F462937

General Info

Members Datasets Scaffolds Average Seq Length
554 335 512 222

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10004522|JGI24740J21852_100045224
Length 224
Sequence VDISNLIQTVLIYALPVIFAITVHEAAHGYVARHFGDNTAEVMGRVTLNPVKHIDPIGTILMPLMLYFATSGAFLFGYAKPVPVNFGRLRHPKRDMVWVALAGPVSNFIQAILWAVLLITLIAAGLDSKHFFIQMAQGGILVNLVMWAFNLFPLPPLDGGRVLAGLLPSGQAQMFLARIEPYGFFIVMGLVLAGIVSTYWLRPLMDVGYFVINLLITPLKALLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
4 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
10 2643221658 Variovorax sp. Root411 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2643221683 Variovorax sp. Root473 Isolate Unclassified
13 2721755523 Delftia sp. HK171 Isolate Unclassified
14 2738541277 Variovorax sp. GV051 Isolate Unclassified
15 2738541307 Variovorax sp. GV008 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2818991446 Variovorax sp. 1180 Isolate Unclassified
18 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
19 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
20 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
21 2842677519 Variovorax sp. R-72495 Isolate Unclassified
22 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
23 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
24 2885266251 Ralstonia sp. SET104 Isolate Nodule
25 2899924645 Variovorax sp. 369 Isolate Unclassified
26 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
27 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
28 2904456579 Variovorax sp. 2002 Isolate Unclassified
29 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
30 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
31 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
32 2928037797 Variovorax sp. 1126 Isolate Unclassified
33 2928044640 Variovorax sp. 1128 Isolate Unclassified
34 2928051484 Variovorax sp. 1133 Isolate Unclassified
35 2928058823 Ralstonia sp. 1138 Isolate Unclassified
36 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
37 2928070936 Variovorax gossypii 1167 Isolate Unclassified
38 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
39 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
40 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
41 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
42 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
43 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
47 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
48 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
49 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
50 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
57 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
58 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
59 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
60 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
61 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
75 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
76 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
88 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
137 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
146 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
151 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
200 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
201 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
202 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
203 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
204 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
228 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
229 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
233 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
234 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
235 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
236 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
237 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
238 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
243 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
244 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
245 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
246 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
306 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
307 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
319 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
320 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
321 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
322 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
323 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
324 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
325 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
326 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.16
Metatranscriptomes 1.26
Isolates 7.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.2
Nodule 1.44
Rhizoplane 1.62
Rhizosphere 47.47
Stem 0
Stem Tuber 0
Unclassified 14.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2582705 2162886007 Bacteria 1830
2 JGI24740J21852_10000861 3300001979 Bacteria 13400
3 JGI24740J21852_10004522 3300001979 Bacteria 5985
4 JGI24739J22299_10009188 3300001989 Bacteria 3689
5 JGI25155J39150_1000104 3300002704 Bacteria 45159
6 JGI25156J39149_1000089 3300002705 Bacteria 68168
7 JGI25156J39149_1006899 3300002705 Bacteria 3050
8 JGI25154J39366_1000115 3300002738 Bacteria 68056
9 JGI25154J39366_1000886 3300002738 Bacteria 12804
10 JGI25157J39369_1000118 3300002741 Bacteria 68168
11 JGI25152J39213_1007682 3300002773 Bacteria 2766
12 JGI25151J46595_10008567 3300003187 Bacteria 4903
13 rootH1_10013892 3300003316 Bacteria 3161
14 rootH2_10067992 3300003320 Bacteria 1800
15 rootL2_10082545 3300003322 Bacteria 1573
16 rootL2_10082546 3300003322 Bacteria 1117
17 rootL2_10328530 3300003322 Bacteria 1320
18 rootH1_10019992 3300003323 Bacteria 2407
19 JGI25160J50197_1000281 3300003354 Bacteria 37019
20 JGI25161J50226_1000124 3300003374 Bacteria 56436
21 Ga0055539_1000034 3300003752 Bacteria 223400
22 Ga0055539_1014703 3300003752 Bacteria 953
23 Ga0055532_1000002 3300003758 Bacteria 576000
24 Ga0055525_1000660 3300003759 Bacteria 13305
25 Ga0055527_1000729 3300003760 Bacteria 9342
26 Ga0055527_1008441 3300003760 Bacteria 1229
27 Ga0055535_1000444 3300003761 Bacteria 38262
28 Ga0055542_1000127 3300003762 Bacteria 100078
29 Ga0055542_1001411 3300003762 Bacteria 12092
30 Ga0055542_1001450 3300003762 Bacteria 11766
31 Ga0055529_1000028 3300003763 Bacteria 287650
32 Ga0055526_1004181 3300003771 Bacteria 8782
33 Ga0055526_1014963 3300003771 Bacteria 3149
34 Ga0055526_1017780 3300003771 Bacteria 2695
35 Ga0055537_1000741 3300003773 Bacteria 16713
36 Ga0055537_1002621 3300003773 Bacteria 5881
37 Ga0055537_1007912 3300003773 Bacteria 2505
38 Ga0055524_1000360 3300003775 Bacteria 40907
39 Ga0055524_1001538 3300003775 Bacteria 13046
40 Ga0055524_1033815 3300003775 Bacteria 1424
41 Ga0055536_1000588 3300003781 Bacteria 24780
42 Ga0055536_1014047 3300003781 Bacteria 2839
43 Ga0055536_1024705 3300003781 Bacteria 1733
44 Ga0055534_1000686 3300003784 Bacteria 16713
45 Ga0055534_1000946 3300003784 Bacteria 12933
46 Ga0055534_1001087 3300003784 Bacteria 11641
47 Ga0055534_1002450 3300003784 Bacteria 6412
48 Ga0055528_1001964 3300003790 Bacteria 11610
49 Ga0055530_10013154 3300003791 Bacteria 2839
50 Ga0055530_10016774 3300003791 Bacteria 2321
51 Ga0055530_10023704 3300003791 Bacteria 1757
52 Ga0055540_1002688 3300003792 Bacteria 9163
53 Ga0055540_1003967 3300003792 Bacteria 6901
54 Ga0055540_1006040 3300003792 Bacteria 4904
55 Ga0055531_10000765 3300003794 Bacteria 26813
56 Ga0055531_10018758 3300003794 Bacteria 2839
57 Ga0055531_10018915 3300003794 Bacteria 2818
58 Ga0055541_1000537 3300003841 Bacteria 10407
59 Ga0055543_1003544 3300004625 Bacteria 4537
60 Ga0055543_1022259 3300004625 Bacteria 1151
61 Ga0065714_10104364 3300005288 Bacteria 1586
62 Ga0065704_10104047 3300005289 Bacteria 2153
63 Ga0070658_10316220 3300005327 Bacteria 1333
64 Ga0070658_10335849 3300005327 Bacteria 1292
65 Ga0070660_100075338 3300005339 Bacteria 2642
66 Ga0070661_100000063 3300005344 Bacteria 85407
67 Ga0070669_100155387 3300005353 Bacteria 1773
68 Ga0070675_100578828 3300005354 Bacteria 1017
69 Ga0070674_100139611 3300005356 Bacteria 1817
70 Ga0070674_100299640 3300005356 Bacteria 1281
71 Ga0070659_100000856 3300005366 Bacteria 22237
72 Ga0070714_100714246 3300005435 Bacteria 968
73 Ga0070663_100000006 3300005455 Bacteria 208068
74 Ga0070662_100133103 3300005457 Bacteria 1919
75 Ga0070681_10185958 3300005458 Bacteria 1998
76 Ga0070679_100029946 3300005530 Bacteria 5370
77 Ga0068853_100038988 3300005539 Bacteria 4050
78 Ga0070665_100004201 3300005548 Bacteria 15157
79 Ga0068855_100177446 3300005563 Bacteria 2409
80 Ga0068855_100272526 3300005563 Bacteria 1882
81 Ga0068855_100281722 3300005563 Bacteria 1846
82 Ga0070664_100000002 3300005564 Bacteria 458815
83 Ga0068857_100004824 3300005577 Bacteria 11424
84 Ga0068854_100000093 3300005578 Bacteria 63395
85 Ga0068854_100277617 3300005578 Bacteria 1348
86 Ga0068856_100000028 3300005614 Bacteria 131498
87 Ga0068851_10051182 3300005834 Bacteria 2098
88 Ga0075365_10085187 3300006038 Bacteria 2146
89 Ga0075365_10388191 3300006038 Bacteria 985
90 Ga0075363_100275004 3300006048 Bacteria 973
91 Ga0075363_100280774 3300006048 Bacteria 963
92 Ga0075364_10032761 3300006051 Bacteria 3341
93 Ga0075432_10049710 3300006058 Bacteria 1477
94 Ga0075362_10040858 3300006177 Bacteria 2043
95 Ga0075362_10152974 3300006177 Bacteria 1108
96 Ga0075362_10168996 3300006177 Bacteria 1056
97 Ga0075367_10080029 3300006178 Bacteria 1976
98 Ga0075369_10031340 3300006186 Bacteria 2243
99 Ga0075366_10018482 3300006195 Bacteria 4025
100 Ga0075366_10081737 3300006195 Bacteria 1930
101 Ga0075366_10282202 3300006195 Bacteria 1015
102 Ga0075366_10311612 3300006195 Bacteria 963
103 Ga0075366_10401171 3300006195 Bacteria 844
104 Ga0075370_10020473 3300006353 Bacteria 3617
105 Ga0075370_10043817 3300006353 Bacteria 2529
106 Ga0075370_10220651 3300006353 Bacteria 1120
107 Ga0068871_100178540 3300006358 Bacteria 1824
108 Ga0079104_1026104 3300006946 Bacteria 1514
109 Ga0099826_10000004 3300006948 Bacteria 802669
110 Ga0099826_10002661 3300006948 Bacteria 11663
111 Ga0105251_10038466 3300009011 Bacteria 2343
112 Ga0105244_10009227 3300009036 Bacteria 6084
113 Ga0105244_10083717 3300009036 Bacteria 1576
114 Ga0105250_10001549 3300009092 Bacteria 12351
115 Ga0105240_10012990 3300009093 Bacteria 11470
116 Ga0105240_10103622 3300009093 Bacteria 3456
117 Ga0105240_10404536 3300009093 Bacteria 1537
118 Ga0105243_10004995 3300009148 Bacteria 10394
119 Ga0105243_10056277 3300009148 Bacteria 3127
120 Ga0105243_10262233 3300009148 Bacteria 1548
121 Ga0105243_10560592 3300009148 Bacteria 1093
122 Ga0105241_10608758 3300009174 Bacteria 988
123 Ga0105242_10826521 3300009176 Bacteria 919
124 Ga0105237_10086401 3300009545 Bacteria 3126
125 Ga0105237_10298383 3300009545 Bacteria 1614
126 Ga0105249_11252054 3300009553 Bacteria 813
127 Ga0105148_104401 3300009978 Bacteria 1005
128 Ga0105239_10061593 3300010375 Bacteria 4118
129 Ga0105239_10196260 3300010375 Bacteria 2260
130 Ga0105246_10372650 3300011119 Bacteria 1177
131 Ga0105246_10484454 3300011119 Bacteria 1047
132 Ga0105246_10510900 3300011119 Bacteria 1022
133 Ga0157373_10242444 3300013100 Bacteria 1274
134 Ga0157373_10295431 3300013100 Bacteria 1149
135 Ga0157371_10000123 3300013102 Bacteria 118119
136 Ga0157370_10000013 3300013104 Bacteria 198861
137 Ga0157369_10002729 3300013105 Bacteria 21078
138 Ga0157369_10006810 3300013105 Bacteria 13180
139 Ga0157372_10000067 3300013307 Bacteria 111621
140 Ga0182008_10061743 3300014497 Bacteria 1847
141 Ga0182006_1000486 3300015261 Bacteria 31112
142 Ga0182006_1002000 3300015261 Bacteria 11485
143 Ga0182006_1022589 3300015261 Bacteria 2614
144 Ga0182006_1032750 3300015261 Bacteria 2087
145 Ga0182007_10001482 3300015262 Bacteria 12559
146 Ga0182007_10002603 3300015262 Bacteria 8886
147 Ga0182007_10047464 3300015262 Bacteria 1420
148 Ga0182005_1099026 3300015265 Bacteria 816
149 Ga0163161_10045297 3300017792 Bacteria 3172
150 Ga0163161_10136183 3300017792 Bacteria 1857
151 Ga0197907_10926987 3300020069 Bacteria 3851
152 Ga0206356_10261372 3300020070 Bacteria 2400
153 Ga0206351_10276860 3300020077 Bacteria 13540
154 Ga0154015_1572807 3300020610 Bacteria 29913
155 Ga0209435_100002 3300025206 Bacteria 794178
156 Ga0209436_113323 3300025208 Bacteria 1349
157 Ga0209784_100003 3300025224 Bacteria 1379451
158 Ga0209566_100002 3300025225 Bacteria 2614868
159 Ga0209566_100534 3300025225 Bacteria 25886
160 Ga0209566_101105 3300025225 Bacteria 10413
161 Ga0209674_100008 3300025226 Bacteria 1076909
162 Ga0209674_100179 3300025226 Bacteria 77366
163 Ga0209674_100334 3300025226 Bacteria 28536
164 Ga0209672_100052 3300025228 Bacteria 231179
165 Ga0209672_101800 3300025228 Bacteria 6580
166 Ga0209147_100002 3300025229 Bacteria 2158988
167 Ga0209147_101313 3300025229 Bacteria 9569
168 Ga0209563_100004 3300025230 Bacteria 1814108
169 Ga0209563_103947 3300025230 Bacteria 2928
170 Ga0209563_108159 3300025230 Bacteria 1669
171 Ga0209258_100002 3300025242 Bacteria 2158988
172 Ga0209258_100078 3300025242 Bacteria 263996
173 Ga0207425_1020292 3300025245 Bacteria 1422
174 Ga0209646_1000001 3300025246 Bacteria 3092932
175 Ga0209646_1000022 3300025246 Bacteria 446621
176 Ga0209026_1000001 3300025250 Bacteria 1228671
177 Ga0209026_1003742 3300025250 Bacteria 4828
178 Ga0209677_100009 3300025253 Bacteria 749530
179 Ga0209677_110256 3300025253 Bacteria 1580
180 Ga0209148_1000021 3300025254 Bacteria 714645
181 Ga0209148_1000086 3300025254 Bacteria 263996
182 Ga0209148_1008202 3300025254 Bacteria 2112
183 Ga0209759_1000001 3300025256 Bacteria 2799452
184 Ga0209759_1003223 3300025256 Bacteria 6602
185 Ga0209759_1007807 3300025256 Bacteria 3396
186 Ga0209129_1007455 3300025258 Bacteria 3254
187 Ga0209565_1000067 3300025263 Bacteria 171247
188 Ga0209565_1000235 3300025263 Bacteria 60351
189 Ga0209565_1001195 3300025263 Bacteria 12379
190 Ga0209565_1040087 3300025263 Bacteria 876
191 Ga0209455_1000021 3300025272 Bacteria 699993
192 Ga0209673_1000097 3300025273 Bacteria 193482
193 Ga0209673_1002750 3300025273 Bacteria 11539
194 Ga0209673_1006771 3300025273 Bacteria 5445
195 Ga0209673_1044206 3300025273 Bacteria 1236
196 Ga0209673_1049785 3300025273 Bacteria 1117
197 Ga0209130_1000627 3300025284 Bacteria 33309
198 Ga0209130_1001183 3300025284 Bacteria 18648
199 Ga0209130_1002348 3300025284 Bacteria 9605
200 Ga0209675_1000038 3300025291 Bacteria 250481
201 Ga0209675_1000125 3300025291 Bacteria 105527
202 Ga0209675_1000312 3300025291 Bacteria 43634
203 Ga0209675_1001530 3300025291 Bacteria 13205
204 Ga0209675_1006067 3300025291 Bacteria 4932
205 Ga0209675_1037777 3300025291 Bacteria 1081
206 Ga0209676_1000014 3300025292 Bacteria 793514
207 Ga0209676_1000125 3300025292 Bacteria 191565
208 Ga0209676_1000290 3300025292 Bacteria 103000
209 Ga0209676_1001114 3300025292 Bacteria 29761
210 Ga0209676_1006035 3300025292 Bacteria 6108
211 Ga0209676_1065809 3300025292 Bacteria 881
212 Ga0209025_1000232 3300025294 Bacteria 130663
213 Ga0209025_1000246 3300025294 Bacteria 127684
214 Ga0209025_1001132 3300025294 Bacteria 38158
215 Ga0209025_1001880 3300025294 Bacteria 24550
216 Ga0209025_1010452 3300025294 Bacteria 6287
217 Ga0209025_1016160 3300025294 Bacteria 4433
218 Ga0209025_1020578 3300025294 Bacteria 3600
219 Ga0209025_1062350 3300025294 Bacteria 1384
220 Ga0209025_1079758 3300025294 Bacteria 1118
221 Ga0209564_1000289 3300025295 Bacteria 101976
222 Ga0209564_1001012 3300025295 Bacteria 34912
223 Ga0209564_1002381 3300025295 Bacteria 15080
224 Ga0209564_1003033 3300025295 Bacteria 11958
225 Ga0209564_1009302 3300025295 Bacteria 4696
226 Ga0209564_1047573 3300025295 Bacteria 1079
227 Ga0209758_1023688 3300025297 Bacteria 2766
228 Ga0209758_1029712 3300025297 Bacteria 2278
229 Ga0209050_1000012 3300025298 Bacteria 813717
230 Ga0209050_1001325 3300025298 Bacteria 27578
231 Ga0209050_1009978 3300025298 Bacteria 4756
232 Ga0209050_1015040 3300025298 Bacteria 3283
233 Ga0209050_1028982 3300025298 Bacteria 1782
234 Ga0209256_1000291 3300025299 Bacteria 88153
235 Ga0209256_1000318 3300025299 Bacteria 82840
236 Ga0209256_1000700 3300025299 Bacteria 44602
237 Ga0209256_1013617 3300025299 Bacteria 3004
238 Ga0207426_1000266 3300025302 Bacteria 109895
239 Ga0207426_1000424 3300025302 Bacteria 69170
240 Ga0209051_1000134 3300025303 Bacteria 138380
241 Ga0209051_1000141 3300025303 Bacteria 135837
242 Ga0209051_1000827 3300025303 Bacteria 32026
243 Ga0209051_1000928 3300025303 Bacteria 29063
244 Ga0209051_1002508 3300025303 Bacteria 13040
245 Ga0209051_1010882 3300025303 Bacteria 4545
246 Ga0209051_1016603 3300025303 Bacteria 3322
247 Ga0209257_1000024 3300025304 Bacteria 726068
248 Ga0209257_1000096 3300025304 Bacteria 259390
249 Ga0209257_1004157 3300025304 Bacteria 11499
250 Ga0209257_1009903 3300025304 Bacteria 4967
251 Ga0209257_1010149 3300025304 Bacteria 4847
252 Ga0209257_1016033 3300025304 Bacteria 3061
253 Ga0207655_1002785 3300025728 Bacteria 13593
254 Ga0207647_10114826 3300025904 Bacteria 1590
255 Ga0207647_10116643 3300025904 Bacteria 1576
256 Ga0207654_10371409 3300025911 Bacteria 989
257 Ga0207695_10000437 3300025913 Bacteria 91491
258 Ga0207695_10135547 3300025913 Bacteria 2415
259 Ga0207695_10159876 3300025913 Bacteria 2185
260 Ga0207671_10167291 3300025914 Bacteria 1705
261 Ga0207660_10258554 3300025917 Bacteria 1376
262 Ga0207657_10278980 3300025919 Bacteria 1327
263 Ga0207649_10000118 3300025920 Bacteria 67180
264 Ga0207652_10313350 3300025921 Bacteria 1416
265 Ga0207646_10076222 3300025922 Bacteria 2996
266 Ga0207681_10145346 3300025923 Bacteria 1771
267 Ga0207664_10087902 3300025929 Bacteria 2542
268 Ga0207690_10000806 3300025932 Bacteria 20112
269 Ga0207690_10107259 3300025932 Bacteria 2006
270 Ga0207706_10033042 3300025933 Bacteria 4606
271 Ga0207709_10000273 3300025935 Bacteria 60743
272 Ga0207709_10000423 3300025935 Bacteria 41043
273 Ga0207709_10002021 3300025935 Bacteria 13158
274 Ga0207669_10031262 3300025937 Bacteria 2972
275 Ga0207679_10000001 3300025945 Bacteria 777444
276 Ga0207667_10231121 3300025949 Bacteria 1894
277 Ga0207667_10270350 3300025949 Bacteria 1738
278 Ga0207640_10000113 3300025981 Bacteria 60850
279 Ga0207639_10018768 3300026041 Bacteria 4918
280 Ga0207639_10711968 3300026041 Bacteria 932
281 Ga0207678_10000001 3300026067 Bacteria 433184
282 Ga0207702_10000009 3300026078 Bacteria 305906
283 Ga0207648_10585327 3300026089 Bacteria 1027
284 Ga0207674_10001631 3300026116 Bacteria 28868
285 Ga0207674_10145504 3300026116 Bacteria 2328
286 Ga0207674_10461966 3300026116 Bacteria 1227
287 Ga0207698_10143833 3300026142 Bacteria 2059
288 Ga0209281_1000007 3300027111 Bacteria 938265
289 Ga0209970_1000278 3300027614 Bacteria 8497
290 Ga0209282_1000027 3300027666 Bacteria 159842
291 Ga0209282_1000622 3300027666 Bacteria 17438
292 Ga0209974_10016672 3300027876 Bacteria 2438
293 Ga0268266_10088529 3300028379 Bacteria 2709
294 Ga0307517_10209401 3300028786 Bacteria 1204
295 Ga0307515_10001755 3300028794 Bacteria 48316
296 Ga0307515_10097062 3300028794 Bacteria 3606
297 Ga0307515_10295111 3300028794 Bacteria 1312
298 Ga0307512_10047678 3300030522 Bacteria 3479
299 Ga0316177_1077431 3300030731 Bacteria 8128
300 Ga0316176_1115156 3300030732 Bacteria 1911
301 Ga0316178_1071171 3300030735 Bacteria 2102
302 Ga0316181_1106607 3300030744 Bacteria 2130
303 Ga0316182_1005716 3300030745 Bacteria 3927
304 Ga0316182_1052468 3300030745 Bacteria 3442
305 Ga0265332_10025124 3300031238 Bacteria 2618
306 Ga0265327_10002982 3300031251 Bacteria 16820
307 Ga0265327_10005888 3300031251 Bacteria 10018
308 Ga0307513_10000064 3300031456 Bacteria 141845
309 Ga0307513_10068624 3300031456 Bacteria 3713
310 Ga0307513_10190106 3300031456 Bacteria 1906
311 Ga0307408_100052746 3300031548 Bacteria 2934
312 Ga0307408_100171313 3300031548 Bacteria 1733
313 Ga0307408_100234217 3300031548 Bacteria 1505
314 Ga0307408_100308994 3300031548 Bacteria 1327
315 Ga0307514_10001936 3300031649 Bacteria 22633
316 Ga0307514_10031551 3300031649 Bacteria 4249
317 Ga0265314_10000727 3300031711 Bacteria 39795
318 Ga0265342_10052852 3300031712 Bacteria 2420
319 Ga0265342_10116675 3300031712 Bacteria 1506
320 Ga0307405_10077120 3300031731 Bacteria 2164
321 Ga0307405_10113014 3300031731 Bacteria 1843
322 Ga0307405_10268301 3300031731 Bacteria 1278
323 Ga0307413_10349689 3300031824 Bacteria 1140
324 Ga0307412_10111697 3300031911 Bacteria 1952
325 Ga0307412_10212720 3300031911 Bacteria 1476
326 Ga0307412_10487521 3300031911 Bacteria 1023
327 Ga0307412_10620284 3300031911 Bacteria 918
328 Ga0307416_100300129 3300032002 Bacteria 1596
329 Ga0307414_10243745 3300032004 Bacteria 1489
330 Ga0307411_10051066 3300032005 Bacteria 2696
331 Ga0307411_10626680 3300032005 Bacteria 928
332 Ga0373931_0394222 3300035691 Bacteria 875
333 Ga0395900_0015816 3300037418 Bacteria 7690
334 Ga0395900_0088773 3300037418 Bacteria 3178
335 Ga0395898_0246581 3300037466 Bacteria 1703
336 Ga0395905_0000263 3300037471 Bacteria 78624
337 Ga0395905_0209073 3300037471 Bacteria 1828
338 Ga0395905_0454976 3300037471 Bacteria 1178
339 Ga0395905_0505863 3300037471 Bacteria 1108
340 Ga0395905_0627464 3300037471 Bacteria 977
341 Ga0395901_0029467 3300038443 Bacteria 5652
342 Ga0395901_0097690 3300038443 Bacteria 3079
343 Ga0436361_0266266 3300039447 Bacteria 2852
344 Ga0436361_0299431 3300039447 Bacteria 1486
345 Ga0439466_0042140 3300041411 Bacteria 1520
346 Ga0439465_0005416 3300041413 Bacteria 4073
347 Ga0451843_1354054 3300041509 Bacteria 1352
348 Ga0439431_0000412 3300041997 Bacteria 9012
349 Ga0439433_0012340 3300041999 Bacteria 1873
350 Ga0439442_023670 3300042002 Bacteria 1276
351 Ga0439445_0000931 3300042004 Bacteria 6212
352 Ga0439432_000553 3300042006 Bacteria 13936
353 Ga0439449_0000464 3300042007 Bacteria 15110
354 Ga0439449_0001035 3300042007 Bacteria 10949
355 Ga0439452_001098 3300042010 Bacteria 11911
356 Ga0439457_017065 3300042014 Bacteria 1614
357 Ga0439462_0026494 3300042015 Bacteria 1528
358 Ga0439462_0057195 3300042015 Bacteria 1053
359 Ga0450911_000314 3300042115 Bacteria 17507
360 Ga0450899_002710 3300042135 Bacteria 1916
361 Ga0439446_0040052 3300042156 Bacteria 1378
362 Ga0450909_001765 3300042185 Bacteria 3042
363 Ga0439434_0069156 3300042435 Bacteria 1110
364 Ga0439464_0033606 3300042439 Bacteria 1444
365 Ga0451577_0004913 3300042876 Bacteria 13922
366 Ga0451577_0689136 3300042876 Bacteria 926
367 Ga0466986_0046556 3300044650 Bacteria 2996
368 Ga0466969_0001537 3300044656 Bacteria 12389
369 Ga0466969_0065883 3300044656 Bacteria 1750
370 Ga0466972_0026599 3300044658 Bacteria 2867
371 Ga0466978_0099900 3300044671 Bacteria 1803
372 Ga0466982_0121102 3300044672 Bacteria 1614
373 Ga0453683_0001073 3300044673 Bacteria 25281
374 Ga0466965_0066998 3300044683 Bacteria 1801
375 Ga0466965_0114646 3300044683 Bacteria 1387
376 Ga0466966_0000766 3300044684 Bacteria 20373
377 Ga0466961_0002199 3300044693 Bacteria 12138
378 Ga0466961_0022811 3300044693 Bacteria 4025
379 Ga0466961_0079130 3300044693 Bacteria 2082
380 Ga0466963_0492983 3300044694 Bacteria 865
381 Ga0466964_0088796 3300044706 Bacteria 1341
382 Ga0453684_0071185 3300044712 Bacteria 4398
383 Ga0453684_0085726 3300044712 Bacteria 3912
384 Ga0453684_0402041 3300044712 Bacteria 1534
385 Ga0466970_0002171 3300044765 Bacteria 9475
386 Ga0466970_0101357 3300044765 Bacteria 1568
387 Ga0466957_0013499 3300044842 Bacteria 4738
388 Ga0466960_0014708 3300044901 Bacteria 3359
389 Ga0466959_0004666 3300045049 Bacteria 9221
390 Ga0466959_0009923 3300045049 Bacteria 6788
391 Ga0451576_0045854 3300045051 Bacteria 4602
392 Ga0466958_0277486 3300045836 Bacteria 1074
393 Ga0466967_0540148 3300045976 Bacteria 1147
394 Ga0495627_009315 3300046453 Bacteria 3619
395 Ga0495627_049848 3300046453 Bacteria 1263
396 Ga0495596_0000335 3300046500 Bacteria 30658
397 Ga0495607_0014303 3300046501 Bacteria 5173
398 Ga0495610_0003555 3300046512 Bacteria 12069
399 Ga0495610_0036249 3300046512 Bacteria 2522
400 Ga0495610_0084073 3300046512 Bacteria 1455
401 Ga0495616_0007066 3300046513 Bacteria 6744
402 Ga0495620_0007804 3300046515 Bacteria 5781
403 Ga0495631_0000024 3300046518 Bacteria 90896
404 Ga0495631_0176078 3300046518 Bacteria 917
405 Ga0495637_0001297 3300046520 Bacteria 15020
406 Ga0495648_0094307 3300046524 Bacteria 1667
407 Ga0495642_0006747 3300046528 Bacteria 4401
408 Ga0495642_0213693 3300046528 Bacteria 841
409 Ga0495654_0003871 3300046530 Bacteria 9040
410 Ga0495654_0015651 3300046530 Bacteria 4026
411 Ga0495609_0005338 3300046538 Bacteria 6785
412 Ga0495621_0004608 3300046539 Bacteria 3895
413 Ga0495656_0052086 3300046615 Bacteria 1754
414 Ga0495625_0002043 3300046660 Bacteria 22690
415 Ga0495661_0144040 3300046665 Bacteria 1293
416 Ga0495588_0098214 3300046674 Bacteria 1537
417 Ga0495588_0126654 3300046674 Bacteria 1347
418 Ga0495588_0360877 3300046674 Bacteria 763
419 Ga0495669_0051778 3300046684 Bacteria 1843
420 Ga0495670_0090481 3300046691 Bacteria 1566
421 Ga0495671_0005939 3300046692 Bacteria 7099
422 Ga0495671_0065559 3300046692 Bacteria 1787
423 Ga0495649_0007729 3300046694 Bacteria 6528
424 Ga0495672_0029711 3300047320 Bacteria 3438
425 Ga0495676_0066831 3300047321 Bacteria 2784
426 Ga0495677_0007354 3300047445 Bacteria 4119
427 Ga0495685_001591 3300047447 Bacteria 6993
428 Ga0495685_069680 3300047447 Bacteria 1179
429 Ga0496101_0043417 3300048904 Bacteria 3214
430 Ga0496102_0229764 3300048905 Bacteria 1749
431 Ga0496102_0401714 3300048905 Bacteria 1288
432 Ga0496104_0349217 3300048907 Bacteria 1392
433 Ga0496110_0312644 3300048913 Bacteria 1431
434 Ga0496116_0003784 3300048919 Bacteria 14789
435 Ga0496116_0019588 3300048919 Bacteria 5176
436 Ga0496117_0014448 3300048920 Bacteria 6801
437 Ga0496117_0050807 3300048920 Bacteria 2937
438 Ga0496117_0061178 3300048920 Bacteria 2590
439 Ga0496118_0042846 3300048921 Bacteria 3565
440 Ga0496118_0047251 3300048921 Bacteria 3338
441 Ga0496121_0021141 3300048924 Bacteria 6390
442 Ga0496122_0001935 3300048925 Bacteria 31174
443 Ga0496122_0142047 3300048925 Bacteria 1500
444 Ga0496122_0150084 3300048925 Bacteria 1440
445 Ga0496123_0002072 3300048926 Bacteria 25819
446 Ga0496124_0264580 3300048927 Bacteria 1263
447 Ga0496124_0300995 3300048927 Bacteria 1158
448 Ga0496125_0002892 3300048928 Bacteria 21632
449 Ga0496125_0015500 3300048928 Bacteria 7366
450 Ga0496125_0025596 3300048928 Bacteria 5400
451 Ga0496125_0070637 3300048928 Bacteria 2733
452 Ga0496125_0073287 3300048928 Bacteria 2663
453 Ga0496125_0224879 3300048928 Bacteria 1205
454 Ga0496126_0047225 3300048929 Bacteria 3943
455 Ga0496126_0219919 3300048929 Bacteria 1596
456 Ga0496126_0525550 3300048929 Bacteria 942
457 Ga0501031_0481592 3300049568 Bacteria 801
458 Ga0501032_0381053 3300049569 Bacteria 907
459 Ga0501034_0000379 3300049571 Bacteria 75837
460 Ga0501037_0077002 3300049573 Bacteria 2421
461 Ga0501038_0394306 3300049574 Bacteria 1072
462 Ga0501046_0216402 3300049580 Bacteria 1420
463 Ga0501242_015778 3300049674 Bacteria 943
464 Ga0501225_0001534 3300049705 Bacteria 7255
465 Ga0501241_034835 3300049758 Bacteria 961
466 Ga0501035_0609936 3300049822 Bacteria 888
467 nmdc:mga03683_14638_c1 3300050489 Bacteria 2906
468 nmdc:mga03683_18489_c2 3300050489 Bacteria 1882
469 nmdc:mga03683_31350_c1 3300050489 Bacteria 2132
470 nmdc:mga03683_99792_c1 3300050489 Bacteria 1275
471 nmdc:mga03n38_68923_c1 3300050490 Bacteria 1632
472 nmdc:mga03n38_74626_c1 3300050490 Bacteria 1578
473 nmdc:mga00v17_129830_c1 3300050491 Bacteria 1610
474 nmdc:mga00v17_139585_c1 3300050491 Bacteria 1553
475 nmdc:mga00v17_224348_c1 3300050491 Bacteria 1217
476 nmdc:mga00v17_546880_c1 3300050491 Bacteria 749
477 nmdc:mga0yw44_273100_c1 3300050492 Bacteria 1129
478 nmdc:mga0yw44_339797_c1 3300050492 Bacteria 1010
479 nmdc:mga0k408_13854_c1 3300050493 Bacteria 4431
480 nmdc:mga0k408_150894_c1 3300050493 Bacteria 1384
481 nmdc:mga0k408_195228_c1 3300050493 Bacteria 1208
482 nmdc:mga0k408_305565_c1 3300050493 Bacteria 949
483 nmdc:mga0k408_314363_c1 3300050493 Bacteria 935
484 nmdc:mga06z11_198364_c1 3300050494 Bacteria 1164
485 nmdc:mga04h51_227690_c1 3300050495 Bacteria 741
486 nmdc:mga07m45_14460_c1 3300050496 Bacteria 4203
487 nmdc:mga07m45_213104_c1 3300050496 Bacteria 1124
488 nmdc:mga07m45_73863_c1 3300050496 Bacteria 1942
489 nmdc:mga07m45_76463_c1 3300050496 Bacteria 1909
490 nmdc:mga0qj67_120095_c1 3300050509 Bacteria 2125
491 nmdc:mga0sz30_48862_c1 3300050516 Bacteria 1791
492 Ga0500610_0002872 3300053079 Bacteria 6476
493 Ga0500610_0009448 3300053079 Bacteria 4323
494 Ga0500644_0056645 3300053088 Bacteria 1365
495 Ga0500562_000962 3300053108 Bacteria 7009
496 Ga0500594_0034823 3300053118 Bacteria 1347
497 Ga0500607_067986 3300053121 Bacteria 1844
498 Ga0500608_011378 3300053122 Bacteria 3861
499 Ga0500618_005373 3300053125 Bacteria 3907
500 Ga0500658_0009580 3300053134 Bacteria 3570
501 Ga0500559_0282353 3300053136 Bacteria 781
502 Ga0500568_0002854 3300053139 Bacteria 9942
503 Ga0500574_004711 3300053141 Bacteria 2579
504 Ga0500616_0080443 3300053153 Bacteria 1638
505 Ga0500634_0078822 3300053161 Bacteria 1703
506 Ga0500645_000151 3300053730 Bacteria 54244
507 Ga0500645_013959 3300053730 Bacteria 2569
508 Ga0500645_083605 3300053730 Bacteria 910
509 Ga0500645_102220 3300053730 Bacteria 808
510 Ga0587088_000007 3300059508 Bacteria 8942
511 Ga0587067_001336 3300059640 Bacteria 2635
512 Ga0587072_000021 3300059643 Bacteria 9666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0003784 Ga0496116_0003784_17_634 205
2 3300045049 Ga0466959_0009923 Ga0466959_0009923_6041_6709 206
3 3300048905 Ga0496102_0229764 Ga0496102_0229764_186_851 208
4 3300048907 Ga0496104_0349217 Ga0496104_0349217_606_1271 208
5 3300037471 Ga0395905_0627464 Ga0395905_0627464_106_774 211
6 3300005458 Ga0070681_10185958 Ga0070681_101859582 214
7 3300005548 Ga0070665_100004201 Ga0070665_10000420118 214
8 3300028379 Ga0268266_10088529 Ga0268266_100885292 214
9 iso_pu_bacteria 2513020051 2513231084 214
10 3300005563 Ga0068855_100272526 Ga0068855_1002725262 215
11 3300025949 Ga0207667_10231121 Ga0207667_102311212 216
12 3300037471 Ga0395905_0505863 Ga0395905_0505863_55_723 216
13 3300031712 Ga0265342_10116675 Ga0265342_101166752 217
14 3300038443 Ga0395901_0097690 Ga0395901_0097690_984_1745 217
15 iso_pu_bacteria 2596583598 2597028781 217
16 iso_pu_bacteria 2599185178 2599445464 217
17 iso_pu_bacteria 2858688981 2858695138 217
18 iso_pu_bacteria 2885266251 2885266885 217
19 iso_pu_bacteria 2900577576 2900581150 217
20 iso_pu_bacteria 2928058823 2928062796 217
21 3300005457 Ga0070662_100133103 Ga0070662_1001331032 218
22 3300006358 Ga0068871_100178540 Ga0068871_1001785402 218
23 3300009036 Ga0105244_10009227 Ga0105244_100092276 218
24 3300009148 Ga0105243_10262233 Ga0105243_102622332 218
25 3300009174 Ga0105241_10608758 Ga0105241_106087582 218
26 3300009176 Ga0105242_10826521 Ga0105242_108265212 218
27 3300009545 Ga0105237_10298383 Ga0105237_102983832 218
28 3300010375 Ga0105239_10196260 Ga0105239_101962602 218
29 3300011119 Ga0105246_10372650 Ga0105246_103726501 218
30 3300013100 Ga0157373_10295431 Ga0157373_102954312 218
31 3300014497 Ga0182008_10061743 Ga0182008_100617432 218
32 3300015261 Ga0182006_1002000 Ga0182006_10020006 218
33 3300015262 Ga0182007_10001482 Ga0182007_1000148213 218
34 3300015265 Ga0182005_1099026 Ga0182005_10990262 218
35 3300025728 Ga0207655_1002785 Ga0207655_100278513 218
36 3300025904 Ga0207647_10114826 Ga0207647_101148262 218
37 3300025911 Ga0207654_10371409 Ga0207654_103714092 218
38 3300025914 Ga0207671_10167291 Ga0207671_101672912 218
39 3300025933 Ga0207706_10033042 Ga0207706_100330425 218
40 3300025935 Ga0207709_10002021 Ga0207709_100020218 218
41 3300048905 Ga0496102_0401714 Ga0496102_0401714_417_1073 218
42 3300048920 Ga0496117_0014448 Ga0496117_0014448_2221_2877 218
43 3300048921 Ga0496118_0042846 Ga0496118_0042846_1271_1927 218
44 3300048928 Ga0496125_0070637 Ga0496125_0070637_1505_2161 218
45 3300050496 nmdc:mga07m45_213104_c1 nmdc:mga07m45_213104_c1_424_1080 218
46 iso_pu_bacteria 2643221658 2644325385 218
47 iso_pu_bacteria 2643221672 2644399123 218
48 iso_pu_bacteria 2839138175 2839142565 218
49 iso_pu_bacteria 2939631187 2939632142 218
50 3300006048 Ga0075363_100280774 Ga0075363_1002807742 219
51 3300006195 Ga0075366_10311612 Ga0075366_103116122 219
52 3300031548 Ga0307408_100052746 Ga0307408_1000527463 219
53 3300031731 Ga0307405_10077120 Ga0307405_100771202 219
54 3300031911 Ga0307412_10111697 Ga0307412_101116972 219
55 3300039447 Ga0436361_0266266 Ga0436361_0266266_1218_1877 219
56 3300039447 Ga0436361_0299431 Ga0436361_0299431_538_1197 219
57 3300050491 nmdc:mga00v17_546880_c1 nmdc:mga00v17_546880_c1_72_731 219
58 3300050492 nmdc:mga0yw44_339797_c1 nmdc:mga0yw44_339797_c1_132_791 219
59 3300050493 nmdc:mga0k408_314363_c1 nmdc:mga0k408_314363_c1_38_697 219
60 iso_pu_bacteria 2599185214 2599623142 219
61 iso_pu_bacteria 2599185226 2599674789 219
62 iso_pu_bacteria 2599185227 2599680746 219
63 iso_pu_bacteria 2599185229 2599692761 219
64 iso_pu_bacteria 2643221628 2644161958 219
65 iso_pu_bacteria 2643221683 2644467235 219
66 iso_pu_bacteria 2738541277 2738722003 219
67 iso_pu_bacteria 2738541307 2738882823 219
68 iso_pu_bacteria 2738543019 2739282367 219
69 iso_pu_bacteria 2818991446 2819600274 219
70 iso_pu_bacteria 2831265667 2831271931 219
71 iso_pu_bacteria 2838054893 2838059770 219
72 iso_pu_bacteria 2842677519 2842677657 219
73 iso_pu_bacteria 2885192300 2885194846 219
74 iso_pu_bacteria 2899924645 2899928551 219
75 iso_pu_bacteria 2904449895 2904451937 219
76 iso_pu_bacteria 2904456579 2904458917 219
77 iso_pu_bacteria 2904541872 2904547362 219
78 iso_pu_bacteria 2919462493 2919467080 219
79 iso_pu_bacteria 2928037797 2928041476 219
80 iso_pu_bacteria 2928044640 2928048318 219
81 iso_pu_bacteria 2928051484 2928056158 219
82 iso_pu_bacteria 2928064002 2928066361 219
83 iso_pu_bacteria 2928070936 2928076017 219
84 iso_pu_bacteria 2928084124 2928087788 219
85 iso_pu_bacteria 2929160207 2929165137 219
86 iso_pu_bacteria 2945945610 2945946240 219
87 iso_pu_bacteria 2945972063 2945975842 219
88 iso_pu_bacteria 2954767861 2954768716 219
89 3300001979 JGI24740J21852_10000861 JGI24740J21852_1000086110 221
90 3300002705 JGI25156J39149_1006899 JGI25156J39149_10068993 221
91 3300002738 JGI25154J39366_1000886 JGI25154J39366_10008864 221
92 3300003187 JGI25151J46595_10008567 JGI25151J46595_100085672 221
93 3300003322 rootL2_10328530 rootL2_103285302 221
94 3300003752 Ga0055539_1000034 Ga0055539_1000034217 221
95 3300003752 Ga0055539_1014703 Ga0055539_10147032 221
96 3300003758 Ga0055532_1000002 Ga0055532_1000002197 221
97 3300003759 Ga0055525_1000660 Ga0055525_100066016 221
98 3300003760 Ga0055527_1000729 Ga0055527_10007295 221
99 3300003762 Ga0055542_1001411 Ga0055542_10014112 221
100 3300003762 Ga0055542_1001450 Ga0055542_10014503 221
101 3300003763 Ga0055529_1000028 Ga0055529_100002839 221
102 3300003771 Ga0055526_1004181 Ga0055526_10041818 221
103 3300003771 Ga0055526_1014963 Ga0055526_10149633 221
104 3300003771 Ga0055526_1017780 Ga0055526_10177803 221
105 3300003773 Ga0055537_1002621 Ga0055537_10026214 221
106 3300003775 Ga0055524_1000360 Ga0055524_10003603 221
107 3300003775 Ga0055524_1001538 Ga0055524_10015386 221
108 3300003775 Ga0055524_1033815 Ga0055524_10338152 221
109 3300003781 Ga0055536_1000588 Ga0055536_100058824 221
110 3300003784 Ga0055534_1001087 Ga0055534_10010872 221
111 3300003784 Ga0055534_1002450 Ga0055534_10024505 221
112 3300003841 Ga0055541_1000537 Ga0055541_10005378 221
113 3300005339 Ga0070660_100075338 Ga0070660_1000753382 221
114 3300005344 Ga0070661_100000063 Ga0070661_10000006354 221
115 3300005366 Ga0070659_100000856 Ga0070659_10000085611 221
116 3300005455 Ga0070663_100000006 Ga0070663_100000006117 221
117 3300005564 Ga0070664_100000002 Ga0070664_100000002148 221
118 3300005577 Ga0068857_100004824 Ga0068857_10000482411 221
119 3300005578 Ga0068854_100000093 Ga0068854_10000009314 221
120 3300005614 Ga0068856_100000028 Ga0068856_10000002881 221
121 3300006948 Ga0099826_10000004 Ga0099826_10000004443 221
122 3300009011 Ga0105251_10038466 Ga0105251_100384662 221
123 3300009093 Ga0105240_10404536 Ga0105240_104045361 221
124 3300009978 Ga0105148_104401 Ga0105148_1044012 221
125 3300013102 Ga0157371_10000123 Ga0157371_1000012330 221
126 3300013104 Ga0157370_10000013 Ga0157370_1000001386 221
127 3300013105 Ga0157369_10006810 Ga0157369_100068104 221
128 3300013307 Ga0157372_10000067 Ga0157372_1000006764 221
129 3300015261 Ga0182006_1000486 Ga0182006_100048615 221
130 3300015261 Ga0182006_1022589 Ga0182006_10225893 221
131 3300015262 Ga0182007_10002603 Ga0182007_100026033 221
132 3300020069 Ga0197907_10926987 Ga0197907_109269873 221
133 3300020070 Ga0206356_10261372 Ga0206356_102613721 221
134 3300020077 Ga0206351_10276860 Ga0206351_1027686012 221
135 3300020610 Ga0154015_1572807 Ga0154015_157280722 221
136 3300025224 Ga0209784_100003 Ga0209784_100003516 221
137 3300025225 Ga0209566_100002 Ga0209566_1000021559 221
138 3300025225 Ga0209566_100534 Ga0209566_1005349 221
139 3300025225 Ga0209566_101105 Ga0209566_1011059 221
140 3300025226 Ga0209674_100008 Ga0209674_100008630 221
141 3300025226 Ga0209674_100179 Ga0209674_10017931 221
142 3300025226 Ga0209674_100334 Ga0209674_10033411 221
143 3300025228 Ga0209672_100052 Ga0209672_100052191 221
144 3300025229 Ga0209147_100002 Ga0209147_1000021727 221
145 3300025230 Ga0209563_100004 Ga0209563_100004972 221
146 3300025230 Ga0209563_103947 Ga0209563_1039472 221
147 3300025230 Ga0209563_108159 Ga0209563_1081592 221
148 3300025242 Ga0209258_100002 Ga0209258_1000021727 221
149 3300025246 Ga0209646_1000022 Ga0209646_1000022334 221
150 3300025250 Ga0209026_1003742 Ga0209026_10037425 221
151 3300025253 Ga0209677_100009 Ga0209677_100009660 221
152 3300025253 Ga0209677_110256 Ga0209677_1102562 221
153 3300025254 Ga0209148_1000021 Ga0209148_1000021479 221
154 3300025254 Ga0209148_1008202 Ga0209148_10082023 221
155 3300025256 Ga0209759_1003223 Ga0209759_10032231 221
156 3300025256 Ga0209759_1007807 Ga0209759_10078073 221
157 3300025263 Ga0209565_1000235 Ga0209565_100023547 221
158 3300025272 Ga0209455_1000021 Ga0209455_1000021314 221
159 3300025273 Ga0209673_1044206 Ga0209673_10442061 221
160 3300025291 Ga0209675_1000125 Ga0209675_10001253 221
161 3300025291 Ga0209675_1000312 Ga0209675_10003123 221
162 3300025292 Ga0209676_1000014 Ga0209676_100001491 221
163 3300025294 Ga0209025_1000232 Ga0209025_1000232117 221
164 3300025294 Ga0209025_1000246 Ga0209025_1000246152 221
165 3300025294 Ga0209025_1001132 Ga0209025_100113226 221
166 3300025294 Ga0209025_1001880 Ga0209025_10018808 221
167 3300025295 Ga0209564_1001012 Ga0209564_100101226 221
168 3300025295 Ga0209564_1002381 Ga0209564_100238115 221
169 3300025295 Ga0209564_1003033 Ga0209564_100303312 221
170 3300025297 Ga0209758_1029712 Ga0209758_10297123 221
171 3300025299 Ga0209256_1000291 Ga0209256_100029136 221
172 3300025299 Ga0209256_1000700 Ga0209256_100070035 221
173 3300025303 Ga0209051_1010882 Ga0209051_10108824 221
174 3300025904 Ga0207647_10116643 Ga0207647_101166432 221
175 3300025913 Ga0207695_10000437 Ga0207695_1000043797 221
176 3300025920 Ga0207649_10000118 Ga0207649_1000011837 221
177 3300025932 Ga0207690_10000806 Ga0207690_1000080615 221
178 3300025945 Ga0207679_10000001 Ga0207679_10000001320 221
179 3300025981 Ga0207640_10000113 Ga0207640_1000011314 221
180 3300026067 Ga0207678_10000001 Ga0207678_10000001114 221
181 3300026078 Ga0207702_10000009 Ga0207702_10000009114 221
182 3300026116 Ga0207674_10001631 Ga0207674_100016311 221
183 3300026142 Ga0207698_10143833 Ga0207698_101438333 221
184 3300027666 Ga0209282_1000027 Ga0209282_100002746 221
185 3300028794 Ga0307515_10097062 Ga0307515_100970623 221
186 3300028794 Ga0307515_10295111 Ga0307515_102951112 221
187 3300031456 Ga0307513_10190106 Ga0307513_101901063 221
188 3300037418 Ga0395900_0015816 Ga0395900_0015816_1169_1834 221
189 3300044650 Ga0466986_0046556 Ga0466986_0046556_2257_2922 221
190 3300044656 Ga0466969_0001537 Ga0466969_0001537_6813_7490 221
191 3300044656 Ga0466969_0065883 Ga0466969_0065883_925_1590 221
192 3300044658 Ga0466972_0026599 Ga0466972_0026599_555_1220 221
193 3300044671 Ga0466978_0099900 Ga0466978_0099900_280_945 221
194 3300044672 Ga0466982_0121102 Ga0466982_0121102_177_842 221
195 3300044683 Ga0466965_0066998 Ga0466965_0066998_775_1440 221
196 3300044684 Ga0466966_0000766 Ga0466966_0000766_6722_7399 221
197 3300044693 Ga0466961_0002199 Ga0466961_0002199_11048_11713 221
198 3300044693 Ga0466961_0022811 Ga0466961_0022811_3055_3732 221
199 3300044694 Ga0466963_0492983 Ga0466963_0492983_145_810 221
200 3300044706 Ga0466964_0088796 Ga0466964_0088796_466_1131 221
201 3300044712 Ga0453684_0085726 Ga0453684_0085726_226_969 221
202 3300044765 Ga0466970_0002171 Ga0466970_0002171_373_1038 221
203 3300044765 Ga0466970_0101357 Ga0466970_0101357_810_1487 221
204 3300044842 Ga0466957_0013499 Ga0466957_0013499_3578_4243 221
205 3300045049 Ga0466959_0004666 Ga0466959_0004666_8356_9021 221
206 3300045836 Ga0466958_0277486 Ga0466958_0277486_316_981 221
207 3300045976 Ga0466967_0540148 Ga0466967_0540148_325_993 221
208 3300046500 Ga0495596_0000335 Ga0495596_0000335_20409_21074 221
209 3300046501 Ga0495607_0014303 Ga0495607_0014303_4232_4897 221
210 3300046512 Ga0495610_0003555 Ga0495610_0003555_1360_2025 221
211 3300046513 Ga0495616_0007066 Ga0495616_0007066_2925_3590 221
212 3300046518 Ga0495631_0176078 Ga0495631_0176078_70_735 221
213 3300046524 Ga0495648_0094307 Ga0495648_0094307_568_1233 221
214 3300046528 Ga0495642_0213693 Ga0495642_0213693_155_820 221
215 3300046538 Ga0495609_0005338 Ga0495609_0005338_4935_5600 221
216 3300046615 Ga0495656_0052086 Ga0495656_0052086_638_1303 221
217 3300046665 Ga0495661_0144040 Ga0495661_0144040_194_859 221
218 3300046684 Ga0495669_0051778 Ga0495669_0051778_137_802 221
219 3300046692 Ga0495671_0005939 Ga0495671_0005939_2260_2925 221
220 3300046694 Ga0495649_0007729 Ga0495649_0007729_4737_5402 221
221 3300047320 Ga0495672_0029711 Ga0495672_0029711_1682_2347 221
222 3300047447 Ga0495685_001591 Ga0495685_001591_927_1592 221
223 3300048924 Ga0496121_0021141 Ga0496121_0021141_1227_1892 221
224 3300048925 Ga0496122_0001935 Ga0496122_0001935_20408_21073 221
225 3300048926 Ga0496123_0002072 Ga0496123_0002072_19597_20262 221
226 3300048928 Ga0496125_0025596 Ga0496125_0025596_409_1074 221
227 3300048929 Ga0496126_0047225 Ga0496126_0047225_2792_3457 221
228 3300049571 Ga0501034_0000379 Ga0501034_0000379_65607_66272 221
229 3300053730 Ga0500645_102220 Ga0500645_102220_113_781 221
230 3300059508 Ga0587088_000007 Ga0587088_000007_954_1619 221
231 3300059640 Ga0587067_001336 Ga0587067_001336_984_1649 221
232 3300059643 Ga0587072_000021 Ga0587072_000021_1552_2217 221
233 iso_pu_bacteria 2721755523 2722882053 221
234 3300002704 JGI25155J39150_1000104 JGI25155J39150_100010446 222
235 3300002705 JGI25156J39149_1000089 JGI25156J39149_10000893 222
236 3300002738 JGI25154J39366_1000115 JGI25154J39366_10001153 222
237 3300002741 JGI25157J39369_1000118 JGI25157J39369_100011866 222
238 3300003354 JGI25160J50197_1000281 JGI25160J50197_100028145 222
239 3300003374 JGI25161J50226_1000124 JGI25161J50226_100012464 222
240 3300003773 Ga0055537_1007912 Ga0055537_10079122 222
241 3300003781 Ga0055536_1024705 Ga0055536_10247052 222
242 3300003791 Ga0055530_10016774 Ga0055530_100167742 222
243 3300003791 Ga0055530_10023704 Ga0055530_100237042 222
244 3300003792 Ga0055540_1003967 Ga0055540_10039676 222
245 3300003792 Ga0055540_1006040 Ga0055540_10060406 222
246 3300003794 Ga0055531_10000765 Ga0055531_1000076513 222
247 3300003794 Ga0055531_10018915 Ga0055531_100189152 222
248 3300004625 Ga0055543_1003544 Ga0055543_10035446 222
249 3300005327 Ga0070658_10316220 Ga0070658_103162202 222
250 3300005327 Ga0070658_10335849 Ga0070658_103358492 222
251 3300005435 Ga0070714_100714246 Ga0070714_1007142461 222
252 3300005530 Ga0070679_100029946 Ga0070679_1000299463 222
253 3300005563 Ga0068855_100177446 Ga0068855_1001774462 222
254 3300006038 Ga0075365_10388191 Ga0075365_103881912 222
255 3300006051 Ga0075364_10032761 Ga0075364_100327613 222
256 3300006177 Ga0075362_10168996 Ga0075362_101689962 222
257 3300006195 Ga0075366_10018482 Ga0075366_100184825 222
258 3300006195 Ga0075366_10282202 Ga0075366_102822021 222
259 3300006195 Ga0075366_10401171 Ga0075366_104011711 222
260 3300009092 Ga0105250_10001549 Ga0105250_100015499 222
261 3300009093 Ga0105240_10012990 Ga0105240_100129904 222
262 3300009148 Ga0105243_10004995 Ga0105243_100049959 222
263 3300011119 Ga0105246_10510900 Ga0105246_105109001 222
264 3300025206 Ga0209435_100002 Ga0209435_10000293 222
265 3300025208 Ga0209436_113323 Ga0209436_1133232 222
266 3300025246 Ga0209646_1000001 Ga0209646_10000012236 222
267 3300025250 Ga0209026_1000001 Ga0209026_1000001893 222
268 3300025256 Ga0209759_1000001 Ga0209759_10000011867 222
269 3300025284 Ga0209130_1000627 Ga0209130_10006273 222
270 3300025292 Ga0209676_1001114 Ga0209676_100111429 222
271 3300025292 Ga0209676_1065809 Ga0209676_10658092 222
272 3300025294 Ga0209025_1016160 Ga0209025_10161602 222
273 3300025295 Ga0209564_1009302 Ga0209564_10093024 222
274 3300025298 Ga0209050_1001325 Ga0209050_10013252 222
275 3300025298 Ga0209050_1009978 Ga0209050_10099783 222
276 3300025298 Ga0209050_1015040 Ga0209050_10150403 222
277 3300025302 Ga0207426_1000424 Ga0207426_100042454 222
278 3300025303 Ga0209051_1000928 Ga0209051_100092815 222
279 3300025303 Ga0209051_1002508 Ga0209051_100250813 222
280 3300025304 Ga0209257_1000096 Ga0209257_1000096233 222
281 3300025304 Ga0209257_1009903 Ga0209257_10099032 222
282 3300025913 Ga0207695_10159876 Ga0207695_101598762 222
283 3300025917 Ga0207660_10258554 Ga0207660_102585542 222
284 3300025919 Ga0207657_10278980 Ga0207657_102789802 222
285 3300025921 Ga0207652_10313350 Ga0207652_103133501 222
286 3300025922 Ga0207646_10076222 Ga0207646_100762222 222
287 3300025929 Ga0207664_10087902 Ga0207664_100879023 222
288 3300025935 Ga0207709_10000273 Ga0207709_1000027313 222
289 3300026041 Ga0207639_10711968 Ga0207639_107119681 222
290 3300026116 Ga0207674_10461966 Ga0207674_104619662 222
291 3300027111 Ga0209281_1000007 Ga0209281_1000007720 222
292 3300027614 Ga0209970_1000278 Ga0209970_10002785 222
293 3300027876 Ga0209974_10016672 Ga0209974_100166722 222
294 3300028794 Ga0307515_10001755 Ga0307515_1000175518 222
295 3300030522 Ga0307512_10047678 Ga0307512_100476783 222
296 3300031238 Ga0265332_10025124 Ga0265332_100251242 222
297 3300031456 Ga0307513_10000064 Ga0307513_1000006419 222
298 3300031456 Ga0307513_10068624 Ga0307513_100686243 222
299 3300031649 Ga0307514_10001936 Ga0307514_100019368 222
300 3300031711 Ga0265314_10000727 Ga0265314_1000072714 222
301 3300031712 Ga0265342_10052852 Ga0265342_100528522 222
302 3300035691 Ga0373931_0394222 Ga0373931_0394222_66_734 222
303 3300037418 Ga0395900_0088773 Ga0395900_0088773_1810_2481 222
304 3300037466 Ga0395898_0246581 Ga0395898_0246581_916_1587 222
305 3300037471 Ga0395905_0000263 Ga0395905_0000263_2136_2807 222
306 3300037471 Ga0395905_0209073 Ga0395905_0209073_581_1252 222
307 3300037471 Ga0395905_0454976 Ga0395905_0454976_74_745 222
308 3300038443 Ga0395901_0029467 Ga0395901_0029467_4276_4947 222
309 3300042007 Ga0439449_0000464 Ga0439449_0000464_9767_10435 222
310 3300042015 Ga0439462_0026494 Ga0439462_0026494_407_1075 222
311 3300042015 Ga0439462_0057195 Ga0439462_0057195_61_729 222
312 3300042115 Ga0450911_000314 Ga0450911_000314_3307_3975 222
313 3300042135 Ga0450899_002710 Ga0450899_002710_743_1411 222
314 3300042435 Ga0439434_0069156 Ga0439434_0069156_234_902 222
315 3300042439 Ga0439464_0033606 Ga0439464_0033606_388_1056 222
316 3300042876 Ga0451577_0004913 Ga0451577_0004913_12092_12760 222
317 3300042876 Ga0451577_0689136 Ga0451577_0689136_196_864 222
318 3300044673 Ga0453683_0001073 Ga0453683_0001073_7309_7977 222
319 3300044693 Ga0466961_0079130 Ga0466961_0079130_101_769 222
320 3300044712 Ga0453684_0071185 Ga0453684_0071185_1565_2233 222
321 3300044712 Ga0453684_0402041 Ga0453684_0402041_399_1067 222
322 3300045051 Ga0451576_0045854 Ga0451576_0045854_3774_4442 222
323 3300046528 Ga0495642_0006747 Ga0495642_0006747_1249_1917 222
324 3300046530 Ga0495654_0003871 Ga0495654_0003871_2754_3422 222
325 3300046691 Ga0495670_0090481 Ga0495670_0090481_473_1141 222
326 3300047445 Ga0495677_0007354 Ga0495677_0007354_3185_3853 222
327 3300047447 Ga0495685_069680 Ga0495685_069680_162_830 222
328 3300048913 Ga0496110_0312644 Ga0496110_0312644_644_1312 222
329 3300048928 Ga0496125_0002892 Ga0496125_0002892_18889_19557 222
330 3300048928 Ga0496125_0015500 Ga0496125_0015500_4741_5409 222
331 3300048928 Ga0496125_0224879 Ga0496125_0224879_227_895 222
332 3300048929 Ga0496126_0525550 Ga0496126_0525550_151_900 222
333 3300049568 Ga0501031_0481592 Ga0501031_0481592_10_678 222
334 3300049569 Ga0501032_0381053 Ga0501032_0381053_53_721 222
335 3300049573 Ga0501037_0077002 Ga0501037_0077002_149_817 222
336 3300049574 Ga0501038_0394306 Ga0501038_0394306_315_983 222
337 3300049580 Ga0501046_0216402 Ga0501046_0216402_628_1299 222
338 3300049822 Ga0501035_0609936 Ga0501035_0609936_66_734 222
339 3300050493 nmdc:mga0k408_195228_c1 nmdc:mga0k408_195228_c1_282_950 222
340 3300050493 nmdc:mga0k408_305565_c1 nmdc:mga0k408_305565_c1_115_783 222
341 3300050509 nmdc:mga0qj67_120095_c1 nmdc:mga0qj67_120095_c1_1206_1883 222
342 3300053088 Ga0500644_0056645 Ga0500644_0056645_277_945 222
343 3300053108 Ga0500562_000962 Ga0500562_000962_5805_6473 222
344 3300053125 Ga0500618_005373 Ga0500618_005373_2851_3588 222
345 3300053136 Ga0500559_0282353 Ga0500559_0282353_77_745 222
346 3300053730 Ga0500645_000151 Ga0500645_000151_28057_28725 222
347 3300053730 Ga0500645_013959 Ga0500645_013959_1226_1894 222
348 iso_pu_bacteria 2919704043 2919706605 222
349 2162886007 SwRhRL2b_contig_2582705 SwRhRL2b_0592.00013240 223
350 3300001979 JGI24740J21852_10004522 JGI24740J21852_100045224 223
351 3300001989 JGI24739J22299_10009188 JGI24739J22299_100091884 223
352 3300002773 JGI25152J39213_1007682 JGI25152J39213_10076823 223
353 3300003316 rootH1_10013892 rootH1_100138922 223
354 3300003320 rootH2_10067992 rootH2_100679922 223
355 3300003322 rootL2_10082545 rootL2_100825452 223
356 3300003322 rootL2_10082546 rootL2_100825462 223
357 3300003323 rootH1_10019992 rootH1_100199922 223
358 3300003760 Ga0055527_1008441 Ga0055527_10084412 223
359 3300003761 Ga0055535_1000444 Ga0055535_10004447 223
360 3300003762 Ga0055542_1000127 Ga0055542_100012723 223
361 3300003773 Ga0055537_1000741 Ga0055537_10007418 223
362 3300003781 Ga0055536_1014047 Ga0055536_10140474 223
363 3300003784 Ga0055534_1000686 Ga0055534_10006868 223
364 3300003784 Ga0055534_1000946 Ga0055534_10009465 223
365 3300003790 Ga0055528_1001964 Ga0055528_10019646 223
366 3300003791 Ga0055530_10013154 Ga0055530_100131544 223
367 3300003792 Ga0055540_1002688 Ga0055540_10026887 223
368 3300003794 Ga0055531_10018758 Ga0055531_100187582 223
369 3300004625 Ga0055543_1022259 Ga0055543_10222592 223
370 3300005288 Ga0065714_10104364 Ga0065714_101043642 223
371 3300005289 Ga0065704_10104047 Ga0065704_101040472 223
372 3300005353 Ga0070669_100155387 Ga0070669_1001553873 223
373 3300005354 Ga0070675_100578828 Ga0070675_1005788281 223
374 3300005356 Ga0070674_100139611 Ga0070674_1001396112 223
375 3300005356 Ga0070674_100299640 Ga0070674_1002996402 223
376 3300005539 Ga0068853_100038988 Ga0068853_1000389883 223
377 3300005563 Ga0068855_100281722 Ga0068855_1002817222 223
378 3300005578 Ga0068854_100277617 Ga0068854_1002776172 223
379 3300005834 Ga0068851_10051182 Ga0068851_100511823 223
380 3300006038 Ga0075365_10085187 Ga0075365_100851872 223
381 3300006048 Ga0075363_100275004 Ga0075363_1002750042 223
382 3300006058 Ga0075432_10049710 Ga0075432_100497102 223
383 3300006177 Ga0075362_10040858 Ga0075362_100408582 223
384 3300006177 Ga0075362_10152974 Ga0075362_101529742 223
385 3300006178 Ga0075367_10080029 Ga0075367_100800292 223
386 3300006186 Ga0075369_10031340 Ga0075369_100313403 223
387 3300006195 Ga0075366_10081737 Ga0075366_100817372 223
388 3300006353 Ga0075370_10020473 Ga0075370_100204732 223
389 3300006353 Ga0075370_10043817 Ga0075370_100438174 223
390 3300006353 Ga0075370_10220651 Ga0075370_102206512 223
391 3300006946 Ga0079104_1026104 Ga0079104_10261042 223
392 3300006948 Ga0099826_10002661 Ga0099826_100026619 223
393 3300009036 Ga0105244_10083717 Ga0105244_100837172 223
394 3300009093 Ga0105240_10103622 Ga0105240_101036223 223
395 3300009148 Ga0105243_10056277 Ga0105243_100562774 223
396 3300009148 Ga0105243_10560592 Ga0105243_105605922 223
397 3300009545 Ga0105237_10086401 Ga0105237_100864012 223
398 3300009553 Ga0105249_11252054 Ga0105249_112520541 223
399 3300010375 Ga0105239_10061593 Ga0105239_100615932 223
400 3300011119 Ga0105246_10484454 Ga0105246_104844541 223
401 3300013100 Ga0157373_10242444 Ga0157373_102424442 223
402 3300013105 Ga0157369_10002729 Ga0157369_100027293 223
403 3300015261 Ga0182006_1032750 Ga0182006_10327501 223
404 3300015262 Ga0182007_10047464 Ga0182007_100474642 223
405 3300017792 Ga0163161_10045297 Ga0163161_100452971 223
406 3300017792 Ga0163161_10136183 Ga0163161_101361831 223
407 3300025228 Ga0209672_101800 Ga0209672_1018004 223
408 3300025229 Ga0209147_101313 Ga0209147_1013138 223
409 3300025242 Ga0209258_100078 Ga0209258_100078169 223
410 3300025245 Ga0207425_1020292 Ga0207425_10202922 223
411 3300025254 Ga0209148_1000086 Ga0209148_1000086169 223
412 3300025258 Ga0209129_1007455 Ga0209129_10074553 223
413 3300025263 Ga0209565_1000067 Ga0209565_100006758 223
414 3300025263 Ga0209565_1001195 Ga0209565_10011955 223
415 3300025263 Ga0209565_1040087 Ga0209565_10400872 223
416 3300025273 Ga0209673_1000097 Ga0209673_1000097186 223
417 3300025273 Ga0209673_1002750 Ga0209673_100275010 223
418 3300025273 Ga0209673_1006771 Ga0209673_10067713 223
419 3300025273 Ga0209673_1049785 Ga0209673_10497851 223
420 3300025284 Ga0209130_1001183 Ga0209130_10011838 223
421 3300025284 Ga0209130_1002348 Ga0209130_10023483 223
422 3300025291 Ga0209675_1000038 Ga0209675_1000038186 223
423 3300025291 Ga0209675_1001530 Ga0209675_100153011 223
424 3300025291 Ga0209675_1006067 Ga0209675_10060674 223
425 3300025291 Ga0209675_1037777 Ga0209675_10377771 223
426 3300025292 Ga0209676_1000125 Ga0209676_1000125170 223
427 3300025292 Ga0209676_1000290 Ga0209676_100029010 223
428 3300025292 Ga0209676_1006035 Ga0209676_10060355 223
429 3300025294 Ga0209025_1010452 Ga0209025_10104523 223
430 3300025294 Ga0209025_1020578 Ga0209025_10205782 223
431 3300025294 Ga0209025_1062350 Ga0209025_10623502 223
432 3300025294 Ga0209025_1079758 Ga0209025_10797581 223
433 3300025295 Ga0209564_1000289 Ga0209564_100028913 223
434 3300025295 Ga0209564_1047573 Ga0209564_10475732 223
435 3300025297 Ga0209758_1023688 Ga0209758_10236883 223
436 3300025298 Ga0209050_1000012 Ga0209050_1000012614 223
437 3300025298 Ga0209050_1028982 Ga0209050_10289822 223
438 3300025299 Ga0209256_1000318 Ga0209256_100031868 223
439 3300025299 Ga0209256_1013617 Ga0209256_10136172 223
440 3300025302 Ga0207426_1000266 Ga0207426_100026613 223
441 3300025303 Ga0209051_1000134 Ga0209051_1000134108 223
442 3300025303 Ga0209051_1000141 Ga0209051_100014192 223
443 3300025303 Ga0209051_1000827 Ga0209051_100082724 223
444 3300025303 Ga0209051_1016603 Ga0209051_10166032 223
445 3300025304 Ga0209257_1000024 Ga0209257_1000024560 223
446 3300025304 Ga0209257_1004157 Ga0209257_10041576 223
447 3300025304 Ga0209257_1010149 Ga0209257_10101494 223
448 3300025304 Ga0209257_1016033 Ga0209257_10160332 223
449 3300025913 Ga0207695_10135547 Ga0207695_101355473 223
450 3300025923 Ga0207681_10145346 Ga0207681_101453461 223
451 3300025932 Ga0207690_10107259 Ga0207690_101072593 223
452 3300025935 Ga0207709_10000423 Ga0207709_1000042323 223
453 3300025937 Ga0207669_10031262 Ga0207669_100312623 223
454 3300025949 Ga0207667_10270350 Ga0207667_102703502 223
455 3300026041 Ga0207639_10018768 Ga0207639_100187682 223
456 3300026089 Ga0207648_10585327 Ga0207648_105853272 223
457 3300026116 Ga0207674_10145504 Ga0207674_101455042 223
458 3300027666 Ga0209282_1000622 Ga0209282_100062213 223
459 3300028786 Ga0307517_10209401 Ga0307517_102094011 223
460 3300030731 Ga0316177_1077431 Ga0316177_10774315 223
461 3300030732 Ga0316176_1115156 Ga0316176_11151562 223
462 3300030735 Ga0316178_1071171 Ga0316178_10711712 223
463 3300030744 Ga0316181_1106607 Ga0316181_11066072 223
464 3300030745 Ga0316182_1005716 Ga0316182_10057164 223
465 3300030745 Ga0316182_1052468 Ga0316182_10524684 223
466 3300031251 Ga0265327_10002982 Ga0265327_100029829 223
467 3300031251 Ga0265327_10005888 Ga0265327_100058885 223
468 3300031548 Ga0307408_100171313 Ga0307408_1001713133 223
469 3300031548 Ga0307408_100234217 Ga0307408_1002342172 223
470 3300031548 Ga0307408_100308994 Ga0307408_1003089942 223
471 3300031649 Ga0307514_10031551 Ga0307514_100315513 223
472 3300031731 Ga0307405_10113014 Ga0307405_101130142 223
473 3300031731 Ga0307405_10268301 Ga0307405_102683012 223
474 3300031824 Ga0307413_10349689 Ga0307413_103496891 223
475 3300031911 Ga0307412_10212720 Ga0307412_102127202 223
476 3300031911 Ga0307412_10487521 Ga0307412_104875211 223
477 3300031911 Ga0307412_10620284 Ga0307412_106202842 223
478 3300032002 Ga0307416_100300129 Ga0307416_1003001291 223
479 3300032004 Ga0307414_10243745 Ga0307414_102437452 223
480 3300032005 Ga0307411_10051066 Ga0307411_100510661 223
481 3300032005 Ga0307411_10626680 Ga0307411_106266801 223
482 3300041411 Ga0439466_0042140 Ga0439466_0042140_354_1025 223
483 3300041413 Ga0439465_0005416 Ga0439465_0005416_511_1182 223
484 3300041509 Ga0451843_1354054 Ga0451843_1354054_552_1223 223
485 3300041997 Ga0439431_0000412 Ga0439431_0000412_2970_3641 223
486 3300041999 Ga0439433_0012340 Ga0439433_0012340_483_1154 223
487 3300042002 Ga0439442_023670 Ga0439442_023670_251_922 223
488 3300042004 Ga0439445_0000931 Ga0439445_0000931_4233_4904 223
489 3300042006 Ga0439432_000553 Ga0439432_000553_7483_8154 223
490 3300042007 Ga0439449_0001035 Ga0439449_0001035_4954_5625 223
491 3300042010 Ga0439452_001098 Ga0439452_001098_4186_4857 223
492 3300042014 Ga0439457_017065 Ga0439457_017065_478_1149 223
493 3300042156 Ga0439446_0040052 Ga0439446_0040052_512_1183 223
494 3300042185 Ga0450909_001765 Ga0450909_001765_2032_2703 223
495 3300044683 Ga0466965_0114646 Ga0466965_0114646_513_1184 223
496 3300044901 Ga0466960_0014708 Ga0466960_0014708_1829_2500 223
497 3300046453 Ga0495627_009315 Ga0495627_009315_702_1373 223
498 3300046453 Ga0495627_049848 Ga0495627_049848_390_1061 223
499 3300046512 Ga0495610_0036249 Ga0495610_0036249_179_850 223
500 3300046512 Ga0495610_0084073 Ga0495610_0084073_333_1004 223
501 3300046515 Ga0495620_0007804 Ga0495620_0007804_4523_5194 223
502 3300046518 Ga0495631_0000024 Ga0495631_0000024_11522_12193 223
503 3300046520 Ga0495637_0001297 Ga0495637_0001297_736_1407 223
504 3300046530 Ga0495654_0015651 Ga0495654_0015651_1878_2549 223
505 3300046539 Ga0495621_0004608 Ga0495621_0004608_2136_2807 223
506 3300046660 Ga0495625_0002043 Ga0495625_0002043_12616_13287 223
507 3300046674 Ga0495588_0098214 Ga0495588_0098214_407_1078 223
508 3300046674 Ga0495588_0126654 Ga0495588_0126654_486_1157 223
509 3300046674 Ga0495588_0360877 Ga0495588_0360877_15_686 223
510 3300046692 Ga0495671_0065559 Ga0495671_0065559_674_1345 223
511 3300047321 Ga0495676_0066831 Ga0495676_0066831_1124_1795 223
512 3300048904 Ga0496101_0043417 Ga0496101_0043417_322_996 223
513 3300048919 Ga0496116_0019588 Ga0496116_0019588_3310_3981 223
514 3300048920 Ga0496117_0050807 Ga0496117_0050807_339_1013 223
515 3300048920 Ga0496117_0061178 Ga0496117_0061178_259_930 223
516 3300048921 Ga0496118_0047251 Ga0496118_0047251_2149_2823 223
517 3300048925 Ga0496122_0142047 Ga0496122_0142047_250_921 223
518 3300048925 Ga0496122_0150084 Ga0496122_0150084_184_855 223
519 3300048927 Ga0496124_0264580 Ga0496124_0264580_349_1020 223
520 3300048927 Ga0496124_0300995 Ga0496124_0300995_166_837 223
521 3300048928 Ga0496125_0073287 Ga0496125_0073287_1642_2316 223
522 3300048929 Ga0496126_0219919 Ga0496126_0219919_539_1210 223
523 3300049674 Ga0501242_015778 Ga0501242_015778_165_836 223
524 3300049705 Ga0501225_0001534 Ga0501225_0001534_812_1483 223
525 3300049758 Ga0501241_034835 Ga0501241_034835_269_940 223
526 3300050489 nmdc:mga03683_14638_c1 nmdc:mga03683_14638_c1_534_1205 223
527 3300050489 nmdc:mga03683_18489_c2 nmdc:mga03683_18489_c2_531_1202 223
528 3300050489 nmdc:mga03683_31350_c1 nmdc:mga03683_31350_c1_512_1183 223
529 3300050489 nmdc:mga03683_99792_c1 nmdc:mga03683_99792_c1_256_927 223
530 3300050490 nmdc:mga03n38_68923_c1 nmdc:mga03n38_68923_c1_397_1068 223
531 3300050490 nmdc:mga03n38_74626_c1 nmdc:mga03n38_74626_c1_246_917 223
532 3300050491 nmdc:mga00v17_129830_c1 nmdc:mga00v17_129830_c1_666_1337 223
533 3300050491 nmdc:mga00v17_139585_c1 nmdc:mga00v17_139585_c1_191_862 223
534 3300050491 nmdc:mga00v17_224348_c1 nmdc:mga00v17_224348_c1_331_1002 223
535 3300050492 nmdc:mga0yw44_273100_c1 nmdc:mga0yw44_273100_c1_290_961 223
536 3300050493 nmdc:mga0k408_13854_c1 nmdc:mga0k408_13854_c1_3141_3812 223
537 3300050493 nmdc:mga0k408_150894_c1 nmdc:mga0k408_150894_c1_498_1211 223
538 3300050494 nmdc:mga06z11_198364_c1 nmdc:mga06z11_198364_c1_225_896 223
539 3300050495 nmdc:mga04h51_227690_c1 nmdc:mga04h51_227690_c1_52_723 223
540 3300050496 nmdc:mga07m45_14460_c1 nmdc:mga07m45_14460_c1_978_1649 223
541 3300050496 nmdc:mga07m45_73863_c1 nmdc:mga07m45_73863_c1_437_1108 223
542 3300050496 nmdc:mga07m45_76463_c1 nmdc:mga07m45_76463_c1_862_1533 223
543 3300050516 nmdc:mga0sz30_48862_c1 nmdc:mga0sz30_48862_c1_838_1509 223
544 3300053079 Ga0500610_0002872 Ga0500610_0002872_5686_6357 223
545 3300053079 Ga0500610_0009448 Ga0500610_0009448_1756_2427 223
546 3300053118 Ga0500594_0034823 Ga0500594_0034823_397_1068 223
547 3300053121 Ga0500607_067986 Ga0500607_067986_731_1402 223
548 3300053122 Ga0500608_011378 Ga0500608_011378_2714_3385 223
549 3300053134 Ga0500658_0009580 Ga0500658_0009580_1979_2650 223
550 3300053139 Ga0500568_0002854 Ga0500568_0002854_6611_7282 223
551 3300053141 Ga0500574_004711 Ga0500574_004711_988_1659 223
552 3300053153 Ga0500616_0080443 Ga0500616_0080443_376_1047 223
553 3300053161 Ga0500634_0078822 Ga0500634_0078822_731_1402 223
554 3300053730 Ga0500645_083605 Ga0500645_083605_125_796 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

12

137

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d06-assembly4.cif.gz_K hallucinated c3 protein assembly halc3_104 0.8327 93 143
8d06-assembly1.cif.gz_A hallucinated c3 protein assembly halc3_104 0.728 93 165
8d06-assembly1.cif.gz_A hallucinated c3 protein assembly halc3_104 0.6612 93 165
8d06-assembly4.cif.gz_K hallucinated c3 protein assembly halc3_104 0.6593 93 143
6hd8-assembly1.cif.gz_B crystal structure of the potassium channel mttmem175 in complex with a nanobody-mbp fusion protein 0.615 93 212
ID Description Score Start End Superfamily
af_P75830_95_182_6.10.140.1990 Special;Helix non-globular;Helix Hairpins; 0.6883 93 165 6.10.140.1990
af_E9AGV5_260_442_1.25.40.330 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Adenylate cyclase-associated CAP, N-terminal domain 0.649 92 165 1.25.40.330
af_P75830_95_182_6.10.140.1990 Special;Helix non-globular;Helix Hairpins; 0.5537 93 165 6.10.140.1990
af_Q08421_57_409_1.25.40.1040 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.5312 86 172 1.25.40.1040
af_A0A1D6KXJ0_253_416_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4761 7 192 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A158CFT7-F1-model_v4 Peptidase M50 0.983 6 221 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A9BNZ8-F1-model_v4 Peptidase M50 0.9747 1 223 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A1J5P349-F1-model_v4 Peptidase family M50 0.9741 4 221 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A1V6EIL4-F1-model_v4 Peptidase family M50 0.9715 83 223 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A4Q3RGG6-F1-model_v4 deleted 0.9697 1 223

Feature Viewer

pLDDT pTM Quality
81.03 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map