bacteria 1690
378 Ga0495645_0083443 3300046543 Bacteria 2290
379 Ga0495645_0104773 3300046543 Bacteria 2008
380 Ga0495645_0111736 3300046543 Bacteria 1932
381 Ga0495645_0151181 3300046543 Bacteria 1613
382 Ga0495622_0003386 3300046557 Bacteria 7519
383 Ga0495633_0038178 3300046558 Bacteria 2295
384 Ga0495667_0007200 3300046559 Bacteria 7549
385 Ga0495667_0010453 3300046559 Bacteria 6279
386 Ga0495656_0000191 3300046615 Bacteria 22072
387 Ga0495635_0006416 3300046663 Bacteria 8200
388 Ga0495635_0007835 3300046663 Bacteria 7458
389 Ga0495635_0118208 3300046663 Bacteria 1809
390 Ga0495659_0000663 3300046664 Bacteria 12479
391 Ga0495588_0003207 3300046674 Bacteria 7082
392 Ga0495657_0010725 3300046675 Bacteria 6888
393 Ga0495657_0011246 3300046675 Bacteria 6703
394 Ga0495599_0015062 3300046678 Bacteria 4793
395 Ga0495623_0042576 3300046679 Bacteria 2892
396 Ga0495646_0038623 3300046680 Bacteria 2946
397 Ga0495646_0042739 3300046680 Bacteria 2779
398 Ga0495647_0042982 3300046681 Bacteria 1727
399 Ga0495613_0007435 3300046689 Bacteria 8164
400 Ga0495613_0365193 3300046689 Bacteria 989
401 Ga0495670_0000204 3300046691 Bacteria 26707
402 Ga0495600_0004823 3300046809 Bacteria 8096
403 Ga0495600_0013315 3300046809 Bacteria 5166
404 Ga0495581_0003287 3300047315 Bacteria 9279
405 Ga0495604_0003560 3300047317 Bacteria 12428
406 Ga0495604_0038095 3300047317 Bacteria 3783
407 Ga0495604_0152338 3300047317 Bacteria 1641
408 Ga0495674_0012744 3300047319 Bacteria 7919
409 Ga0495674_0046442 3300047319 Bacteria 3854
410 Ga0495674_0053060 3300047319 Bacteria 3566
411 Ga0495672_0127377 3300047320 Bacteria 1344
412 Ga0495680_0015472 3300047322 Bacteria 6582
413 Ga0495680_0017427 3300047322 Bacteria 6135
414 Ga0495680_0097580 3300047322 Bacteria 2193
415 Ga0495680_0461142 3300047322 Bacteria 868
416 Ga0495675_0020234 3300047444 Bacteria 4231
417 Ga0495675_0049150 3300047444 Bacteria 2681
418 Ga0495675_0082586 3300047444 Bacteria 2023
419 Ga0495684_0024718 3300047471 Bacteria 4620
420 Ga0495684_0167384 3300047471 Bacteria 1637
421 Ga0495593_0002332 3300047673 Bacteria 11402
422 Ga0495593_0066346 3300047673 Bacteria 1881
423 Ga0495593_0130904 3300047673 Bacteria 1273
424 Ga0495593_0196114 3300047673 Bacteria 1015
425 Ga0495602_0019382 3300048088 Bacteria 6755
426 Ga0495602_0099527 3300048088 Bacteria 2390
427 Ga0496100_0036593 3300048903 Bacteria 3097
428 Ga0496100_0070404 3300048903 Bacteria 2332
429 Ga0496101_0104765 3300048904 Bacteria 2122
430 Ga0496101_0142407 3300048904 Bacteria 1828
431 Ga0496101_0259720 3300048904 Bacteria 1354
432 Ga0496102_0012185 3300048905 Bacteria 7433
433 Ga0496104_0000082 3300048907 Bacteria 93223
434 Ga0496104_0044357 3300048907 Bacteria 4178
435 Ga0496104_0080202 3300048907 Bacteria 3111
436 Ga0496104_0133762 3300048907 Bacteria 2382
437 Ga0496104_0211590 3300048907 Bacteria 1850
438 Ga0496105_0000563 3300048908 Bacteria 24520
439 Ga0496105_0002542 3300048908 Bacteria 13233
440 Ga0496105_0087725 3300048908 Bacteria 2570
441 Ga0496105_0116695 3300048908 Bacteria 2202
442 Ga0496106_0024641 3300048909 Bacteria 4473
443 Ga0496106_0036706 3300048909 Bacteria 3665
444 Ga0496106_0171014 3300048909 Bacteria 1722
445 Ga0496107_0042107 3300048910 Bacteria 3280
446 Ga0496107_0042880 3300048910 Bacteria 3250
447 Ga0496108_0012947 3300048911 Bacteria 6797
448 Ga0496108_0019086 3300048911 Bacteria 5625
449 Ga0496108_0032762 3300048911 Bacteria 4316
450 Ga0496108_0233556 3300048911 Bacteria 1599
451 Ga0496109_0003316 3300048912 Bacteria 13454
452 Ga0496109_0064181 3300048912 Bacteria 3360
453 Ga0496109_0156243 3300048912 Bacteria 2136
454 Ga0496109_0369698 3300048912 Bacteria 1354
455 Ga0496109_0786695 3300048912 Bacteria 889
456 Ga0496110_0013600 3300048913 Bacteria 6736
457 Ga0496111_0010284 3300048914 Bacteria 6268
458 Ga0496111_0043951 3300048914 Bacteria 3211
459 Ga0496111_0209093 3300048914 Bacteria 1449
460 Ga0496112_0000009 3300048915 Bacteria 299708
461 Ga0496112_0003000 3300048915 Bacteria 13795
462 Ga0496112_0006605 3300048915 Bacteria 10208
463 Ga0496112_0205147 3300048915 Bacteria 1929
464 Ga0496112_0332761 3300048915 Bacteria 1462
465 Ga0496113_0001653 3300048916 Bacteria 12583
466 Ga0496113_0048545 3300048916 Bacteria 3158
467 Ga0496113_0102678 3300048916 Bacteria 2217
468 Ga0496113_0214082 3300048916 Bacteria 1534
469 Ga0496114_0146380 3300048917 Bacteria 2048
470 Ga0496114_0204818 3300048917 Bacteria 1729
471 Ga0496115_0007748 3300048918 Bacteria 7919
472 Ga0496115_0011688 3300048918 Bacteria 6590
473 Ga0496115_0054098 3300048918 Bacteria 3222
474 Ga0496115_0165875 3300048918 Bacteria 1826
475 Ga0496118_0042775 3300048921 Bacteria 3570
476 Ga0496119_0107650 3300048922 Bacteria 1554
477 Ga0496121_0001680 3300048924 Bacteria 36396
478 Ga0496121_0020161 3300048924 Bacteria 6619
479 Ga0496124_0420676 3300048927 Bacteria 921
480 Ga0496126_0180585 3300048929 Bacteria 1793
481 Ga0501032_0263062 3300049569 Bacteria 1118
482 Ga0501034_0138054 3300049571 Bacteria 2418
483 Ga0501036_0169614 3300049572 Bacteria 1839
484 Ga0501043_0324599 3300049579 Bacteria 1173
485 Ga0501047_0093171 3300049581 Bacteria 2892
486 Ga0501048_0389980 3300049582 Bacteria 995
487 Ga0501070_0089736 3300049586 Bacteria 2544
488 Ga0501070_0131157 3300049586 Bacteria 2070
489 Ga0501070_0202403 3300049586 Bacteria 1630
490 Ga0501072_0240812 3300049588 Bacteria 1441
491 Ga0501077_0066515 3300049593 Bacteria 2286
492 Ga0501080_0341224 3300049742 Bacteria 1354
493 Ga0501080_0596495 3300049742 Bacteria 981
494 Ga0501044_0055174 3300049823 Bacteria 4082
495 Ga0501044_0633913 3300049823 Bacteria 959
496 Ga0501045_0286068 3300049824 Bacteria 1227
497 nmdc:mga05p37_69_c1 3300050507 Bacteria 58220
498 nmdc:mga05p37_7097_c1 3300050507 Bacteria 13206
499 nmdc:mga05p37_75689_c1 3300050507 Bacteria 4144
500 nmdc:mga09592_1312_c1 3300050508 Bacteria 19961
501 nmdc:mga09592_1811_c1 3300050508 Bacteria 17155
502 nmdc:mga0qj67_952_c1 3300050509 Bacteria 19931
503 nmdc:mga06r32_26964_c1 3300050510 Bacteria 5362
504 nmdc:mga06r32_528_c1 3300050510 Bacteria 32999
505 nmdc:mga08y16_125_c1 3300050511 Bacteria 66606
506 nmdc:mga08y16_1304_c1 3300050511 Bacteria 24780
507 nmdc:mga08y16_3037_c1 3300050511 Bacteria 17332
508 nmdc:mga0n895_224628_c1 3300050512 Bacteria 1906
509 nmdc:mga0n895_46468_c1 3300050512 Bacteria 4242
510 nmdc:mga0n895_750293_c1 3300050512 Bacteria 969
511 nmdc:mga0n895_769_c1 3300050512 Bacteria 22759
512 nmdc:mga0rr50_192462_c1 3300050513 Bacteria 1672
513 nmdc:mga0rr50_75659_c1 3300050513 Bacteria 2582
514 nmdc:mga0rr50_92480_c1 3300050513 Bacteria 2358
515 nmdc:mga08x19_114418_c1 3300050514 Bacteria 1802
516 nmdc:mga08x19_503069_c1 3300050514 Bacteria 856
517 nmdc:mga0a205_414948_c1 3300050515 Bacteria 1209
518 nmdc:mga0a205_467639_c1 3300050515 Bacteria 1120
519 nmdc:mga0a205_64555_c1 3300050515 Bacteria 3537
520 nmdc:mga0a205_672361_c1 3300050515 Bacteria 886
521 Ga0495601_0000398 3300053077 Bacteria 23035
522 Ga0495601_0003764 3300053077 Bacteria 8729
523 Ga0495601_0053287 3300053077 Bacteria 2556
524 Ga0495601_0073302 3300053077 Bacteria 2188
525 Ga0495612_0004538 3300053078 Bacteria 5765
526 Ga0495612_0018221 3300053078 Bacteria 2811
527 Ga0495612_0027896 3300053078 Bacteria 2271
528 Ga0500635_0004196 3300053080 Bacteria 3693
529 Ga0495595_0017928 3300053084 Bacteria 3051
530 Ga0495595_0018754 3300053084 Bacteria 2993
531 Ga0495595_0022678 3300053084 Bacteria 2757
532 Ga0495619_0000086 3300053085 Bacteria 69774
533 Ga0495619_0026812 3300053085 Bacteria 3709
534 Ga0495619_0028949 3300053085 Bacteria 3575
535 Ga0500566_0000012 3300053094 Bacteria 117873
536 Ga0500640_000041 3300053095 Bacteria 19442
537 Ga0500572_000453 3300053111 Bacteria 14248
538 Ga0500591_073055 3300053115 Bacteria 1548
539 Ga0500595_000564 3300053119 Bacteria 22025
540 Ga0500608_010835 3300053122 Bacteria 3931
541 Ga0500614_001538 3300053123 Bacteria 5472
542 Ga0500559_0005664 3300053136 Bacteria 5715
543 Ga0500568_0004731 3300053139 Bacteria 7213
544 Ga0500590_029801 3300053148 Bacteria 2832
545 Ga0500603_000272 3300053150 Bacteria 13760
546 Ga0500620_155612 3300053155 Bacteria 795
547 Ga0500630_000455 3300053159 Bacteria 17894
548 Ga0500638_074785 3300053162 Bacteria 1615
549 Ga0500639_000008 3300053163 Bacteria 143238
550 Ga0500637_0065111 3300053178 Bacteria 2091
551 Ga0500645_000106 3300053730 Bacteria 67066
552 Ga0500596_000042 3300053735 Bacteria 16854
553 Ga0501084_0182065 3300054114 Bacteria 1774
554 2513717938 2513237104 Bacteria 10034502
555 2644290777 2643221651 Bacteria 4798932
556 Ga0495635_0041262
557 ARSoilYngRDRAFT_c00569
558 ARcpr5yngRDRAFT_c000106
559 ARSoilOldRDRAFT_c000122
560 ARCol0yngRDRAFT_1000135
561 Ga0065712_10001322
562 Ga0065712_10116508
563 Ga0070676_10281916
564 Ga0070676_10376442
565 Ga0070690_100002682
566 Ga0070690_100060487
567 Ga0068869_100298149
568 Ga0070666_10092819
569 Ga0070682_100023541
570 Ga0070682_100061566
571 Ga0070682_100156155
572 Ga0068868_100619741
573 Ga0070660_100105756
574 Ga0070660_100110773
575 Ga0070660_100383116
576 Ga0070691_10058371
577 Ga0070691_10137245
578 Ga0070687_100464585
579 Ga0070668_100160785
580 Ga0070671_100249230
581 Ga0070671_100319043
582 Ga0070674_100083735
583 Ga0070673_100136684
584 Ga0070673_100903219
585 Ga0070688_100005519
586 Ga0070659_100081837
587 Ga0070659_100091070
588 Ga0070659_100485611
589 Ga0070667_100253526
590 Ga0070703_10090992
591 Ga0070709_10005633
592 Ga0070709_10045449
593 Ga0070714_100093885
594 Ga0070714_100187717
595 Ga0070713_100002128
596 Ga0070710_10001349
597 Ga0070710_10077076
598 Ga0070701_10007638
599 Ga0070711_100117066
600 Ga0070705_100350171
601 Ga0070705_100593229
602 Ga0070694_100022885
603 Ga0070663_100119783
604 Ga0070663_100480511
605 Ga0070678_100207456
606 Ga0070678_100818357
607 Ga0070662_100563281
608 Ga0070681_10128970
609 Ga0070707_100272614
610 Ga0070684_100012301
611 Ga0070684_100964197
612 Ga0070697_100438264
613 Ga0068853_100185225
614 Ga0070686_100014548
615 Ga0070686_100217660
616 Ga0070695_100012420
617 Ga0070696_100093203
618 Ga0070693_100097573
619 Ga0068855_100094226
620 Ga0070664_100079933
621 Ga0068856_100138588
622 Ga0068856_100494759
623 Ga0068856_100561414
624 Ga0070702_100021367
625 Ga0068852_100025662
626 Ga0068852_100392437
627 Ga0068852_100975293
628 Ga0068859_100151514
629 Ga0068864_100034287
630 Ga0068866_10182342
631 Ga0068861_100101742
632 Ga0068851_10080501
633 Ga0068858_100141335
634 Ga0068858_100421567
635 Ga0068860_100023065
636 Ga0068860_100306816
637 Ga0068860_100344740
638 Ga0068860_100473476
639 Ga0081455_10003678
640 Ga0081455_10184760
641 Ga0081538_10014544
642 Ga0081538_10065061
643 Ga0081540_1041140
644 Ga0070717_10175432
645 Ga0070717_10799040
646 Ga0075432_10079666
647 Ga0070715_10001134
648 Ga0070715_10167702
649 Ga0070716_100010186
650 Ga0070712_100201657
651 Ga0070712_100253037
652 Ga0070712_100496064
653 Ga0097621_100088221
654 Ga0097621_100381565
655 Ga0075370_10214521
656 Ga0068871_100104453
657 Ga0068871_100425142
658 Ga0075428_100020338
659 Ga0075430_100000327
660 Ga0075431_100000249
661 Ga0075431_100006602
662 Ga0075433_10004975
663 Ga0075433_10202243
664 Ga0075433_10534647
665 Ga0075433_10537766
666 Ga0075434_100118811
667 Ga0075434_100183071
668 Ga0075429_100001383
669 Ga0075429_100001736
670 Ga0068865_100491382
671 Ga0075436_100093484
672 Ga0075436_100102005
673 Ga0097620_100151508
674 Ga0097620_100387091
675 Ga0075435_100027539
676 Ga0075435_100086867
677 Ga0099795_10157873
678 Ga0105251_10009966
679 Ga0105240_10582077
680 Ga0105240_10721054
681 Ga0111539_10000514
682 Ga0111539_10013120
683 Ga0111539_10013188
684 Ga0105245_10077429
685 Ga0105245_10396042
686 Ga0105245_10569461
687 Ga0105247_10079083
688 Ga0114129_10000242
689 Ga0114129_10016687
690 Ga0114129_10019987
691 Ga0105243_10064955
692 Ga0105241_10311337
693 Ga0105242_10056227
694 Ga0105242_10094702
695 Ga0105248_11450369
696 Ga0105237_10159415
697 Ga0105249_10016871
698 Ga0105249_10041405
699 Ga0099796_10211971
700 Ga0105239_10486234
701 Ga0157369_11032024
702 Ga0157374_10666199
703 Ga0163162_10044532
704 Ga0157372_10200303
705 Ga0157372_11220653
706 Ga0157375_10051674
707 Ga0157375_10939624
708 Ga0163163_10000482
709 Ga0157380_10024613
710 Ga0182008_10055432
711 Ga0157379_10248109
712 Ga0163161_10111136
713 Ga0206353_12051050
714 Ga0207697_10060487
715 Ga0207656_10201669
716 Ga0207713_1045111
717 Ga0207692_10003105
718 Ga0207642_10230846
719 Ga0207710_10006493
720 Ga0207710_10054068
721 Ga0207680_10010979
722 Ga0207685_10005948
723 Ga0207699_10004926
724 Ga0207699_10062285
725 Ga0207645_10338779
726 Ga0207684_10105630
727 Ga0207684_10199735
728 Ga0207654_10626365
729 Ga0207707_10011908
730 Ga0207695_10234965
731 Ga0207693_10002773
732 Ga0207693_10003927
733 Ga0207693_10092686
734 Ga0207693_10569545
735 Ga0207663_10072473
736 Ga0207660_10131914
737 Ga0207662_10172526
738 Ga0207662_10235753
739 Ga0207657_10009809
740 Ga0207657_10287507
741 Ga0207652_10108046
742 Ga0207652_10270601
743 Ga0207646_10196515
744 Ga0207681_10717175
745 Ga0207694_10662782
746 Ga0207659_10118033
747 Ga0207659_10180060
748 Ga0207659_10291770
749 Ga0207687_10041650
750 Ga0207687_10283825
751 Ga0207700_10001520
752 Ga0207700_10034156
753 Ga0207700_10088671
754 Ga0207700_10396875
755 Ga0207664_10095433
756 Ga0207664_10129984
757 Ga0207644_10056415
758 Ga0207644_10119011
759 Ga0207644_10536846
760 Ga0207690_10056157
761 Ga0207690_10249877
762 Ga0207706_10007082
763 Ga0207686_10018729
764 Ga0207686_10228885
765 Ga0207709_10005019
766 Ga0207709_10264709
767 Ga0207704_10023507
768 Ga0207704_10165427
769 Ga0207665_10000860
770 Ga0207665_10088690
771 Ga0207711_10126919
772 Ga0207689_10040891
773 Ga0207661_10235388
774 Ga0207679_10582861
775 Ga0207667_10093325
776 Ga0207712_10032090
777 Ga0207712_10236592
778 Ga0207668_10012372
779 Ga0207703_10131004
780 Ga0207639_10476191
781 Ga0207678_10014676
782 Ga0207678_10116498
783 Ga0207708_10026633
784 Ga0207702_10106426
785 Ga0207702_10265908
786 Ga0207702_10949697
787 Ga0207641_10370422
788 Ga0207676_10020878
789 Ga0207676_10065808
790 Ga0207675_100216650
791 Ga0207683_10010487
792 Ga0207683_10148103
793 Ga0207698_10185973
794 Ga0209971_1047034
795 Ga0209966_1054728
796 Ga0209998_10011782
797 Ga0209974_10072437
798 Ga0207428_10000287
799 Ga0207428_10000364
800 Ga0207428_10004946
801 Ga0268266_10058022
802 Ga0268265_10063494
803 Ga0268264_10132655
804 Ga0268264_10317059
805 Ga0268264_10521402
806 Ga0265318_10150153
807 Ga0265330_10016297
808 Ga0265330_10138557
809 Ga0265332_10029767
810 Ga0265325_10000377
811 Ga0265325_10020437
812 Ga0265325_10062280
813 Ga0265340_10037935
814 Ga0265340_10142404
815 Ga0265339_10003705
816 Ga0265339_10244849
817 Ga0265331_10010638
818 Ga0307408_100689308
819 Ga0265313_10014709
820 Ga0265313_10020498
821 Ga0265313_10038364
822 Ga0265313_10070066
823 Ga0265314_10010054
824 Ga0265342_10274109
825 Ga0307406_10079780
826 Ga0307412_10456055
827 Ga0307416_100379826
828 Ga0307411_10328188
829 Ga0373930_0000198
830 Ga0373948_0002798
831 Ga0373950_0000117
832 Ga0373958_0000359
833 Ga0373959_0001705
834 Ga0373938_0003708
835 Ga0373928_0009432
836 Ga0373929_0040808
837 Ga0373934_0081136
838 Ga0373934_0217619
839 Ga0373944_0007373
840 Ga0373944_0047128
841 Ga0373949_0001805
842 Ga0373951_0000207
843 Ga0373951_0006062
844 Ga0373952_0006702
845 Ga0373923_0008639
846 Ga0373932_0002942
847 Ga0373932_0007719
848 Ga0373936_0009454
849 Ga0373939_0004093
850 Ga0373939_0029782
851 Ga0373941_0000017
852 Ga0373953_0253148
853 Ga0373954_0009903
854 Ga0373956_0009551
855 Ga0373956_0024733
856 Ga0373956_0099399
857 Ga0373957_0009203
858 Ga0373943_0006569
859 Ga0373943_0222956
860 Ga0373946_0002134
861 Ga0373955_0006213
862 Ga0373955_0009408
863 Ga0373955_0013054
864 Ga0373942_0002430
865 Ga0373961_0005690
866 Ga0373924_0019050
867 Ga0373924_0033460
868 Ga0373924_0117733
869 Ga0373931_0031787
870 Ga0373931_0067024
871 Ga0373931_0173808
872 Ga0373935_0188292
873 Ga0373927_0116358
874 Ga0373927_0182774
875 Ga0373933_0006918
876 Ga0373933_0008657
877 Ga0373933_0364911
878 Ga0373947_0202365
879 Ga0373937_0009754
880 Ga0373937_0014145
881 Ga0373937_0022870
882 Ga0373937_0026836
883 Ga0373937_0084682
884 Ga0373937_0658928
885 Ga0373925_0081298
886 Ga0395900_0010716
887 Ga0395898_0023066
888 Ga0395901_0010295
889 Ga0439461_0026298
890 Ga0451577_0388928
891 Ga0453683_0182612
892 Ga0495592_0051786
893 Ga0495592_0078140
894 Ga0495592_0091630
895 Ga0495603_0176068
896 Ga0495629_0132306
897 Ga0495629_0257221
898 Ga0495641_0003584
899 Ga0495651_0009763
900 Ga0495651_0307532
901 Ga0495653_0042381
902 Ga0495653_0287692
903 Ga0495653_0328120
904 Ga0495580_0031857
905 Ga0495582_0009087
906 Ga0495639_0112506
907 Ga0495664_0047693
908 Ga0495664_0047703
909 Ga0495584_0151096
910 Ga0495585_0000251
911 Ga0495607_0001699
912 Ga0495608_0002310
913 Ga0495608_0019643
914 Ga0495618_0028767
915 Ga0495618_0092290
916 Ga0495618_0124178
917 Ga0495628_0055226
918 Ga0495628_0210371
919 Ga0495630_0079387
920 Ga0495637_0032024
921 Ga0495644_0001507
922 Ga0495663_0009112
923 Ga0495666_0012798
924 Ga0495666_0201832
925 Ga0495652_0004978
926 Ga0495652_0123699
927 Ga0495640_0057491
928 Ga0495640_0187550
929 Ga0495587_0010657
930 Ga0495587_0026783
931 Ga0495609_0028585
932 Ga0495621_0037320
933 Ga0495645_0083443
934 Ga0495645_0104773
935 Ga0495645_0111736
936 Ga0495645_0151181
937 Ga0495622_0003386
938 Ga0495633_0038178
939 Ga0495667_0007200
940 Ga0495667_0010453
941 Ga0495656_0000191
942 Ga0495635_0006416
943 Ga0495635_0007835
944 Ga0495635_0118208
945 Ga0495659_0000663
946 Ga0495588_0003207
947 Ga0495657_0010725
948 Ga0495657_0011246
949 Ga0495599_0015062
950 Ga0495623_0042576
951 Ga0495646_0038623
952 Ga0495646_0042739
953 Ga0495647_0042982
954 Ga0495613_0007435
955 Ga0495613_0365193
956 Ga0495670_0000204
957 Ga0495600_0004823
958 Ga0495600_0013315
959 Ga0495581_0003287
960 Ga0495604_0003560
961 Ga0495604_0038095
962 Ga0495604_0152338
963 Ga0495674_0012744
964 Ga0495674_0046442
965 Ga0495674_0053060
966 Ga0495672_0127377
967 Ga0495680_0015472
968 Ga0495680_0017427
969 Ga0495680_0097580
970 Ga0495680_0461142
971 Ga0495675_0020234
972 Ga0495675_0049150
973 Ga0495675_0082586
974 Ga0495684_0024718
975 Ga0495684_0167384
976 Ga0495593_0002332
977 Ga0495593_0066346
978 Ga0495593_0130904
979 Ga0495593_0196114
980 Ga0495602_0019382
981 Ga0495602_0099527
982 Ga0496100_0036593
983 Ga0496100_0070404
984 Ga0496101_0104765
985 Ga0496101_0142407
986 Ga0496101_0259720
987 Ga0496102_0012185
988 Ga0496104_0000082
989 Ga0496104_0044357
990 Ga0496104_0080202
991 Ga0496104_0133762
992 Ga0496104_0211590
993 Ga0496105_0000563
994 Ga0496105_0002542
995 Ga0496105_0087725
996 Ga0496105_0116695
997 Ga0496106_0024641
998 Ga0496106_0036706
999 Ga0496106_0171014
1000 Ga0496107_0042107
1001 Ga0496107_0042880
1002 Ga0496108_0012947
1003 Ga0496108_0019086
1004 Ga0496108_0032762
1005 Ga0496108_0233556
1006 Ga0496109_0003316
1007 Ga0496109_0064181
1008 Ga0496109_0156243
1009 Ga0496109_0369698
1010 Ga0496109_0786695
1011 Ga0496110_0013600
1012 Ga0496111_0010284
1013 Ga0496111_0043951
1014 Ga0496111_0209093
1015 Ga0496112_0000009
1016 Ga0496112_0003000
1017 Ga0496112_0006605
1018 Ga0496112_0205147
1019 Ga0496112_0332761
1020 Ga0496113_0001653
1021 Ga0496113_0048545
1022 Ga0496113_0102678
1023 Ga0496113_0214082
1024 Ga0496114_0146380
1025 Ga0496114_0204818
1026 Ga0496115_0007748
1027 Ga0496115_0011688
1028 Ga0496115_0054098
1029 Ga0496115_0165875
1030 Ga0496118_0042775
1031 Ga0496119_0107650
1032 Ga0496121_0001680
1033 Ga0496121_0020161
1034 Ga0496124_0420676
1035 Ga0496126_0180585
1036 Ga0501032_0263062
1037 Ga0501034_0138054
1038 Ga0501036_0169614
1039 Ga0501043_0324599
1040 Ga0501047_0093171
1041 Ga0501048_0389980
1042 Ga0501070_0089736
1043 Ga0501070_0131157
1044 Ga0501070_0202403
1045 Ga0501072_0240812
1046 Ga0501077_0066515
1047 Ga0501080_0341224
1048 Ga0501080_0596495
1049 Ga0501044_0055174
1050 Ga0501044_0633913
1051 Ga0501045_0286068
1052 nmdc:mga05p37_69_c1
1053 nmdc:mga05p37_7097_c1
1054 nmdc:mga05p37_75689_c1
1055 nmdc:mga09592_1312_c1
1056 nmdc:mga09592_1811_c1
1057 nmdc:mga0qj67_952_c1
1058 nmdc:mga06r32_26964_c1
1059 nmdc:mga06r32_528_c1
1060 nmdc:mga08y16_125_c1
1061 nmdc:mga08y16_1304_c1
1062 nmdc:mga08y16_3037_c1
1063 nmdc:mga0n895_224628_c1
1064 nmdc:mga0n895_46468_c1
1065 nmdc:mga0n895_750293_c1
1066 nmdc:mga0n895_769_c1
1067 nmdc:mga0rr50_192462_c1
1068 nmdc:mga0rr50_75659_c1
1069 nmdc:mga0rr50_92480_c1
1070 nmdc:mga08x19_114418_c1
1071 nmdc:mga08x19_503069_c1
1072 nmdc:mga0a205_414948_c1
1073 nmdc:mga0a205_467639_c1
1074 nmdc:mga0a205_64555_c1
1075 nmdc:mga0a205_672361_c1
1076 Ga0495601_0000398
1077 Ga0495601_0003764
1078 Ga0495601_0053287
1079 Ga0495601_0073302
1080 Ga0495612_0004538
1081 Ga0495612_0018221
1082 Ga0495612_0027896
1083 Ga0500635_0004196
1084 Ga0495595_0017928
1085 Ga0495595_0018754
1086 Ga0495595_0022678
1087 Ga0495619_0000086
1088 Ga0495619_0026812
1089 Ga0495619_0028949
1090 Ga0500566_0000012
1091 Ga0500640_000041
1092 Ga0500572_000453
1093 Ga0500591_073055
1094 Ga0500595_000564
1095 Ga0500608_010835
1096 Ga0500614_001538
1097 Ga0500559_0005664
1098 Ga0500568_0004731
1099 Ga0500590_029801
1100 Ga0500603_000272
1101 Ga0500620_155612
1102 Ga0500630_000455
1103 Ga0500638_074785
1104 Ga0500639_000008
1105 Ga0500637_0065111
1106 Ga0500645_000106
1107 Ga0500596_000042
1108 Ga0501084_0182065
1109 2513717938
1110 2644290777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02211

NHase_beta_C

Nitrile hydratase beta subunit, C-terminal

121

185

0.96

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

1

117

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6th6-assembly1.cif.gz_BU cryo-em structure of t. kodakarensis 70s ribosome 0.8103 130 219
5gak-assembly1.cif.gz_V yeast 60s ribosomal subunit with a-site trna, p-site trna and eif-5a 0.8058 130 219
4v6u-assembly1.cif.gz_BR promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.7774 130 219
8hl3-assembly1.cif.gz_L21E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.7672 130 219
2dd4-assembly1.cif.gz_G thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme 0.7558 104 219
ID Description Score Start End Superfamily
4ob3B02 Mainly Beta;Roll;SH3 type barrels.; 0.9626 123 218 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9589 124 219 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9508 124 219 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9317 124 219 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9307 124 219 2.30.30.50
ID Description Score Start End GO Terms
AF-A0A527ZDG4-F1-model_v4 Nitrile hydratase subunit beta 0.9644 153 219
AF-A0A2A4ZLD0-F1-model_v4 deleted 0.9587 135 219
AF-A0A7C5KQH9-F1-model_v4 Nitrile hydratase subunit beta 0.954 133 217
AF-A0A527ZDG4-F1-model_v4 Nitrile hydratase subunit beta 0.9507 153 219
AF-A0A523CYD7-F1-model_v4 Nitrile hydratase subunit beta 0.9479 142 219

Map