F462914

General Info

Members Datasets Scaffolds Average Seq Length
553 393 526 200

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0228385|Ga0496121_0228385_51_761
Length 236
Sequence LEFVMTARSQTCTAFEGHRRIASGASPDVALAVREVLARGEQAPVLVFDDITSRPVEFDLRGTPEQIVARLASQNDEAETAHAAVDAAEDAPRGRGRPKLGVVAREVTLLPRHWDWLNGQSGGASVALRKLVDAARAAGEDKDRRRAAQEAVYRFMTALAGNLPRYEDATRALYADDRPRFEEIVATWPDDVRDYSLQLADAAFARHAQSRLIAASSRAQTTNRTDEKKTAHAGEA

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
3 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
4 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
5 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
6 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
7 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
8 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
9 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
10 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
11 2818991450 Burkholderia sp. 604 Isolate Unclassified
12 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
13 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
14 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
15 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
16 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
17 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
18 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
19 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
20 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
21 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
22 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
23 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
24 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
25 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
26 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
27 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
31 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
32 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
33 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
42 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
217 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
246 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
247 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
320 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
321 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
328 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
333 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
334 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
335 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
336 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
337 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
342 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
350 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
370 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
385 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
391 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
392 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
393 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.94
Metatranscriptomes 0.18
Isolates 4.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 1.45
Rhizoplane 4.34
Rhizosphere 81.37
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1023768 3300001977 Bacteria 851
2 JGI24740J21852_10003389 3300001979 Bacteria 7015
3 JGI24739J22299_10002488 3300001989 Bacteria 7112
4 JGI24739J22299_10016174 3300001989 Bacteria 2702
5 JGI24743J22301_10003100 3300001991 Bacteria 2591
6 JGI24735J21928_10022697 3300002067 Bacteria 1907
7 JGI24735J21928_10036658 3300002067 Bacteria 1438
8 JGI24738J21930_10001268 3300002075 Bacteria 7077
9 JGI24738J21930_10052018 3300002075 Bacteria 836
10 JGI24744J21845_10007709 3300002077 Bacteria 2225
11 JGI24034J26672_10037608 3300002239 Bacteria 805
12 JGI24742J22300_10007474 3300002244 Bacteria 1804
13 JGI24742J22300_10008907 3300002244 Bacteria 1655
14 JGI25156J39149_1001787 3300002705 Bacteria 8462
15 JGI25156J39149_1002719 3300002705 Bacteria 6170
16 JGI25156J39149_1004311 3300002705 Bacteria 4369
17 JGI25165J46597_1001807 3300003214 Bacteria 9051
18 Ga0055533_1000175 3300003756 Bacteria 57439
19 Ga0055533_1000234 3300003756 Bacteria 36168
20 Ga0055533_1004342 3300003756 Bacteria 2573
21 Ga0055532_1000031 3300003758 Bacteria 231440
22 Ga0055527_1000020 3300003760 Bacteria 231441
23 Ga0055535_1000023 3300003761 Bacteria 231441
24 Ga0055542_1000035 3300003762 Bacteria 231441
25 Ga0055529_1000039 3300003763 Bacteria 231439
26 Ga0058692_1020413 3300003856 Bacteria 1393
27 Ga0065707_10215091 3300005295 Bacteria 1248
28 Ga0070658_10237045 3300005327 Bacteria 1546
29 Ga0070676_10405462 3300005328 Bacteria 949
30 Ga0070683_100147792 3300005329 Bacteria 2227
31 Ga0070683_100161802 3300005329 Bacteria 2124
32 Ga0070690_100212432 3300005330 Bacteria 1352
33 Ga0070670_100404367 3300005331 Bacteria 1206
34 Ga0068869_100056254 3300005334 Bacteria 2869
35 Ga0070680_100814740 3300005336 Bacteria 805
36 Ga0070682_100633974 3300005337 Bacteria 848
37 Ga0068868_100008027 3300005338 Bacteria 7546
38 Ga0070660_100169685 3300005339 Bacteria 1762
39 Ga0070660_100886136 3300005339 Bacteria 752
40 Ga0070660_100970553 3300005339 Bacteria 718
41 Ga0070689_100128639 3300005340 Bacteria 2029
42 Ga0070691_10057024 3300005341 Bacteria 1873
43 Ga0070687_100013129 3300005343 Bacteria 3680
44 Ga0070661_100228110 3300005344 Bacteria 1431
45 Ga0070661_100311382 3300005344 Bacteria 1228
46 Ga0070692_10023724 3300005345 Bacteria 3009
47 Ga0070668_100086182 3300005347 Bacteria 2469
48 Ga0070669_100218668 3300005353 Bacteria 1506
49 Ga0070669_100469581 3300005353 Bacteria 1039
50 Ga0070675_100033460 3300005354 Bacteria 4168
51 Ga0070674_100052636 3300005356 Bacteria 2808
52 Ga0070674_100491397 3300005356 Bacteria 1020
53 Ga0070673_100023147 3300005364 Bacteria 4535
54 Ga0070673_100150943 3300005364 Bacteria 1968
55 Ga0070688_100040057 3300005365 Bacteria 2870
56 Ga0070659_100108405 3300005366 Bacteria 2240
57 Ga0070659_100114744 3300005366 Bacteria 2177
58 Ga0070667_100021215 3300005367 Bacteria 5397
59 Ga0070667_100049175 3300005367 Bacteria 3550
60 Ga0070713_100083972 3300005436 Bacteria 2724
61 Ga0070710_10088465 3300005437 Bacteria 1822
62 Ga0070701_10005793 3300005438 Bacteria 5144
63 Ga0070711_100052070 3300005439 Bacteria 2816
64 Ga0070700_100098643 3300005441 Bacteria 1920
65 Ga0070694_100457517 3300005444 Bacteria 1009
66 Ga0070663_100064656 3300005455 Bacteria 2645
67 Ga0070663_100142424 3300005455 Bacteria 1831
68 Ga0070678_100045543 3300005456 Bacteria 3139
69 Ga0070678_101012649 3300005456 Bacteria 764
70 Ga0070662_100091612 3300005457 Bacteria 2283
71 Ga0070681_10697805 3300005458 Bacteria 931
72 Ga0068867_100007166 3300005459 Bacteria 7880
73 Ga0070685_10000890 3300005466 Bacteria 16081
74 Ga0070698_100021013 3300005471 Bacteria 6839
75 Ga0070699_100003337 3300005518 Bacteria 14205
76 Ga0070684_100155033 3300005535 Bacteria 2077
77 Ga0070684_100561707 3300005535 Bacteria 1059
78 Ga0068853_100066529 3300005539 Bacteria 3130
79 Ga0068853_100762296 3300005539 Bacteria 925
80 Ga0070672_100027998 3300005543 Bacteria 4210
81 Ga0070696_100308722 3300005546 Bacteria 1214
82 Ga0070693_100332959 3300005547 Bacteria 1034
83 Ga0070665_100162598 3300005548 Bacteria 2234
84 Ga0070665_100303922 3300005548 Bacteria 1598
85 Ga0070665_100367337 3300005548 Bacteria 1445
86 Ga0070704_100040984 3300005549 Bacteria 3193
87 Ga0068855_100104012 3300005563 Bacteria 3266
88 Ga0068855_100709611 3300005563 Bacteria 1076
89 Ga0070664_100131617 3300005564 Bacteria 2198
90 Ga0070664_100875444 3300005564 Bacteria 841
91 Ga0068857_100077671 3300005577 Bacteria 2963
92 Ga0068854_100030942 3300005578 Bacteria 3716
93 Ga0068856_100072329 3300005614 Bacteria 3414
94 Ga0068856_100166830 3300005614 Bacteria 2213
95 Ga0070702_100088503 3300005615 Bacteria 1872
96 Ga0068852_100120901 3300005616 Bacteria 2397
97 Ga0068859_100102096 3300005617 Bacteria 2925
98 Ga0068864_100007658 3300005618 Bacteria 8894
99 Ga0068851_10145731 3300005834 Bacteria 1291
100 Ga0068870_10006338 3300005840 Bacteria 5211
101 Ga0068863_100001818 3300005841 Bacteria 21200
102 Ga0068863_101495169 3300005841 Bacteria 684
103 Ga0068858_100018691 3300005842 Bacteria 6487
104 Ga0068860_100000433 3300005843 Bacteria 53218
105 Ga0068860_100016352 3300005843 Bacteria 7234
106 Ga0068860_101524486 3300005843 Bacteria 690
107 Ga0068862_100003882 3300005844 Bacteria 12713
108 Ga0070717_10141338 3300006028 Bacteria 2077
109 Ga0075368_10070669 3300006042 Bacteria 1409
110 Ga0070715_10071751 3300006163 Bacteria 1549
111 Ga0070716_100476996 3300006173 Bacteria 915
112 Ga0075362_10111515 3300006177 Bacteria 1288
113 Ga0097621_100368620 3300006237 Bacteria 1281
114 Ga0075370_10032793 3300006353 Bacteria 2905
115 Ga0075370_10203956 3300006353 Bacteria 1167
116 Ga0068871_100022390 3300006358 Bacteria 4870
117 Ga0075428_100636678 3300006844 Bacteria 1138
118 Ga0075430_100240608 3300006846 Bacteria 1500
119 Ga0075431_100396136 3300006847 Bacteria 1382
120 Ga0075433_10077157 3300006852 Bacteria 2935
121 Ga0075433_10231541 3300006852 Bacteria 1640
122 Ga0075434_100127256 3300006871 Archaea 2564
123 Ga0075434_100168759 3300006871 Bacteria 2208
124 Ga0075429_100724610 3300006880 Bacteria 871
125 Ga0075436_100242896 3300006914 Bacteria 1281
126 Ga0097620_100102102 3300006931 Bacteria 2925
127 Ga0075435_100476687 3300007076 Bacteria 1077
128 Ga0099795_10002946 3300007788 Bacteria 4127
129 Ga0105251_10000269 3300009011 Bacteria 52035
130 Ga0105251_10063827 3300009011 Bacteria 1727
131 Ga0111539_10064533 3300009094 Bacteria 4331
132 Ga0111539_10317799 3300009094 Bacteria 1812
133 Ga0105245_10132707 3300009098 Bacteria 2337
134 Ga0105247_10013108 3300009101 Bacteria 4973
135 Ga0114129_10053597 3300009147 Bacteria 5657
136 Ga0114129_10101997 3300009147 Bacteria 3969
137 Ga0105242_10074845 3300009176 Bacteria 2818
138 Ga0105242_11058973 3300009176 Bacteria 822
139 Ga0105248_10095110 3300009177 Bacteria 3354
140 Ga0105248_10304508 3300009177 Bacteria 1795
141 Ga0105237_10081836 3300009545 Bacteria 3220
142 Ga0105238_10252943 3300009551 Bacteria 1741
143 Ga0105238_10770237 3300009551 Bacteria 977
144 Ga0105249_10059014 3300009553 Bacteria 3518
145 Ga0099796_10004984 3300010159 Bacteria 3272
146 Ga0105239_10061461 3300010375 Bacteria 4123
147 Ga0105246_10019081 3300011119 Bacteria 4376
148 Ga0157371_10203192 3300013102 Bacteria 1421
149 Ga0157369_10214911 3300013105 Bacteria 2014
150 Ga0157369_10252038 3300013105 Bacteria 1842
151 Ga0157369_10261033 3300013105 Bacteria 1806
152 Ga0157374_10073828 3300013296 Bacteria 3219
153 Ga0163162_10041652 3300013306 Bacteria 4596
154 Ga0163162_10113557 3300013306 Bacteria 2807
155 Ga0157372_10150560 3300013307 Bacteria 2685
156 Ga0157375_10175189 3300013308 Bacteria 2294
157 Ga0157375_10980136 3300013308 Bacteria 986
158 Ga0163163_10027358 3300014325 Archaea 5461
159 Ga0182008_10026033 3300014497 Bacteria 2968
160 Ga0157379_10045233 3300014968 Bacteria 3930
161 Ga0157379_10108896 3300014968 Bacteria 2488
162 Ga0157379_10786355 3300014968 Bacteria 897
163 Ga0157376_10027570 3300014969 Bacteria 4505
164 Ga0182007_10002279 3300015262 Bacteria 9669
165 Ga0163161_10145796 3300017792 Bacteria 1796
166 Ga0206354_11182836 3300020081 Bacteria 864
167 Ga0213875_10002701 3300021388 Bacteria 10476
168 Ga0209674_100017 3300025226 Bacteria 689087
169 Ga0209674_100085 3300025226 Bacteria 190617
170 Ga0209674_100143 3300025226 Bacteria 107275
171 Ga0209672_100001 3300025228 Bacteria 2828210
172 Ga0209147_100001 3300025229 Bacteria 2384371
173 Ga0207427_101362 3300025231 Bacteria 9008
174 Ga0209258_100001 3300025242 Bacteria 2384269
175 Ga0209148_1000003 3300025254 Bacteria 2384288
176 Ga0209759_1000037 3300025256 Bacteria 259200
177 Ga0209759_1000092 3300025256 Bacteria 161238
178 Ga0209759_1000200 3300025256 Bacteria 94590
179 Ga0209233_1000123 3300025261 Bacteria 228400
180 Ga0209455_1000001 3300025272 Bacteria 2384278
181 Ga0207697_10099834 3300025315 Bacteria 1236
182 Ga0207656_10036613 3300025321 Bacteria 2060
183 Ga0207713_1000435 3300025735 Bacteria 44035
184 Ga0207713_1105724 3300025735 Bacteria 964
185 Ga0207692_10408297 3300025898 Bacteria 848
186 Ga0207710_10011112 3300025900 Bacteria 3791
187 Ga0207688_10000092 3300025901 Bacteria 34911
188 Ga0207680_10046917 3300025903 Bacteria 2556
189 Ga0207647_10012684 3300025904 Bacteria 5857
190 Ga0207647_10025467 3300025904 Bacteria 3886
191 Ga0207647_10059672 3300025904 Bacteria 2333
192 Ga0207685_10056026 3300025905 Bacteria 1541
193 Ga0207645_10003528 3300025907 Bacteria 11833
194 Ga0207643_10001083 3300025908 Bacteria 16109
195 Ga0207654_10435032 3300025911 Bacteria 917
196 Ga0207707_10785228 3300025912 Bacteria 794
197 Ga0207695_10321335 3300025913 Bacteria 1437
198 Ga0207671_10013631 3300025914 Bacteria 6464
199 Ga0207663_10038672 3300025916 Bacteria 2886
200 Ga0207660_10667758 3300025917 Bacteria 847
201 Ga0207662_10001580 3300025918 Bacteria 11150
202 Ga0207657_10125119 3300025919 Bacteria 2112
203 Ga0207646_11073116 3300025922 Bacteria 709
204 Ga0207681_10207086 3300025923 Bacteria 1509
205 Ga0207694_10642357 3300025924 Bacteria 894
206 Ga0207650_10165000 3300025925 Bacteria 1757
207 Ga0207659_10016670 3300025926 Bacteria 4787
208 Ga0207687_10018688 3300025927 Bacteria 4580
209 Ga0207700_10067310 3300025928 Bacteria 2741
210 Ga0207644_10033432 3300025931 Bacteria 3593
211 Ga0207690_10040226 3300025932 Bacteria 3055
212 Ga0207690_10383583 3300025932 Bacteria 1117
213 Ga0207706_10008103 3300025933 Bacteria 9697
214 Ga0207686_10008312 3300025934 Bacteria 5599
215 Ga0207670_10020428 3300025936 Bacteria 4069
216 Ga0207669_10019553 3300025937 Bacteria 3529
217 Ga0207704_10563890 3300025938 Bacteria 927
218 Ga0207691_10023849 3300025940 Bacteria 5758
219 Ga0207711_10025808 3300025941 Bacteria 4927
220 Ga0207711_10771593 3300025941 Unclassified 896
221 Ga0207689_10051943 3300025942 Bacteria 3379
222 Ga0207661_10016764 3300025944 Bacteria 5409
223 Ga0207661_10106849 3300025944 Bacteria 2360
224 Ga0207679_10190530 3300025945 Bacteria 1705
225 Ga0207679_10273544 3300025945 Bacteria 1445
226 Ga0207667_10354487 3300025949 Bacteria 1496
227 Ga0207651_10016867 3300025960 Bacteria 4295
228 Ga0207651_11034254 3300025960 Bacteria 735
229 Ga0207712_10046176 3300025961 Bacteria 3019
230 Ga0207668_10029136 3300025972 Bacteria 3615
231 Ga0207640_10278231 3300025981 Bacteria 1313
232 Ga0207658_10118589 3300025986 Bacteria 2105
233 Ga0207677_10530863 3300026023 Bacteria 1022
234 Ga0207703_10064191 3300026035 Bacteria 3013
235 Ga0207703_10552631 3300026035 Bacteria 1086
236 Ga0207639_10210568 3300026041 Bacteria 1673
237 Ga0207639_10280476 3300026041 Bacteria 1465
238 Ga0207708_10000679 3300026075 Bacteria 26002
239 Ga0207702_10295357 3300026078 Bacteria 1536
240 Ga0207702_10790994 3300026078 Bacteria 937
241 Ga0207648_10001913 3300026089 Bacteria 22748
242 Ga0207676_10005821 3300026095 Bacteria 8715
243 Ga0207674_10023205 3300026116 Bacteria 6649
244 Ga0207675_100004582 3300026118 Bacteria 13325
245 Ga0207683_10006472 3300026121 Bacteria 10023
246 Ga0207698_10155619 3300026142 Bacteria 1991
247 Ga0207698_10330091 3300026142 Bacteria 1432
248 Ga0209371_1002008 3300027312 Bacteria 12240
249 Ga0207428_10290881 3300027907 Bacteria 1211
250 Ga0268266_10047366 3300028379 Bacteria 3682
251 Ga0268265_11075541 3300028380 Bacteria 797
252 Ga0268264_10000062 3300028381 Bacteria 302110
253 Ga0268264_10019403 3300028381 Bacteria 5556
254 Ga0268264_10378075 3300028381 Bacteria 1356
255 Ga0268256_1001757 3300030500 Bacteria 12240
256 Ga0265329_10003505 3300031242 Bacteria 6798
257 Ga0265339_10000627 3300031249 Bacteria 27311
258 Ga0265331_10076029 3300031250 Bacteria 1565
259 Ga0265327_10158143 3300031251 Bacteria 1049
260 Ga0265316_10086153 3300031344 Bacteria 2402
261 Ga0307509_10006490 3300031507 Bacteria 15715
262 Ga0307509_10220729 3300031507 Bacteria 1709
263 Ga0307408_100005169 3300031548 Bacteria 8755
264 Ga0265313_10009581 3300031595 Bacteria 6266
265 Ga0265313_10094128 3300031595 Bacteria 1339
266 Ga0307508_10000108 3300031616 Bacteria 97443
267 Ga0265314_10001008 3300031711 Bacteria 32993
268 Ga0265314_10001100 3300031711 Bacteria 31213
269 Ga0265342_10043832 3300031712 Bacteria 2698
270 Ga0316576_10698563 3300031727 Unclassified 735
271 Ga0307516_10000908 3300031730 Bacteria 40669
272 Ga0307516_10235896 3300031730 Bacteria 1530
273 Ga0307410_10340616 3300031852 Bacteria 1195
274 Ga0307407_10163530 3300031903 Bacteria 1459
275 Ga0307412_10000014 3300031911 Bacteria 353795
276 Ga0307409_100529907 3300031995 Bacteria 1152
277 Ga0373934_0163697 3300035086 Bacteria 913
278 Ga0373946_0349325 3300035171 Bacteria 739
279 Ga0373955_0451953 3300035172 Bacteria 783
280 Ga0373961_0336987 3300035241 Bacteria 566
281 Ga0373924_0481826 3300035410 Bacteria 557
282 Ga0373931_0148654 3300035691 Bacteria 1364
283 Ga0373931_0498051 3300035691 Bacteria 785
284 Ga0373931_0616099 3300035691 Bacteria 711
285 Ga0373937_1257105 3300036401 Bacteria 688
286 Ga0395900_0041674 3300037418 Bacteria 4732
287 Ga0395898_0139449 3300037466 Bacteria 2321
288 Ga0436364_0567892 3300037853 Bacteria 10612
289 Ga0395901_0037001 3300038443 Bacteria 5047
290 Ga0242420_099384 3300038996 Bacteria 618
291 Ga0400483_217610 3300039062 Bacteria 1913
292 Ga0400489_18479 3300039093 Bacteria 2032
293 Ga0436363_1313259 3300039450 Bacteria 3200
294 Ga0439436_0051993 3300041404 Bacteria 1156
295 Ga0451793_0087511 3300041452 Bacteria 3323
296 Ga0451795_0039163 3300041456 Bacteria 1104
297 Ga0451577_0001798 3300042876 Bacteria 27438
298 Ga0451577_0004743 3300042876 Bacteria 14234
299 Ga0451577_0641786 3300042876 Bacteria 963
300 Ga0451577_0892657 3300042876 Unclassified 801
301 Ga0466963_0073993 3300044694 Bacteria 2298
302 Ga0453684_0050546 3300044712 Bacteria 5466
303 Ga0451576_0099519 3300045051 Bacteria 3025
304 Ga0451576_1137445 3300045051 Bacteria 816
305 Ga0495592_0118473 3300046454 Bacteria 1865
306 Ga0495590_0025822 3300046457 Bacteria 2063
307 Ga0495591_060021 3300046458 Bacteria 1013
308 Ga0495629_0000034 3300046459 Bacteria 118709
309 Ga0495629_0001013 3300046459 Bacteria 22585
310 Ga0495629_0007389 3300046459 Bacteria 8100
311 Ga0495638_0015393 3300046460 Bacteria 5137
312 Ga0495641_0027950 3300046461 Bacteria 2735
313 Ga0495651_0007769 3300046462 Bacteria 8207
314 Ga0495651_0104894 3300046462 Bacteria 2098
315 Ga0495651_0252380 3300046462 Bacteria 1204
316 Ga0495653_0001766 3300046463 Bacteria 17042
317 Ga0495653_0083128 3300046463 Bacteria 2361
318 Ga0495653_0146215 3300046463 Bacteria 1656
319 Ga0495650_0001635 3300046471 Bacteria 20815
320 Ga0495650_0019002 3300046471 Bacteria 3399
321 Ga0495650_0019198 3300046471 Bacteria 3375
322 Ga0495650_0026693 3300046471 Bacteria 2680
323 Ga0495650_0034988 3300046471 Bacteria 2216
324 Ga0495580_0004501 3300046472 Bacteria 11707
325 Ga0495580_0006375 3300046472 Bacteria 9626
326 Ga0495580_0007438 3300046472 Bacteria 8804
327 Ga0495582_0015387 3300046473 Bacteria 4202
328 Ga0495605_0002834 3300046474 Bacteria 10539
329 Ga0495662_0062221 3300046476 Bacteria 1803
330 Ga0495664_0009482 3300046477 Bacteria 5448
331 Ga0495664_0069254 3300046477 Bacteria 2106
332 Ga0495664_0123795 3300046477 Bacteria 1564
333 Ga0495584_0042189 3300046491 Bacteria 2303
334 Ga0495584_0170052 3300046491 Bacteria 1108
335 Ga0495584_0349168 3300046491 Bacteria 751
336 Ga0495585_0245989 3300046492 Bacteria 894
337 Ga0495596_0034101 3300046500 Bacteria 2023
338 Ga0495596_0090560 3300046500 Bacteria 1187
339 Ga0495607_0205520 3300046501 Bacteria 972
340 Ga0495607_0419986 3300046501 Bacteria 605
341 Ga0495583_0003116 3300046506 Bacteria 13113
342 Ga0495606_0016303 3300046507 Bacteria 5673
343 Ga0495606_0018047 3300046507 Bacteria 5306
344 Ga0495606_0080382 3300046507 Bacteria 2028
345 Ga0495608_0149753 3300046511 Bacteria 1487
346 Ga0495608_0459800 3300046511 Bacteria 774
347 Ga0495616_0161638 3300046513 Bacteria 1007
348 Ga0495616_0195463 3300046513 Bacteria 892
349 Ga0495618_0050693 3300046514 Bacteria 2622
350 Ga0495618_0121028 3300046514 Bacteria 1676
351 Ga0495620_0003580 3300046515 Bacteria 8876
352 Ga0495628_0009315 3300046516 Bacteria 8389
353 Ga0495628_0212788 3300046516 Bacteria 1453
354 Ga0495630_0056510 3300046517 Bacteria 2940
355 Ga0495630_0092904 3300046517 Bacteria 2280
356 Ga0495630_0208177 3300046517 Bacteria 1493
357 Ga0495631_0192594 3300046518 Bacteria 873
358 Ga0495637_0056139 3300046520 Bacteria 1631
359 Ga0495643_0092994 3300046522 Bacteria 1553
360 Ga0495663_0060164 3300046525 Bacteria 1193
361 Ga0495666_0026793 3300046526 Bacteria 2838
362 Ga0495642_0001699 3300046528 Bacteria 9496
363 Ga0495642_0020732 3300046528 Bacteria 2583
364 Ga0495652_0005229 3300046529 Bacteria 12259
365 Ga0495652_0054217 3300046529 Bacteria 3414
366 Ga0495652_0100723 3300046529 Bacteria 2343
367 Ga0495654_0001638 3300046530 Bacteria 15167
368 Ga0495654_0082615 3300046530 Bacteria 1503
369 Ga0495665_0022320 3300046531 Bacteria 3402
370 Ga0495665_0038461 3300046531 Bacteria 2550
371 Ga0495640_0026178 3300046533 Bacteria 4218
372 Ga0495586_0489443 3300046535 Unclassified 710
373 Ga0495587_0373384 3300046536 Bacteria 794
374 Ga0495597_0006041 3300046542 Bacteria 6307
375 Ga0495597_0071108 3300046542 Bacteria 1499
376 Ga0495645_0001014 3300046543 Bacteria 19105
377 Ga0495645_0088887 3300046543 Bacteria 2209
378 Ga0495633_0291110 3300046558 Bacteria 742
379 Ga0495667_0069190 3300046559 Bacteria 2304
380 Ga0495668_0203386 3300046616 Bacteria 1084
381 Ga0495668_0203746 3300046616 Bacteria 1083
382 Ga0495634_0014874 3300046642 Bacteria 5594
383 Ga0495659_0161391 3300046664 Bacteria 905
384 Ga0495661_0007205 3300046665 Bacteria 7757
385 Ga0495661_0036075 3300046665 Bacteria 3098
386 Ga0495588_0010689 3300046674 Bacteria 4281
387 Ga0495657_0015754 3300046675 Bacteria 5524
388 Ga0495623_0013794 3300046679 Bacteria 5239
389 Ga0495623_0014711 3300046679 Bacteria 5060
390 Ga0495623_0539284 3300046679 Bacteria 612
391 Ga0495646_0010051 3300046680 Bacteria 6018
392 Ga0495646_0024779 3300046680 Bacteria 3777
393 Ga0495646_0037504 3300046680 Bacteria 2997
394 Ga0495669_0013198 3300046684 Bacteria 3518
395 Ga0495669_0390043 3300046684 Bacteria 674
396 Ga0495613_0020732 3300046689 Bacteria 4900
397 Ga0495613_0024240 3300046689 Bacteria 4521
398 Ga0495613_0168259 3300046689 Bacteria 1557
399 Ga0495624_0002128 3300046690 Bacteria 15089
400 Ga0495624_0030098 3300046690 Bacteria 3538
401 Ga0495670_0288194 3300046691 Bacteria 879
402 Ga0495649_0080110 3300046694 Bacteria 1746
403 Ga0495589_0003147 3300046794 Bacteria 9029
404 Ga0495589_0092619 3300046794 Bacteria 1467
405 Ga0495581_0000534 3300047315 Bacteria 19544
406 Ga0495604_0011449 3300047317 Bacteria 7043
407 Ga0495604_0258244 3300047317 Bacteria 1185
408 Ga0495636_0052449 3300047318 Bacteria 1711
409 Ga0495636_0385839 3300047318 Bacteria 665
410 Ga0495674_0044070 3300047319 Bacteria 3967
411 Ga0495674_0048296 3300047319 Bacteria 3766
412 Ga0495674_0121251 3300047319 Bacteria 2208
413 Ga0495672_0083459 3300047320 Bacteria 1774
414 Ga0495676_0184178 3300047321 Bacteria 1461
415 Ga0495680_0034306 3300047322 Bacteria 4099
416 Ga0495680_0109607 3300047322 Bacteria 2047
417 Ga0495683_0009400 3300047323 Bacteria 5209
418 Ga0495683_0019979 3300047323 Bacteria 3456
419 Ga0495683_0023754 3300047323 Bacteria 3150
420 Ga0495687_036872 3300047443 Bacteria 2183
421 Ga0495679_000007 3300047446 Bacteria 401482
422 Ga0495684_0191113 3300047471 Bacteria 1514
423 Ga0495686_0042021 3300047472 Bacteria 2909
424 Ga0495686_0105577 3300047472 Bacteria 1694
425 Ga0495593_0018774 3300047673 Bacteria 3882
426 Ga0495593_0091952 3300047673 Bacteria 1561
427 Ga0495593_0118670 3300047673 Bacteria 1347
428 Ga0495602_0092287 3300048088 Bacteria 2509
429 Ga0495602_0122177 3300048088 Bacteria 2093
430 Ga0495602_0157194 3300048088 Bacteria 1779
431 Ga0495602_0162456 3300048088 Bacteria 1742
432 Ga0495614_0005607 3300048089 Bacteria 5660
433 Ga0495614_0006617 3300048089 Bacteria 5190
434 Ga0495615_0110179 3300048090 Bacteria 787
435 Ga0495626_0020272 3300048091 Bacteria 3315
436 Ga0495626_0032791 3300048091 Bacteria 2492
437 Ga0495626_0058049 3300048091 Bacteria 1770
438 Ga0496100_0015825 3300048903 Bacteria 4413
439 Ga0496101_0091019 3300048904 Bacteria 2269
440 Ga0496101_0097176 3300048904 Bacteria 2199
441 Ga0496102_0140003 3300048905 Bacteria 2268
442 Ga0496103_0013122 3300048906 Bacteria 4912
443 Ga0496104_0035201 3300048907 Bacteria 4675
444 Ga0496104_0059994 3300048907 Bacteria 3603
445 Ga0496105_0025266 3300048908 Bacteria 4833
446 Ga0496106_0010888 3300048909 Bacteria 6719
447 Ga0496106_0667518 3300048909 Unclassified 830
448 Ga0496107_0012596 3300048910 Bacteria 5904
449 Ga0496108_0043162 3300048911 Bacteria 3766
450 Ga0496108_0274515 3300048911 Bacteria 1467
451 Ga0496109_0082300 3300048912 Bacteria 2966
452 Ga0496110_0009317 3300048913 Bacteria 7942
453 Ga0496111_0053990 3300048914 Bacteria 2903
454 Ga0496112_0013272 3300048915 Bacteria 7605
455 Ga0496112_0193828 3300048915 Bacteria 1993
456 Ga0496113_0017691 3300048916 Bacteria 4954
457 Ga0496114_0007580 3300048917 Bacteria 8581
458 Ga0496115_0020547 3300048918 Bacteria 5094
459 Ga0496117_0031181 3300048920 Bacteria 4074
460 Ga0496117_0124745 3300048920 Bacteria 1574
461 Ga0496118_0011851 3300048921 Bacteria 8451
462 Ga0496118_0019093 3300048921 Bacteria 6142
463 Ga0496118_0021529 3300048921 Bacteria 5670
464 Ga0496121_0228385 3300048924 Bacteria 1305
465 Ga0496126_0310018 3300048929 Bacteria 1300
466 Ga0495678_011639 3300049459 Bacteria 4203
467 Ga0501032_0100351 3300049569 Bacteria 1918
468 Ga0501034_0003885 3300049571 Bacteria 16815
469 Ga0501034_0029278 3300049571 Bacteria 5597
470 Ga0501034_0144853 3300049571 Bacteria 2353
471 Ga0501034_0208241 3300049571 Bacteria 1911
472 Ga0501034_0454368 3300049571 Bacteria 1198
473 Ga0501036_0163756 3300049572 Bacteria 1875
474 Ga0501037_0020022 3300049573 Bacteria 4940
475 Ga0501038_0011338 3300049574 Bacteria 8137
476 Ga0501039_0107136 3300049575 Bacteria 2183
477 Ga0501043_0007910 3300049579 Bacteria 8403
478 Ga0501043_0451399 3300049579 Bacteria 966
479 Ga0501047_0015122 3300049581 Bacteria 7347
480 Ga0501047_0030526 3300049581 Bacteria 5195
481 Ga0501047_0198906 3300049581 Bacteria 1865
482 Ga0501048_0178731 3300049582 Bacteria 1504
483 Ga0501067_0101575 3300049583 Bacteria 1598
484 Ga0501068_0024364 3300049584 Bacteria 3553
485 Ga0501070_0068775 3300049586 Bacteria 2932
486 Ga0501073_0026132 3300049589 Bacteria 4183
487 Ga0501074_0091165 3300049590 Bacteria 2183
488 Ga0501252_002308 3300049682 Bacteria 1882
489 Ga0501080_0010363 3300049742 Bacteria 8524
490 Ga0501080_0488402 3300049742 Bacteria 1101
491 Ga0501083_0060709 3300049744 Bacteria 2525
492 Ga0501083_0118090 3300049744 Bacteria 1740
493 Ga0501035_0022655 3300049822 Bacteria 5770
494 Ga0501044_0040451 3300049823 Bacteria 4859
495 Ga0501044_0280972 3300049823 Bacteria 1598
496 nmdc:mga03683_29007_c1 3300050489 Bacteria 2204
497 nmdc:mga03n38_44650_c1 3300050490 Bacteria 1948
498 nmdc:mga0k408_21731_c1 3300050493 Bacteria 3607
499 nmdc:mga06z11_279263_c1 3300050494 Bacteria 989
500 nmdc:mga06z11_97599_c1 3300050494 Bacteria 1606
501 nmdc:mga04h51_85247_c1 3300050495 Bacteria 1128
502 nmdc:mga05p37_146175_c1 3300050507 Bacteria 2895
503 nmdc:mga05p37_56563_c1 3300050507 Bacteria 4830
504 nmdc:mga05p37_59426_c1 3300050507 Bacteria 4708
505 nmdc:mga09592_238893_c2 3300050508 Bacteria 1219
506 nmdc:mga09592_655680_c1 3300050508 Bacteria 896
507 nmdc:mga0qj67_162110_c1 3300050509 Bacteria 1815
508 nmdc:mga06r32_1498709_c1 3300050510 Bacteria 615
509 nmdc:mga08y16_1024065_c1 3300050511 Bacteria 804
510 nmdc:mga08y16_478413_c1 3300050511 Bacteria 1267
511 nmdc:mga08y16_558908_c1 3300050511 Bacteria 1157
512 nmdc:mga0n895_196577_c1 3300050512 Bacteria 2048
513 nmdc:mga0n895_248831_c1 3300050512 Bacteria 1804
514 nmdc:mga0rr50_181482_c1 3300050513 Bacteria 1721
515 nmdc:mga0rr50_781839_c1 3300050513 Bacteria 815
516 nmdc:mga08x19_399929_c1 3300050514 Bacteria 963
517 nmdc:mga0a205_261337_c1 3300050515 Bacteria 1609
518 nmdc:mga0a205_540683_c1 3300050515 Bacteria 1021
519 Ga0495601_0046194 3300053077 Bacteria 2741
520 Ga0495601_0307652 3300053077 Bacteria 1032
521 Ga0500647_0151008 3300053091 Bacteria 1084
522 Ga0500595_011376 3300053119 Bacteria 3488
523 Ga0500590_026672 3300053148 Bacteria 2997
524 Ga0500616_0000603 3300053153 Bacteria 43497
525 Ga0500645_000048 3300053730 Bacteria 103273
526 Ga0501084_0584757 3300054114 Bacteria 944

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1313259 Ga0436363_1313259_410_949 151
2 3300046679 Ga0495623_0539284 Ga0495623_0539284_120_596 151
3 3300035241 Ga0373961_0336987 Ga0373961_0336987_12_485 155
4 3300035410 Ga0373924_0481826 Ga0373924_0481826_33_527 162
5 3300038996 Ga0242420_099384 Ga0242420_099384_104_598 162
6 3300048909 Ga0496106_0667518 Ga0496106_0667518_285_806 162
7 3300050509 nmdc:mga0qj67_162110_c1 nmdc:mga0qj67_162110_c1_516_1010 162
8 3300042876 Ga0451577_0641786 Ga0451577_0641786_399_899 163
9 3300013306 Ga0163162_10041652 Ga0163162_100416523 168
10 3300037466 Ga0395898_0139449 Ga0395898_0139449_1550_2071 169
11 3300035691 Ga0373931_0148654 Ga0373931_0148654_137_679 172
12 3300005295 Ga0065707_10215091 Ga0065707_102150911 175
13 3300005336 Ga0070680_100814740 Ga0070680_1008147401 175
14 3300005353 Ga0070669_100218668 Ga0070669_1002186681 175
15 3300005458 Ga0070681_10697805 Ga0070681_106978052 175
16 3300005535 Ga0070684_100561707 Ga0070684_1005617072 175
17 3300005843 Ga0068860_101524486 Ga0068860_1015244862 175
18 3300006173 Ga0070716_100476996 Ga0070716_1004769961 175
19 3300006844 Ga0075428_100636678 Ga0075428_1006366782 175
20 3300006846 Ga0075430_100240608 Ga0075430_1002406082 175
21 3300006847 Ga0075431_100396136 Ga0075431_1003961362 175
22 3300006852 Ga0075433_10077157 Ga0075433_100771573 175
23 3300006852 Ga0075433_10231541 Ga0075433_102315412 175
24 3300006871 Ga0075434_100127256 Ga0075434_1001272563 175
25 3300006871 Ga0075434_100168759 Ga0075434_1001687591 175
26 3300006880 Ga0075429_100724610 Ga0075429_1007246101 175
27 3300006914 Ga0075436_100242896 Ga0075436_1002428962 175
28 3300007076 Ga0075435_100476687 Ga0075435_1004766872 175
29 3300009094 Ga0111539_10317799 Ga0111539_103177992 175
30 3300009147 Ga0114129_10053597 Ga0114129_100535974 175
31 3300009147 Ga0114129_10101997 Ga0114129_101019974 175
32 3300009176 Ga0105242_11058973 Ga0105242_110589731 175
33 3300009177 Ga0105248_10304508 Ga0105248_103045082 175
34 3300013308 Ga0157375_10980136 Ga0157375_109801361 175
35 3300014968 Ga0157379_10786355 Ga0157379_107863551 175
36 3300025917 Ga0207660_10667758 Ga0207660_106677581 175
37 3300025941 Ga0207711_10771593 Ga0207711_107715931 175
38 3300035086 Ga0373934_0163697 Ga0373934_0163697_305_838 175
39 3300035172 Ga0373955_0451953 Ga0373955_0451953_112_645 175
40 3300035691 Ga0373931_0616099 Ga0373931_0616099_154_687 175
41 3300036401 Ga0373937_1257105 Ga0373937_1257105_80_613 175
42 3300045051 Ga0451576_1137445 Ga0451576_1137445_13_546 175
43 3300046511 Ga0495608_0459800 Ga0495608_0459800_76_609 175
44 3300046536 Ga0495587_0373384 Ga0495587_0373384_50_583 175
45 3300046558 Ga0495633_0291110 Ga0495633_0291110_66_599 175
46 3300046664 Ga0495659_0161391 Ga0495659_0161391_348_881 175
47 3300047318 Ga0495636_0052449 Ga0495636_0052449_1160_1693 175
48 3300050507 nmdc:mga05p37_146175_c1 nmdc:mga05p37_146175_c1_1948_2481 175
49 3300050507 nmdc:mga05p37_56563_c1 nmdc:mga05p37_56563_c1_2313_2846 175
50 3300050507 nmdc:mga05p37_59426_c1 nmdc:mga05p37_59426_c1_1276_1809 175
51 3300050508 nmdc:mga09592_238893_c2 nmdc:mga09592_238893_c2_65_598 175
52 3300050508 nmdc:mga09592_655680_c1 nmdc:mga09592_655680_c1_122_655 175
53 3300050510 nmdc:mga06r32_1498709_c1 nmdc:mga06r32_1498709_c1_39_572 175
54 3300050511 nmdc:mga08y16_558908_c1 nmdc:mga08y16_558908_c1_398_931 175
55 3300050512 nmdc:mga0n895_196577_c1 nmdc:mga0n895_196577_c1_877_1410 175
56 3300050512 nmdc:mga0n895_248831_c1 nmdc:mga0n895_248831_c1_582_1115 175
57 3300050513 nmdc:mga0rr50_181482_c1 nmdc:mga0rr50_181482_c1_335_868 175
58 3300050513 nmdc:mga0rr50_781839_c1 nmdc:mga0rr50_781839_c1_63_596 175
59 3300050514 nmdc:mga08x19_399929_c1 nmdc:mga08x19_399929_c1_153_686 175
60 3300050515 nmdc:mga0a205_261337_c1 nmdc:mga0a205_261337_c1_904_1437 175
61 3300050515 nmdc:mga0a205_540683_c1 nmdc:mga0a205_540683_c1_124_657 175
62 3300046501 Ga0495607_0419986 Ga0495607_0419986_13_543 176
63 3300047318 Ga0495636_0385839 Ga0495636_0385839_84_650 180
64 3300005841 Ga0068863_101495169 Ga0068863_1014951691 181
65 3300025912 Ga0207707_10785228 Ga0207707_107852282 181
66 3300025960 Ga0207651_11034254 Ga0207651_110342541 181
67 3300031727 Ga0316576_10698563 Ga0316576_106985631 181
68 3300046471 Ga0495650_0034988 Ga0495650_0034988_46_624 181
69 3300046535 Ga0495586_0489443 Ga0495586_0489443_26_586 181
70 3300046684 Ga0495669_0390043 Ga0495669_0390043_33_593 181
71 3300005356 Ga0070674_100052636 Ga0070674_1000526363 182
72 3300005364 Ga0070673_100150943 Ga0070673_1001509431 182
73 3300005456 Ga0070678_101012649 Ga0070678_1010126491 182
74 3300005548 Ga0070665_100303922 Ga0070665_1003039222 182
75 3300006353 Ga0075370_10032793 Ga0075370_100327933 183
76 3300025904 Ga0207647_10025467 Ga0207647_100254673 183
77 3300050489 nmdc:mga03683_29007_c1 nmdc:mga03683_29007_c1_1597_2172 183
78 3300050490 nmdc:mga03n38_44650_c1 nmdc:mga03n38_44650_c1_1203_1778 183
79 3300050493 nmdc:mga0k408_21731_c1 nmdc:mga0k408_21731_c1_1200_1775 183
80 3300050494 nmdc:mga06z11_97599_c1 nmdc:mga06z11_97599_c1_510_1085 183
81 3300002075 JGI24738J21930_10001268 JGI24738J21930_100012683 185
82 3300014497 Ga0182008_10026033 Ga0182008_100260332 185
83 3300046507 Ga0495606_0080382 Ga0495606_0080382_1193_1816 185
84 3300049571 Ga0501034_0144853 Ga0501034_0144853_1715_2296 185
85 3300049571 Ga0501034_0454368 Ga0501034_0454368_560_1141 185
86 3300049579 Ga0501043_0451399 Ga0501043_0451399_220_801 185
87 3300049581 Ga0501047_0198906 Ga0501047_0198906_1091_1672 185
88 3300013105 Ga0157369_10214911 Ga0157369_102149111 186
89 3300046500 Ga0495596_0034101 Ga0495596_0034101_89_712 186
90 3300048920 Ga0496117_0031181 Ga0496117_0031181_748_1371 186
91 3300048921 Ga0496118_0011851 Ga0496118_0011851_4722_5345 186
92 3300005471 Ga0070698_100021013 Ga0070698_1000210135 187
93 3300005518 Ga0070699_100003337 Ga0070699_10000333710 187
94 3300025914 Ga0207671_10013631 Ga0207671_100136315 187
95 3300025922 Ga0207646_11073116 Ga0207646_110731162 187
96 3300028381 Ga0268264_10378075 Ga0268264_103780752 187
97 3300031507 Ga0307509_10006490 Ga0307509_1000649010 187
98 3300031730 Ga0307516_10235896 Ga0307516_102358962 187
99 3300048907 Ga0496104_0059994 Ga0496104_0059994_2077_2706 187
100 3300049581 Ga0501047_0030526 Ga0501047_0030526_547_1158 187
101 3300053730 Ga0500645_000048 Ga0500645_000048_35837_36505 187
102 iso_pu_bacteria 2508501125 2509129267 187
103 3300031616 Ga0307508_10000108 Ga0307508_100001081 188
104 3300035171 Ga0373946_0349325 Ga0373946_0349325_90_665 188
105 3300042876 Ga0451577_0001798 Ga0451577_0001798_10194_10775 188
106 3300042876 Ga0451577_0004743 Ga0451577_0004743_10214_10795 188
107 3300044712 Ga0453684_0050546 Ga0453684_0050546_3000_3581 188
108 iso_pu_bacteria 2744054900 2746086511 188
109 iso_pu_bacteria 2744054901 2746093910 188
110 iso_pu_bacteria 2842324504 2842328863 188
111 iso_pu_bacteria 2842348783 2842353718 188
112 iso_pu_bacteria 2842454564 2842459194 188
113 3300003756 Ga0055533_1000175 Ga0055533_10001759 189
114 3300003756 Ga0055533_1000234 Ga0055533_100023414 189
115 3300003856 Ga0058692_1020413 Ga0058692_10204132 189
116 3300009551 Ga0105238_10252943 Ga0105238_102529432 189
117 3300020081 Ga0206354_11182836 Ga0206354_111828362 189
118 3300025226 Ga0209674_100017 Ga0209674_100017157 189
119 3300025226 Ga0209674_100085 Ga0209674_10008564 189
120 3300025913 Ga0207695_10321335 Ga0207695_103213352 189
121 3300025945 Ga0207679_10190530 Ga0207679_101905302 189
122 3300027312 Ga0209371_1002008 Ga0209371_10020086 189
123 3300030500 Ga0268256_1001757 Ga0268256_10017573 189
124 3300037418 Ga0395900_0041674 Ga0395900_0041674_1488_2075 189
125 3300038443 Ga0395901_0037001 Ga0395901_0037001_1916_2503 189
126 3300053153 Ga0500616_0000603 Ga0500616_0000603_27277_27909 189
127 3300003758 Ga0055532_1000031 Ga0055532_1000031216 190
128 3300003760 Ga0055527_1000020 Ga0055527_1000020216 190
129 3300003761 Ga0055535_1000023 Ga0055535_10000233 190
130 3300003762 Ga0055542_1000035 Ga0055542_1000035216 190
131 3300003763 Ga0055529_1000039 Ga0055529_10000393 190
132 3300005327 Ga0070658_10237045 Ga0070658_102370452 190
133 3300005329 Ga0070683_100147792 Ga0070683_1001477922 190
134 3300005339 Ga0070660_100886136 Ga0070660_1008861361 190
135 3300005344 Ga0070661_100311382 Ga0070661_1003113822 190
136 3300005366 Ga0070659_100114744 Ga0070659_1001147442 190
137 3300005535 Ga0070684_100155033 Ga0070684_1001550332 190
138 3300005539 Ga0068853_100762296 Ga0068853_1007622961 190
139 3300005563 Ga0068855_100104012 Ga0068855_1001040124 190
140 3300005563 Ga0068855_100709611 Ga0068855_1007096111 190
141 3300005564 Ga0070664_100131617 Ga0070664_1001316172 190
142 3300005614 Ga0068856_100072329 Ga0068856_1000723294 190
143 3300005616 Ga0068852_100120901 Ga0068852_1001209012 190
144 3300013105 Ga0157369_10261033 Ga0157369_102610332 190
145 3300013307 Ga0157372_10150560 Ga0157372_101505602 190
146 3300025228 Ga0209672_100001 Ga0209672_1000012094 190
147 3300025229 Ga0209147_100001 Ga0209147_1000012094 190
148 3300025242 Ga0209258_100001 Ga0209258_1000012094 190
149 3300025254 Ga0209148_1000003 Ga0209148_10000032094 190
150 3300025272 Ga0209455_1000001 Ga0209455_10000012094 190
151 3300025911 Ga0207654_10435032 Ga0207654_104350322 190
152 3300025924 Ga0207694_10642357 Ga0207694_106423572 190
153 3300025932 Ga0207690_10383583 Ga0207690_103835832 190
154 3300025944 Ga0207661_10016764 Ga0207661_100167645 190
155 3300025949 Ga0207667_10354487 Ga0207667_103544872 190
156 3300026035 Ga0207703_10552631 Ga0207703_105526311 190
157 3300026041 Ga0207639_10280476 Ga0207639_102804762 190
158 3300026078 Ga0207702_10295357 Ga0207702_102953572 190
159 3300026142 Ga0207698_10330091 Ga0207698_103300912 190
160 3300042876 Ga0451577_0892657 Ga0451577_0892657_207_785 190
161 3300045051 Ga0451576_0099519 Ga0451576_0099519_1023_1640 190
162 3300046507 Ga0495606_0016303 Ga0495606_0016303_3652_4287 190
163 3300047323 Ga0495683_0009400 Ga0495683_0009400_478_1113 190
164 3300047443 Ga0495687_036872 Ga0495687_036872_655_1290 190
165 3300048091 Ga0495626_0032791 Ga0495626_0032791_971_1606 190
166 3300049742 Ga0501080_0488402 Ga0501080_0488402_499_1080 190
167 3300049744 Ga0501083_0060709 Ga0501083_0060709_1194_1775 190
168 3300054114 Ga0501084_0584757 Ga0501084_0584757_232_813 190
169 iso_pu_bacteria 2513237151 2513959347 190
170 iso_pu_bacteria 2526164713 2527080162 190
171 iso_pu_bacteria 2738541296 2738822363 190
172 iso_pu_bacteria 2738541298 2738835820 190
173 iso_pu_bacteria 2738541306 2738876049 190
174 iso_pu_bacteria 2738543002 2739188001 190
175 iso_pu_bacteria 2738543008 2739222647 190
176 iso_pu_bacteria 2900634093 2900636565 190
177 iso_pu_bacteria 2945934425 2945935071 190
178 iso_pu_bacteria 2990703756 2990704337 190
179 iso_pu_bacteria 641736151 642422490 190
180 iso_pu_bacteria 642555113 642619975 190
181 3300001979 JGI24740J21852_10003389 JGI24740J21852_100033893 191
182 3300005339 Ga0070660_100970553 Ga0070660_1009705531 191
183 3300031730 Ga0307516_10000908 Ga0307516_1000090821 191
184 3300046529 Ga0495652_0100723 Ga0495652_0100723_455_1063 191
185 3300053148 Ga0500590_026672 Ga0500590_026672_1852_2445 191
186 iso_pu_bacteria 2857537821 2857538916 191
187 iso_pu_bacteria 8055301274 8055304223 191
188 3300002244 JGI24742J22300_10007474 JGI24742J22300_100074742 192
189 3300005548 Ga0070665_100162598 Ga0070665_1001625982 192
190 3300005843 Ga0068860_100000433 Ga0068860_10000043320 192
191 3300028381 Ga0268264_10000062 Ga0268264_1000006267 192
192 3300031507 Ga0307509_10220729 Ga0307509_102207292 192
193 3300031548 Ga0307408_100005169 Ga0307408_1000051696 192
194 3300031903 Ga0307407_10163530 Ga0307407_101635301 192
195 3300031995 Ga0307409_100529907 Ga0307409_1005299071 192
196 3300046471 Ga0495650_0026693 Ga0495650_0026693_517_1134 192
197 iso_pu_bacteria 2818991450 2819625183 192
198 iso_pu_bacteria 2928108538 2928109357 192
199 iso_pu_bacteria 2928135762 2928137189 192
200 iso_pu_bacteria 2928503688 2928509888 192
201 iso_pu_bacteria 8055266321 8055268024 192
202 3300014968 Ga0157379_10045233 Ga0157379_100452333 193
203 3300039062 Ga0400483_217610 Ga0400483_217610_144_752 193
204 3300039093 Ga0400489_18479 Ga0400489_18479_1235_1843 193
205 3300050511 nmdc:mga08y16_1024065_c1 nmdc:mga08y16_1024065_c1_95_697 193
206 3300002705 JGI25156J39149_1002719 JGI25156J39149_10027194 194
207 3300002705 JGI25156J39149_1004311 JGI25156J39149_10043111 194
208 3300003756 Ga0055533_1004342 Ga0055533_10043421 194
209 3300005455 Ga0070663_100064656 Ga0070663_1000646562 194
210 3300014325 Ga0163163_10027358 Ga0163163_100273584 194
211 3300021388 Ga0213875_10002701 Ga0213875_100027017 194
212 3300025226 Ga0209674_100143 Ga0209674_10014360 194
213 3300025256 Ga0209759_1000092 Ga0209759_1000092152 194
214 3300025256 Ga0209759_1000200 Ga0209759_10002005 194
215 3300031249 Ga0265339_10000627 Ga0265339_100006278 194
216 3300031250 Ga0265331_10076029 Ga0265331_100760292 194
217 3300031595 Ga0265313_10094128 Ga0265313_100941281 194
218 3300031711 Ga0265314_10001008 Ga0265314_1000100824 194
219 3300031712 Ga0265342_10043832 Ga0265342_100438324 194
220 3300031911 Ga0307412_10000014 Ga0307412_10000014299 194
221 3300037853 Ga0436364_0567892 Ga0436364_0567892_6284_6904 194
222 3300046457 Ga0495590_0025822 Ga0495590_0025822_1159_1773 194
223 3300046459 Ga0495629_0000034 Ga0495629_0000034_75332_75946 194
224 3300046460 Ga0495638_0015393 Ga0495638_0015393_2156_2770 194
225 3300046462 Ga0495651_0104894 Ga0495651_0104894_845_1459 194
226 3300046463 Ga0495653_0001766 Ga0495653_0001766_9334_9948 194
227 3300046471 Ga0495650_0019198 Ga0495650_0019198_2256_2870 194
228 3300046472 Ga0495580_0006375 Ga0495580_0006375_4925_5539 194
229 3300046472 Ga0495580_0007438 Ga0495580_0007438_2669_3283 194
230 3300046474 Ga0495605_0002834 Ga0495605_0002834_8839_9453 194
231 3300046477 Ga0495664_0069254 Ga0495664_0069254_399_1013 194
232 3300046491 Ga0495584_0170052 Ga0495584_0170052_357_971 194
233 3300046491 Ga0495584_0349168 Ga0495584_0349168_27_656 194
234 3300046506 Ga0495583_0003116 Ga0495583_0003116_664_1278 194
235 3300046507 Ga0495606_0018047 Ga0495606_0018047_3199_3813 194
236 3300046514 Ga0495618_0121028 Ga0495618_0121028_1027_1641 194
237 3300046515 Ga0495620_0003580 Ga0495620_0003580_3534_4148 194
238 3300046516 Ga0495628_0009315 Ga0495628_0009315_4719_5333 194
239 3300046517 Ga0495630_0092904 Ga0495630_0092904_1001_1615 194
240 3300046522 Ga0495643_0092994 Ga0495643_0092994_642_1271 194
241 3300046528 Ga0495642_0020732 Ga0495642_0020732_1895_2524 194
242 3300046531 Ga0495665_0038461 Ga0495665_0038461_926_1540 194
243 3300046542 Ga0495597_0006041 Ga0495597_0006041_5433_6062 194
244 3300046616 Ga0495668_0203386 Ga0495668_0203386_366_995 194
245 3300046665 Ga0495661_0007205 Ga0495661_0007205_7025_7654 194
246 3300046665 Ga0495661_0036075 Ga0495661_0036075_508_1122 194
247 3300046680 Ga0495646_0037504 Ga0495646_0037504_1090_1704 194
248 3300046689 Ga0495613_0020732 Ga0495613_0020732_1117_1731 194
249 3300046690 Ga0495624_0002128 Ga0495624_0002128_13061_13675 194
250 3300046690 Ga0495624_0030098 Ga0495624_0030098_951_1565 194
251 3300046694 Ga0495649_0080110 Ga0495649_0080110_501_1115 194
252 3300047317 Ga0495604_0011449 Ga0495604_0011449_2716_3342 194
253 3300047319 Ga0495674_0044070 Ga0495674_0044070_1480_2094 194
254 3300047319 Ga0495674_0048296 Ga0495674_0048296_1875_2489 194
255 3300047320 Ga0495672_0083459 Ga0495672_0083459_244_858 194
256 3300047321 Ga0495676_0184178 Ga0495676_0184178_197_811 194
257 3300047322 Ga0495680_0109607 Ga0495680_0109607_270_896 194
258 3300047323 Ga0495683_0019979 Ga0495683_0019979_58_672 194
259 3300047446 Ga0495679_000007 Ga0495679_000007_300009_300623 194
260 3300047472 Ga0495686_0042021 Ga0495686_0042021_1593_2207 194
261 3300047472 Ga0495686_0105577 Ga0495686_0105577_34_648 194
262 3300047673 Ga0495593_0018774 Ga0495593_0018774_1395_2009 194
263 3300048088 Ga0495602_0092287 Ga0495602_0092287_1038_1652 194
264 3300048088 Ga0495602_0122177 Ga0495602_0122177_785_1399 194
265 3300048091 Ga0495626_0020272 Ga0495626_0020272_2115_2729 194
266 3300048920 Ga0496117_0124745 Ga0496117_0124745_270_884 194
267 3300048921 Ga0496118_0019093 Ga0496118_0019093_1654_2268 194
268 3300048929 Ga0496126_0310018 Ga0496126_0310018_613_1227 194
269 3300049459 Ga0495678_011639 Ga0495678_011639_18_632 194
270 3300049569 Ga0501032_0100351 Ga0501032_0100351_128_736 194
271 3300049571 Ga0501034_0208241 Ga0501034_0208241_695_1303 194
272 3300049572 Ga0501036_0163756 Ga0501036_0163756_779_1387 194
273 3300049573 Ga0501037_0020022 Ga0501037_0020022_2720_3328 194
274 3300049574 Ga0501038_0011338 Ga0501038_0011338_5476_6084 194
275 3300049575 Ga0501039_0107136 Ga0501039_0107136_154_762 194
276 3300049579 Ga0501043_0007910 Ga0501043_0007910_406_1014 194
277 3300049581 Ga0501047_0015122 Ga0501047_0015122_1549_2157 194
278 3300049582 Ga0501048_0178731 Ga0501048_0178731_850_1458 194
279 3300049583 Ga0501067_0101575 Ga0501067_0101575_695_1303 194
280 3300049586 Ga0501070_0068775 Ga0501070_0068775_1848_2456 194
281 3300049589 Ga0501073_0026132 Ga0501073_0026132_2551_3159 194
282 3300049590 Ga0501074_0091165 Ga0501074_0091165_1016_1624 194
283 3300049742 Ga0501080_0010363 Ga0501080_0010363_6254_6862 194
284 3300049744 Ga0501083_0118090 Ga0501083_0118090_183_791 194
285 3300049822 Ga0501035_0022655 Ga0501035_0022655_740_1348 194
286 3300049823 Ga0501044_0280972 Ga0501044_0280972_360_968 194
287 3300053091 Ga0500647_0151008 Ga0500647_0151008_167_790 194
288 3300053119 Ga0500595_011376 Ga0500595_011376_2259_2870 194
289 iso_pu_bacteria 2904483920 2904488382 194
290 iso_pu_bacteria 2919527303 2919531998 194
291 3300007788 Ga0099795_10002946 Ga0099795_100029463 195
292 3300010159 Ga0099796_10004984 Ga0099796_100049843 195
293 3300044694 Ga0466963_0073993 Ga0466963_0073993_1378_1995 195
294 3300049571 Ga0501034_0003885 Ga0501034_0003885_6247_6864 195
295 3300049571 Ga0501034_0029278 Ga0501034_0029278_3861_4475 195
296 3300049584 Ga0501068_0024364 Ga0501068_0024364_1356_1973 195
297 3300049823 Ga0501044_0040451 Ga0501044_0040451_1461_2078 195
298 3300001989 JGI24739J22299_10002488 JGI24739J22299_100024883 196
299 3300001989 JGI24739J22299_10016174 JGI24739J22299_100161742 196
300 3300002067 JGI24735J21928_10036658 JGI24735J21928_100366582 196
301 3300005367 Ga0070667_100049175 Ga0070667_1000491752 196
302 3300009011 Ga0105251_10000269 Ga0105251_100002693 196
303 3300009011 Ga0105251_10063827 Ga0105251_100638272 196
304 3300013105 Ga0157369_10252038 Ga0157369_102520382 196
305 3300015262 Ga0182007_10002279 Ga0182007_100022794 196
306 3300025735 Ga0207713_1000435 Ga0207713_100043540 196
307 3300025735 Ga0207713_1105724 Ga0207713_11057242 196
308 3300025904 Ga0207647_10012684 Ga0207647_100126843 196
309 3300025904 Ga0207647_10059672 Ga0207647_100596722 196
310 3300041404 Ga0439436_0051993 Ga0439436_0051993_361_1014 196
311 3300046454 Ga0495592_0118473 Ga0495592_0118473_531_1157 196
312 3300046459 Ga0495629_0007389 Ga0495629_0007389_140_766 196
313 3300046461 Ga0495641_0027950 Ga0495641_0027950_1154_1780 196
314 3300046463 Ga0495653_0083128 Ga0495653_0083128_268_894 196
315 3300046471 Ga0495650_0019002 Ga0495650_0019002_1610_2236 196
316 3300046473 Ga0495582_0015387 Ga0495582_0015387_3354_3980 196
317 3300046477 Ga0495664_0009482 Ga0495664_0009482_1139_1765 196
318 3300046477 Ga0495664_0123795 Ga0495664_0123795_498_1133 196
319 3300046514 Ga0495618_0050693 Ga0495618_0050693_1565_2191 196
320 3300046516 Ga0495628_0212788 Ga0495628_0212788_322_957 196
321 3300046517 Ga0495630_0056510 Ga0495630_0056510_1490_2116 196
322 3300046526 Ga0495666_0026793 Ga0495666_0026793_1405_2031 196
323 3300046529 Ga0495652_0005229 Ga0495652_0005229_7647_8273 196
324 3300046533 Ga0495640_0026178 Ga0495640_0026178_1566_2192 196
325 3300046543 Ga0495645_0088887 Ga0495645_0088887_824_1450 196
326 3300046559 Ga0495667_0069190 Ga0495667_0069190_318_944 196
327 3300046642 Ga0495634_0014874 Ga0495634_0014874_1319_1945 196
328 3300046675 Ga0495657_0015754 Ga0495657_0015754_3871_4497 196
329 3300046679 Ga0495623_0014711 Ga0495623_0014711_748_1374 196
330 3300046680 Ga0495646_0010051 Ga0495646_0010051_1392_2018 196
331 3300046689 Ga0495613_0168259 Ga0495613_0168259_82_708 196
332 3300046794 Ga0495589_0092619 Ga0495589_0092619_10_636 196
333 3300047319 Ga0495674_0121251 Ga0495674_0121251_145_771 196
334 3300047322 Ga0495680_0034306 Ga0495680_0034306_520_1146 196
335 3300047323 Ga0495683_0023754 Ga0495683_0023754_1108_1734 196
336 3300047471 Ga0495684_0191113 Ga0495684_0191113_181_807 196
337 3300047673 Ga0495593_0091952 Ga0495593_0091952_648_1274 196
338 3300048088 Ga0495602_0162456 Ga0495602_0162456_621_1256 196
339 3300048089 Ga0495614_0005607 Ga0495614_0005607_1381_2007 196
340 3300048921 Ga0496118_0021529 Ga0496118_0021529_3797_4426 196
341 3300002067 JGI24735J21928_10022697 JGI24735J21928_100226972 197
342 3300002705 JGI25156J39149_1001787 JGI25156J39149_10017874 197
343 3300003214 JGI25165J46597_1001807 JGI25165J46597_10018072 197
344 3300025231 Ga0207427_101362 Ga0207427_1013624 197
345 3300025256 Ga0209759_1000037 Ga0209759_100003790 197
346 3300025261 Ga0209233_1000123 Ga0209233_10001233 197
347 3300031595 Ga0265313_10009581 Ga0265313_100095814 197
348 3300046459 Ga0495629_0001013 Ga0495629_0001013_9974_10603 197
349 3300046462 Ga0495651_0007769 Ga0495651_0007769_3453_4073 197
350 3300046462 Ga0495651_0252380 Ga0495651_0252380_438_1067 197
351 3300046463 Ga0495653_0146215 Ga0495653_0146215_555_1184 197
352 3300046471 Ga0495650_0001635 Ga0495650_0001635_11696_12325 197
353 3300046472 Ga0495580_0004501 Ga0495580_0004501_10322_10951 197
354 3300046476 Ga0495662_0062221 Ga0495662_0062221_67_696 197
355 3300046501 Ga0495607_0205520 Ga0495607_0205520_252_881 197
356 3300046511 Ga0495608_0149753 Ga0495608_0149753_333_953 197
357 3300046513 Ga0495616_0161638 Ga0495616_0161638_301_930 197
358 3300046517 Ga0495630_0208177 Ga0495630_0208177_451_1080 197
359 3300046520 Ga0495637_0056139 Ga0495637_0056139_810_1421 197
360 3300046528 Ga0495642_0001699 Ga0495642_0001699_4008_4637 197
361 3300046529 Ga0495652_0054217 Ga0495652_0054217_356_976 197
362 3300046530 Ga0495654_0082615 Ga0495654_0082615_691_1320 197
363 3300046531 Ga0495665_0022320 Ga0495665_0022320_1949_2578 197
364 3300046543 Ga0495645_0001014 Ga0495645_0001014_11693_12322 197
365 3300046674 Ga0495588_0010689 Ga0495588_0010689_1267_1896 197
366 3300046679 Ga0495623_0013794 Ga0495623_0013794_3323_3943 197
367 3300046680 Ga0495646_0024779 Ga0495646_0024779_2081_2710 197
368 3300046684 Ga0495669_0013198 Ga0495669_0013198_2464_3093 197
369 3300046689 Ga0495613_0024240 Ga0495613_0024240_2727_3356 197
370 3300046794 Ga0495589_0003147 Ga0495589_0003147_7166_7795 197
371 3300047315 Ga0495581_0000534 Ga0495581_0000534_6826_7455 197
372 3300047673 Ga0495593_0118670 Ga0495593_0118670_52_681 197
373 3300048088 Ga0495602_0157194 Ga0495602_0157194_27_641 197
374 3300048089 Ga0495614_0006617 Ga0495614_0006617_3282_3911 197
375 3300048904 Ga0496101_0097176 Ga0496101_0097176_913_1542 197
376 3300053077 Ga0495601_0307652 Ga0495601_0307652_279_899 197
377 3300031242 Ga0265329_10003505 Ga0265329_100035054 199
378 3300031344 Ga0265316_10086153 Ga0265316_100861533 199
379 3300031711 Ga0265314_10001100 Ga0265314_1000110025 199
380 3300041452 Ga0451793_0087511 Ga0451793_0087511_1609_2271 199
381 3300041456 Ga0451795_0039163 Ga0451795_0039163_104_724 199
382 3300046542 Ga0495597_0071108 Ga0495597_0071108_866_1477 199
383 3300048090 Ga0495615_0110179 Ga0495615_0110179_49_675 199
384 3300031251 Ga0265327_10158143 Ga0265327_101581431 200
385 3300048924 Ga0496121_0228385 Ga0496121_0228385_51_761 200
386 3300031852 Ga0307410_10340616 Ga0307410_103406162 201
387 3300046530 Ga0495654_0001638 Ga0495654_0001638_3888_4577 201
388 3300049682 Ga0501252_002308 Ga0501252_002308_1024_1638 201
389 3300001977 JGI24746J21847_1023768 JGI24746J21847_10237682 203
390 3300001991 JGI24743J22301_10003100 JGI24743J22301_100031001 203
391 3300002075 JGI24738J21930_10052018 JGI24738J21930_100520181 203
392 3300002077 JGI24744J21845_10007709 JGI24744J21845_100077092 203
393 3300002239 JGI24034J26672_10037608 JGI24034J26672_100376081 203
394 3300002244 JGI24742J22300_10008907 JGI24742J22300_100089072 203
395 3300005328 Ga0070676_10405462 Ga0070676_104054621 203
396 3300005329 Ga0070683_100161802 Ga0070683_1001618021 203
397 3300005330 Ga0070690_100212432 Ga0070690_1002124322 203
398 3300005331 Ga0070670_100404367 Ga0070670_1004043671 203
399 3300005334 Ga0068869_100056254 Ga0068869_1000562542 203
400 3300005337 Ga0070682_100633974 Ga0070682_1006339741 203
401 3300005338 Ga0068868_100008027 Ga0068868_1000080276 203
402 3300005339 Ga0070660_100169685 Ga0070660_1001696852 203
403 3300005340 Ga0070689_100128639 Ga0070689_1001286392 203
404 3300005341 Ga0070691_10057024 Ga0070691_100570241 203
405 3300005343 Ga0070687_100013129 Ga0070687_1000131291 203
406 3300005344 Ga0070661_100228110 Ga0070661_1002281102 203
407 3300005345 Ga0070692_10023724 Ga0070692_100237243 203
408 3300005347 Ga0070668_100086182 Ga0070668_1000861822 203
409 3300005353 Ga0070669_100469581 Ga0070669_1004695812 203
410 3300005354 Ga0070675_100033460 Ga0070675_1000334603 203
411 3300005356 Ga0070674_100491397 Ga0070674_1004913972 203
412 3300005364 Ga0070673_100023147 Ga0070673_1000231472 203
413 3300005365 Ga0070688_100040057 Ga0070688_1000400572 203
414 3300005366 Ga0070659_100108405 Ga0070659_1001084051 203
415 3300005367 Ga0070667_100021215 Ga0070667_1000212155 203
416 3300005436 Ga0070713_100083972 Ga0070713_1000839722 203
417 3300005437 Ga0070710_10088465 Ga0070710_100884652 203
418 3300005438 Ga0070701_10005793 Ga0070701_100057933 203
419 3300005439 Ga0070711_100052070 Ga0070711_1000520702 203
420 3300005441 Ga0070700_100098643 Ga0070700_1000986431 203
421 3300005444 Ga0070694_100457517 Ga0070694_1004575171 203
422 3300005455 Ga0070663_100142424 Ga0070663_1001424243 203
423 3300005456 Ga0070678_100045543 Ga0070678_1000455432 203
424 3300005457 Ga0070662_100091612 Ga0070662_1000916121 203
425 3300005459 Ga0068867_100007166 Ga0068867_1000071665 203
426 3300005466 Ga0070685_10000890 Ga0070685_100008908 203
427 3300005539 Ga0068853_100066529 Ga0068853_1000665294 203
428 3300005543 Ga0070672_100027998 Ga0070672_1000279984 203
429 3300005546 Ga0070696_100308722 Ga0070696_1003087221 203
430 3300005547 Ga0070693_100332959 Ga0070693_1003329592 203
431 3300005548 Ga0070665_100367337 Ga0070665_1003673372 203
432 3300005549 Ga0070704_100040984 Ga0070704_1000409843 203
433 3300005564 Ga0070664_100875444 Ga0070664_1008754441 203
434 3300005577 Ga0068857_100077671 Ga0068857_1000776712 203
435 3300005578 Ga0068854_100030942 Ga0068854_1000309422 203
436 3300005614 Ga0068856_100166830 Ga0068856_1001668301 203
437 3300005615 Ga0070702_100088503 Ga0070702_1000885032 203
438 3300005617 Ga0068859_100102096 Ga0068859_1001020962 203
439 3300005618 Ga0068864_100007658 Ga0068864_1000076585 203
440 3300005834 Ga0068851_10145731 Ga0068851_101457311 203
441 3300005840 Ga0068870_10006338 Ga0068870_100063384 203
442 3300005841 Ga0068863_100001818 Ga0068863_1000018182 203
443 3300005842 Ga0068858_100018691 Ga0068858_1000186913 203
444 3300005843 Ga0068860_100016352 Ga0068860_1000163529 203
445 3300005844 Ga0068862_100003882 Ga0068862_10000388210 203
446 3300006028 Ga0070717_10141338 Ga0070717_101413382 203
447 3300006042 Ga0075368_10070669 Ga0075368_100706691 203
448 3300006163 Ga0070715_10071751 Ga0070715_100717511 203
449 3300006177 Ga0075362_10111515 Ga0075362_101115153 203
450 3300006237 Ga0097621_100368620 Ga0097621_1003686202 203
451 3300006353 Ga0075370_10203956 Ga0075370_102039562 203
452 3300006358 Ga0068871_100022390 Ga0068871_1000223903 203
453 3300006931 Ga0097620_100102102 Ga0097620_1001021022 203
454 3300009094 Ga0111539_10064533 Ga0111539_100645333 203
455 3300009098 Ga0105245_10132707 Ga0105245_101327073 203
456 3300009101 Ga0105247_10013108 Ga0105247_100131085 203
457 3300009176 Ga0105242_10074845 Ga0105242_100748452 203
458 3300009177 Ga0105248_10095110 Ga0105248_100951101 203
459 3300009545 Ga0105237_10081836 Ga0105237_100818362 203
460 3300009551 Ga0105238_10770237 Ga0105238_107702372 203
461 3300009553 Ga0105249_10059014 Ga0105249_100590142 203
462 3300010375 Ga0105239_10061461 Ga0105239_100614613 203
463 3300011119 Ga0105246_10019081 Ga0105246_100190813 203
464 3300013102 Ga0157371_10203192 Ga0157371_102031922 203
465 3300013296 Ga0157374_10073828 Ga0157374_100738282 203
466 3300013306 Ga0163162_10113557 Ga0163162_101135573 203
467 3300013308 Ga0157375_10175189 Ga0157375_101751892 203
468 3300014968 Ga0157379_10108896 Ga0157379_101088963 203
469 3300014969 Ga0157376_10027570 Ga0157376_100275705 203
470 3300017792 Ga0163161_10145796 Ga0163161_101457962 203
471 3300025315 Ga0207697_10099834 Ga0207697_100998341 203
472 3300025321 Ga0207656_10036613 Ga0207656_100366133 203
473 3300025898 Ga0207692_10408297 Ga0207692_104082972 203
474 3300025900 Ga0207710_10011112 Ga0207710_100111124 203
475 3300025901 Ga0207688_10000092 Ga0207688_1000009220 203
476 3300025903 Ga0207680_10046917 Ga0207680_100469172 203
477 3300025905 Ga0207685_10056026 Ga0207685_100560261 203
478 3300025907 Ga0207645_10003528 Ga0207645_1000352812 203
479 3300025908 Ga0207643_10001083 Ga0207643_100010835 203
480 3300025916 Ga0207663_10038672 Ga0207663_100386723 203
481 3300025918 Ga0207662_10001580 Ga0207662_100015809 203
482 3300025919 Ga0207657_10125119 Ga0207657_101251192 203
483 3300025923 Ga0207681_10207086 Ga0207681_102070862 203
484 3300025925 Ga0207650_10165000 Ga0207650_101650001 203
485 3300025926 Ga0207659_10016670 Ga0207659_100166702 203
486 3300025927 Ga0207687_10018688 Ga0207687_100186882 203
487 3300025928 Ga0207700_10067310 Ga0207700_100673102 203
488 3300025931 Ga0207644_10033432 Ga0207644_100334325 203
489 3300025932 Ga0207690_10040226 Ga0207690_100402262 203
490 3300025933 Ga0207706_10008103 Ga0207706_100081034 203
491 3300025934 Ga0207686_10008312 Ga0207686_100083125 203
492 3300025936 Ga0207670_10020428 Ga0207670_100204285 203
493 3300025937 Ga0207669_10019553 Ga0207669_100195533 203
494 3300025938 Ga0207704_10563890 Ga0207704_105638901 203
495 3300025940 Ga0207691_10023849 Ga0207691_100238494 203
496 3300025941 Ga0207711_10025808 Ga0207711_100258083 203
497 3300025942 Ga0207689_10051943 Ga0207689_100519433 203
498 3300025944 Ga0207661_10106849 Ga0207661_101068492 203
499 3300025945 Ga0207679_10273544 Ga0207679_102735441 203
500 3300025960 Ga0207651_10016867 Ga0207651_100168672 203
501 3300025961 Ga0207712_10046176 Ga0207712_100461761 203
502 3300025972 Ga0207668_10029136 Ga0207668_100291363 203
503 3300025981 Ga0207640_10278231 Ga0207640_102782312 203
504 3300025986 Ga0207658_10118589 Ga0207658_101185892 203
505 3300026023 Ga0207677_10530863 Ga0207677_105308632 203
506 3300026035 Ga0207703_10064191 Ga0207703_100641911 203
507 3300026041 Ga0207639_10210568 Ga0207639_102105682 203
508 3300026075 Ga0207708_10000679 Ga0207708_1000067912 203
509 3300026078 Ga0207702_10790994 Ga0207702_107909942 203
510 3300026089 Ga0207648_10001913 Ga0207648_100019132 203
511 3300026095 Ga0207676_10005821 Ga0207676_100058215 203
512 3300026116 Ga0207674_10023205 Ga0207674_100232052 203
513 3300026118 Ga0207675_100004582 Ga0207675_1000045823 203
514 3300026121 Ga0207683_10006472 Ga0207683_100064728 203
515 3300026142 Ga0207698_10155619 Ga0207698_101556192 203
516 3300027907 Ga0207428_10290881 Ga0207428_102908812 203
517 3300028379 Ga0268266_10047366 Ga0268266_100473663 203
518 3300028380 Ga0268265_11075541 Ga0268265_110755411 203
519 3300028381 Ga0268264_10019403 Ga0268264_100194032 203
520 3300035691 Ga0373931_0498051 Ga0373931_0498051_22_633 203
521 3300046458 Ga0495591_060021 Ga0495591_060021_342_953 203
522 3300046491 Ga0495584_0042189 Ga0495584_0042189_1519_2130 203
523 3300046492 Ga0495585_0245989 Ga0495585_0245989_142_762 203
524 3300046500 Ga0495596_0090560 Ga0495596_0090560_120_731 203
525 3300046513 Ga0495616_0195463 Ga0495616_0195463_202_813 203
526 3300046518 Ga0495631_0192594 Ga0495631_0192594_157_768 203
527 3300046525 Ga0495663_0060164 Ga0495663_0060164_477_1097 203
528 3300046616 Ga0495668_0203746 Ga0495668_0203746_411_1022 203
529 3300046691 Ga0495670_0288194 Ga0495670_0288194_196_807 203
530 3300047317 Ga0495604_0258244 Ga0495604_0258244_132_743 203
531 3300048091 Ga0495626_0058049 Ga0495626_0058049_665_1276 203
532 3300048903 Ga0496100_0015825 Ga0496100_0015825_1390_2001 203
533 3300048904 Ga0496101_0091019 Ga0496101_0091019_1418_2029 203
534 3300048905 Ga0496102_0140003 Ga0496102_0140003_240_851 203
535 3300048906 Ga0496103_0013122 Ga0496103_0013122_1360_1971 203
536 3300048907 Ga0496104_0035201 Ga0496104_0035201_240_851 203
537 3300048908 Ga0496105_0025266 Ga0496105_0025266_2474_3085 203
538 3300048909 Ga0496106_0010888 Ga0496106_0010888_2871_3482 203
539 3300048910 Ga0496107_0012596 Ga0496107_0012596_1298_1909 203
540 3300048911 Ga0496108_0043162 Ga0496108_0043162_71_682 203
541 3300048911 Ga0496108_0274515 Ga0496108_0274515_364_975 203
542 3300048912 Ga0496109_0082300 Ga0496109_0082300_2313_2924 203
543 3300048913 Ga0496110_0009317 Ga0496110_0009317_5367_5978 203
544 3300048914 Ga0496111_0053990 Ga0496111_0053990_729_1340 203
545 3300048915 Ga0496112_0013272 Ga0496112_0013272_2229_2840 203
546 3300048915 Ga0496112_0193828 Ga0496112_0193828_326_937 203
547 3300048916 Ga0496113_0017691 Ga0496113_0017691_3500_4111 203
548 3300048917 Ga0496114_0007580 Ga0496114_0007580_4259_4870 203
549 3300048918 Ga0496115_0020547 Ga0496115_0020547_199_810 203
550 3300050494 nmdc:mga06z11_279263_c1 nmdc:mga06z11_279263_c1_312_923 203
551 3300050495 nmdc:mga04h51_85247_c1 nmdc:mga04h51_85247_c1_424_1044 203
552 3300050511 nmdc:mga08y16_478413_c1 nmdc:mga08y16_478413_c1_239_850 203
553 3300053077 Ga0495601_0046194 Ga0495601_0046194_1061_1672 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09998

DUF2239

Uncharacterized protein conserved in bacteria (DUF2239)

11

200

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b0u-assembly2.cif.gz_C structure of the calpl/t10 complex 0.4174 1 64
7unh-assembly1.cif.gz_A de novo designed chlorophyll dimer protein in apo state, sp2 0.3833 117 199
1fr0-assembly1.cif.gz_A solution structure of the histidine-containing phosphotransfer domain of anaerobic sensor kinase arcb from escherichia coli. 0.3085 119 199
6lo8-assembly1.cif.gz_A cryo-em structure of the tim22 complex from yeast 0.3063 121 203
6akj-assembly1.cif.gz_B the crystal structure of emc complex 0.3032 7 76
ID Description Score Start End Superfamily
af_P32867_31_225_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.566 119 198 1.20.58.70
af_P39926_34_229_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5515 119 197 1.20.58.70
af_Q59YF0_33_231_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4948 119 198 1.20.58.70
2rcvH01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.4556 119 203 1.10.287.990
2rcvH01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.4465 119 203 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A1I6WPV1-F1-model_v4 Uncharacterized protein 0.9792 137 190
AF-A0A539D1T3-F1-model_v4 Uncharacterized protein 0.9702 5 65
AF-A0A6B3UQS1-F1-model_v4 DUF2239 family protein 0.9699 124 194
AF-A0A519K0E2-F1-model_v4 DUF2239 family protein 0.9685 5 57
AF-A0A1L6M3J6-F1-model_v4 deleted 0.9543 91 193

Feature Viewer

pLDDT pTM Quality
81.9 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map