F462914
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 393 | 526 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0228385|Ga0496121_0228385_51_761 |
| Length | 236 |
| Sequence | LEFVMTARSQTCTAFEGHRRIASGASPDVALAVREVLARGEQAPVLVFDDITSRPVEFDLRGTPEQIVARLASQNDEAETAHAAVDAAEDAPRGRGRPKLGVVAREVTLLPRHWDWLNGQSGGASVALRKLVDAARAAGEDKDRRRAAQEAVYRFMTALAGNLPRYEDATRALYADDRPRFEEIVATWPDDVRDYSLQLADAAFARHAQSRLIAASSRAQTTNRTDEKKTAHAGEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 2 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 3 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 4 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 5 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 6 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 7 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 8 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 9 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 10 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 11 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 12 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 13 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 14 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 15 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 16 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 17 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 18 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 19 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 20 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 21 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 22 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 23 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 24 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 25 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 26 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 27 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 30 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 31 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 32 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 33 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 34 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 35 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 42 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 246 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 247 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 250 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 333 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 334 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 335 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 336 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 337 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 346 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 385 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 386 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 391 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 392 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 393 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.94 |
| Metatranscriptomes | 0.18 |
| Isolates | 4.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.15 |
| Nodule | 1.45 |
| Rhizoplane | 4.34 |
| Rhizosphere | 81.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1023768 | 3300001977 | Bacteria | 851 |
| 2 | JGI24740J21852_10003389 | 3300001979 | Bacteria | 7015 |
| 3 | JGI24739J22299_10002488 | 3300001989 | Bacteria | 7112 |
| 4 | JGI24739J22299_10016174 | 3300001989 | Bacteria | 2702 |
| 5 | JGI24743J22301_10003100 | 3300001991 | Bacteria | 2591 |
| 6 | JGI24735J21928_10022697 | 3300002067 | Bacteria | 1907 |
| 7 | JGI24735J21928_10036658 | 3300002067 | Bacteria | 1438 |
| 8 | JGI24738J21930_10001268 | 3300002075 | Bacteria | 7077 |
| 9 | JGI24738J21930_10052018 | 3300002075 | Bacteria | 836 |
| 10 | JGI24744J21845_10007709 | 3300002077 | Bacteria | 2225 |
| 11 | JGI24034J26672_10037608 | 3300002239 | Bacteria | 805 |
| 12 | JGI24742J22300_10007474 | 3300002244 | Bacteria | 1804 |
| 13 | JGI24742J22300_10008907 | 3300002244 | Bacteria | 1655 |
| 14 | JGI25156J39149_1001787 | 3300002705 | Bacteria | 8462 |
| 15 | JGI25156J39149_1002719 | 3300002705 | Bacteria | 6170 |
| 16 | JGI25156J39149_1004311 | 3300002705 | Bacteria | 4369 |
| 17 | JGI25165J46597_1001807 | 3300003214 | Bacteria | 9051 |
| 18 | Ga0055533_1000175 | 3300003756 | Bacteria | 57439 |
| 19 | Ga0055533_1000234 | 3300003756 | Bacteria | 36168 |
| 20 | Ga0055533_1004342 | 3300003756 | Bacteria | 2573 |
| 21 | Ga0055532_1000031 | 3300003758 | Bacteria | 231440 |
| 22 | Ga0055527_1000020 | 3300003760 | Bacteria | 231441 |
| 23 | Ga0055535_1000023 | 3300003761 | Bacteria | 231441 |
| 24 | Ga0055542_1000035 | 3300003762 | Bacteria | 231441 |
| 25 | Ga0055529_1000039 | 3300003763 | Bacteria | 231439 |
| 26 | Ga0058692_1020413 | 3300003856 | Bacteria | 1393 |
| 27 | Ga0065707_10215091 | 3300005295 | Bacteria | 1248 |
| 28 | Ga0070658_10237045 | 3300005327 | Bacteria | 1546 |
| 29 | Ga0070676_10405462 | 3300005328 | Bacteria | 949 |
| 30 | Ga0070683_100147792 | 3300005329 | Bacteria | 2227 |
| 31 | Ga0070683_100161802 | 3300005329 | Bacteria | 2124 |
| 32 | Ga0070690_100212432 | 3300005330 | Bacteria | 1352 |
| 33 | Ga0070670_100404367 | 3300005331 | Bacteria | 1206 |
| 34 | Ga0068869_100056254 | 3300005334 | Bacteria | 2869 |
| 35 | Ga0070680_100814740 | 3300005336 | Bacteria | 805 |
| 36 | Ga0070682_100633974 | 3300005337 | Bacteria | 848 |
| 37 | Ga0068868_100008027 | 3300005338 | Bacteria | 7546 |
| 38 | Ga0070660_100169685 | 3300005339 | Bacteria | 1762 |
| 39 | Ga0070660_100886136 | 3300005339 | Bacteria | 752 |
| 40 | Ga0070660_100970553 | 3300005339 | Bacteria | 718 |
| 41 | Ga0070689_100128639 | 3300005340 | Bacteria | 2029 |
| 42 | Ga0070691_10057024 | 3300005341 | Bacteria | 1873 |
| 43 | Ga0070687_100013129 | 3300005343 | Bacteria | 3680 |
| 44 | Ga0070661_100228110 | 3300005344 | Bacteria | 1431 |
| 45 | Ga0070661_100311382 | 3300005344 | Bacteria | 1228 |
| 46 | Ga0070692_10023724 | 3300005345 | Bacteria | 3009 |
| 47 | Ga0070668_100086182 | 3300005347 | Bacteria | 2469 |
| 48 | Ga0070669_100218668 | 3300005353 | Bacteria | 1506 |
| 49 | Ga0070669_100469581 | 3300005353 | Bacteria | 1039 |
| 50 | Ga0070675_100033460 | 3300005354 | Bacteria | 4168 |
| 51 | Ga0070674_100052636 | 3300005356 | Bacteria | 2808 |
| 52 | Ga0070674_100491397 | 3300005356 | Bacteria | 1020 |
| 53 | Ga0070673_100023147 | 3300005364 | Bacteria | 4535 |
| 54 | Ga0070673_100150943 | 3300005364 | Bacteria | 1968 |
| 55 | Ga0070688_100040057 | 3300005365 | Bacteria | 2870 |
| 56 | Ga0070659_100108405 | 3300005366 | Bacteria | 2240 |
| 57 | Ga0070659_100114744 | 3300005366 | Bacteria | 2177 |
| 58 | Ga0070667_100021215 | 3300005367 | Bacteria | 5397 |
| 59 | Ga0070667_100049175 | 3300005367 | Bacteria | 3550 |
| 60 | Ga0070713_100083972 | 3300005436 | Bacteria | 2724 |
| 61 | Ga0070710_10088465 | 3300005437 | Bacteria | 1822 |
| 62 | Ga0070701_10005793 | 3300005438 | Bacteria | 5144 |
| 63 | Ga0070711_100052070 | 3300005439 | Bacteria | 2816 |
| 64 | Ga0070700_100098643 | 3300005441 | Bacteria | 1920 |
| 65 | Ga0070694_100457517 | 3300005444 | Bacteria | 1009 |
| 66 | Ga0070663_100064656 | 3300005455 | Bacteria | 2645 |
| 67 | Ga0070663_100142424 | 3300005455 | Bacteria | 1831 |
| 68 | Ga0070678_100045543 | 3300005456 | Bacteria | 3139 |
| 69 | Ga0070678_101012649 | 3300005456 | Bacteria | 764 |
| 70 | Ga0070662_100091612 | 3300005457 | Bacteria | 2283 |
| 71 | Ga0070681_10697805 | 3300005458 | Bacteria | 931 |
| 72 | Ga0068867_100007166 | 3300005459 | Bacteria | 7880 |
| 73 | Ga0070685_10000890 | 3300005466 | Bacteria | 16081 |
| 74 | Ga0070698_100021013 | 3300005471 | Bacteria | 6839 |
| 75 | Ga0070699_100003337 | 3300005518 | Bacteria | 14205 |
| 76 | Ga0070684_100155033 | 3300005535 | Bacteria | 2077 |
| 77 | Ga0070684_100561707 | 3300005535 | Bacteria | 1059 |
| 78 | Ga0068853_100066529 | 3300005539 | Bacteria | 3130 |
| 79 | Ga0068853_100762296 | 3300005539 | Bacteria | 925 |
| 80 | Ga0070672_100027998 | 3300005543 | Bacteria | 4210 |
| 81 | Ga0070696_100308722 | 3300005546 | Bacteria | 1214 |
| 82 | Ga0070693_100332959 | 3300005547 | Bacteria | 1034 |
| 83 | Ga0070665_100162598 | 3300005548 | Bacteria | 2234 |
| 84 | Ga0070665_100303922 | 3300005548 | Bacteria | 1598 |
| 85 | Ga0070665_100367337 | 3300005548 | Bacteria | 1445 |
| 86 | Ga0070704_100040984 | 3300005549 | Bacteria | 3193 |
| 87 | Ga0068855_100104012 | 3300005563 | Bacteria | 3266 |
| 88 | Ga0068855_100709611 | 3300005563 | Bacteria | 1076 |
| 89 | Ga0070664_100131617 | 3300005564 | Bacteria | 2198 |
| 90 | Ga0070664_100875444 | 3300005564 | Bacteria | 841 |
| 91 | Ga0068857_100077671 | 3300005577 | Bacteria | 2963 |
| 92 | Ga0068854_100030942 | 3300005578 | Bacteria | 3716 |
| 93 | Ga0068856_100072329 | 3300005614 | Bacteria | 3414 |
| 94 | Ga0068856_100166830 | 3300005614 | Bacteria | 2213 |
| 95 | Ga0070702_100088503 | 3300005615 | Bacteria | 1872 |
| 96 | Ga0068852_100120901 | 3300005616 | Bacteria | 2397 |
| 97 | Ga0068859_100102096 | 3300005617 | Bacteria | 2925 |
| 98 | Ga0068864_100007658 | 3300005618 | Bacteria | 8894 |
| 99 | Ga0068851_10145731 | 3300005834 | Bacteria | 1291 |
| 100 | Ga0068870_10006338 | 3300005840 | Bacteria | 5211 |
| 101 | Ga0068863_100001818 | 3300005841 | Bacteria | 21200 |
| 102 | Ga0068863_101495169 | 3300005841 | Bacteria | 684 |
| 103 | Ga0068858_100018691 | 3300005842 | Bacteria | 6487 |
| 104 | Ga0068860_100000433 | 3300005843 | Bacteria | 53218 |
| 105 | Ga0068860_100016352 | 3300005843 | Bacteria | 7234 |
| 106 | Ga0068860_101524486 | 3300005843 | Bacteria | 690 |
| 107 | Ga0068862_100003882 | 3300005844 | Bacteria | 12713 |
| 108 | Ga0070717_10141338 | 3300006028 | Bacteria | 2077 |
| 109 | Ga0075368_10070669 | 3300006042 | Bacteria | 1409 |
| 110 | Ga0070715_10071751 | 3300006163 | Bacteria | 1549 |
| 111 | Ga0070716_100476996 | 3300006173 | Bacteria | 915 |
| 112 | Ga0075362_10111515 | 3300006177 | Bacteria | 1288 |
| 113 | Ga0097621_100368620 | 3300006237 | Bacteria | 1281 |
| 114 | Ga0075370_10032793 | 3300006353 | Bacteria | 2905 |
| 115 | Ga0075370_10203956 | 3300006353 | Bacteria | 1167 |
| 116 | Ga0068871_100022390 | 3300006358 | Bacteria | 4870 |
| 117 | Ga0075428_100636678 | 3300006844 | Bacteria | 1138 |
| 118 | Ga0075430_100240608 | 3300006846 | Bacteria | 1500 |
| 119 | Ga0075431_100396136 | 3300006847 | Bacteria | 1382 |
| 120 | Ga0075433_10077157 | 3300006852 | Bacteria | 2935 |
| 121 | Ga0075433_10231541 | 3300006852 | Bacteria | 1640 |
| 122 | Ga0075434_100127256 | 3300006871 | Archaea | 2564 |
| 123 | Ga0075434_100168759 | 3300006871 | Bacteria | 2208 |
| 124 | Ga0075429_100724610 | 3300006880 | Bacteria | 871 |
| 125 | Ga0075436_100242896 | 3300006914 | Bacteria | 1281 |
| 126 | Ga0097620_100102102 | 3300006931 | Bacteria | 2925 |
| 127 | Ga0075435_100476687 | 3300007076 | Bacteria | 1077 |
| 128 | Ga0099795_10002946 | 3300007788 | Bacteria | 4127 |
| 129 | Ga0105251_10000269 | 3300009011 | Bacteria | 52035 |
| 130 | Ga0105251_10063827 | 3300009011 | Bacteria | 1727 |
| 131 | Ga0111539_10064533 | 3300009094 | Bacteria | 4331 |
| 132 | Ga0111539_10317799 | 3300009094 | Bacteria | 1812 |
| 133 | Ga0105245_10132707 | 3300009098 | Bacteria | 2337 |
| 134 | Ga0105247_10013108 | 3300009101 | Bacteria | 4973 |
| 135 | Ga0114129_10053597 | 3300009147 | Bacteria | 5657 |
| 136 | Ga0114129_10101997 | 3300009147 | Bacteria | 3969 |
| 137 | Ga0105242_10074845 | 3300009176 | Bacteria | 2818 |
| 138 | Ga0105242_11058973 | 3300009176 | Bacteria | 822 |
| 139 | Ga0105248_10095110 | 3300009177 | Bacteria | 3354 |
| 140 | Ga0105248_10304508 | 3300009177 | Bacteria | 1795 |
| 141 | Ga0105237_10081836 | 3300009545 | Bacteria | 3220 |
| 142 | Ga0105238_10252943 | 3300009551 | Bacteria | 1741 |
| 143 | Ga0105238_10770237 | 3300009551 | Bacteria | 977 |
| 144 | Ga0105249_10059014 | 3300009553 | Bacteria | 3518 |
| 145 | Ga0099796_10004984 | 3300010159 | Bacteria | 3272 |
| 146 | Ga0105239_10061461 | 3300010375 | Bacteria | 4123 |
| 147 | Ga0105246_10019081 | 3300011119 | Bacteria | 4376 |
| 148 | Ga0157371_10203192 | 3300013102 | Bacteria | 1421 |
| 149 | Ga0157369_10214911 | 3300013105 | Bacteria | 2014 |
| 150 | Ga0157369_10252038 | 3300013105 | Bacteria | 1842 |
| 151 | Ga0157369_10261033 | 3300013105 | Bacteria | 1806 |
| 152 | Ga0157374_10073828 | 3300013296 | Bacteria | 3219 |
| 153 | Ga0163162_10041652 | 3300013306 | Bacteria | 4596 |
| 154 | Ga0163162_10113557 | 3300013306 | Bacteria | 2807 |
| 155 | Ga0157372_10150560 | 3300013307 | Bacteria | 2685 |
| 156 | Ga0157375_10175189 | 3300013308 | Bacteria | 2294 |
| 157 | Ga0157375_10980136 | 3300013308 | Bacteria | 986 |
| 158 | Ga0163163_10027358 | 3300014325 | Archaea | 5461 |
| 159 | Ga0182008_10026033 | 3300014497 | Bacteria | 2968 |
| 160 | Ga0157379_10045233 | 3300014968 | Bacteria | 3930 |
| 161 | Ga0157379_10108896 | 3300014968 | Bacteria | 2488 |
| 162 | Ga0157379_10786355 | 3300014968 | Bacteria | 897 |
| 163 | Ga0157376_10027570 | 3300014969 | Bacteria | 4505 |
| 164 | Ga0182007_10002279 | 3300015262 | Bacteria | 9669 |
| 165 | Ga0163161_10145796 | 3300017792 | Bacteria | 1796 |
| 166 | Ga0206354_11182836 | 3300020081 | Bacteria | 864 |
| 167 | Ga0213875_10002701 | 3300021388 | Bacteria | 10476 |
| 168 | Ga0209674_100017 | 3300025226 | Bacteria | 689087 |
| 169 | Ga0209674_100085 | 3300025226 | Bacteria | 190617 |
| 170 | Ga0209674_100143 | 3300025226 | Bacteria | 107275 |
| 171 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 172 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 173 | Ga0207427_101362 | 3300025231 | Bacteria | 9008 |
| 174 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 175 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 176 | Ga0209759_1000037 | 3300025256 | Bacteria | 259200 |
| 177 | Ga0209759_1000092 | 3300025256 | Bacteria | 161238 |
| 178 | Ga0209759_1000200 | 3300025256 | Bacteria | 94590 |
| 179 | Ga0209233_1000123 | 3300025261 | Bacteria | 228400 |
| 180 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 181 | Ga0207697_10099834 | 3300025315 | Bacteria | 1236 |
| 182 | Ga0207656_10036613 | 3300025321 | Bacteria | 2060 |
| 183 | Ga0207713_1000435 | 3300025735 | Bacteria | 44035 |
| 184 | Ga0207713_1105724 | 3300025735 | Bacteria | 964 |
| 185 | Ga0207692_10408297 | 3300025898 | Bacteria | 848 |
| 186 | Ga0207710_10011112 | 3300025900 | Bacteria | 3791 |
| 187 | Ga0207688_10000092 | 3300025901 | Bacteria | 34911 |
| 188 | Ga0207680_10046917 | 3300025903 | Bacteria | 2556 |
| 189 | Ga0207647_10012684 | 3300025904 | Bacteria | 5857 |
| 190 | Ga0207647_10025467 | 3300025904 | Bacteria | 3886 |
| 191 | Ga0207647_10059672 | 3300025904 | Bacteria | 2333 |
| 192 | Ga0207685_10056026 | 3300025905 | Bacteria | 1541 |
| 193 | Ga0207645_10003528 | 3300025907 | Bacteria | 11833 |
| 194 | Ga0207643_10001083 | 3300025908 | Bacteria | 16109 |
| 195 | Ga0207654_10435032 | 3300025911 | Bacteria | 917 |
| 196 | Ga0207707_10785228 | 3300025912 | Bacteria | 794 |
| 197 | Ga0207695_10321335 | 3300025913 | Bacteria | 1437 |
| 198 | Ga0207671_10013631 | 3300025914 | Bacteria | 6464 |
| 199 | Ga0207663_10038672 | 3300025916 | Bacteria | 2886 |
| 200 | Ga0207660_10667758 | 3300025917 | Bacteria | 847 |
| 201 | Ga0207662_10001580 | 3300025918 | Bacteria | 11150 |
| 202 | Ga0207657_10125119 | 3300025919 | Bacteria | 2112 |
| 203 | Ga0207646_11073116 | 3300025922 | Bacteria | 709 |
| 204 | Ga0207681_10207086 | 3300025923 | Bacteria | 1509 |
| 205 | Ga0207694_10642357 | 3300025924 | Bacteria | 894 |
| 206 | Ga0207650_10165000 | 3300025925 | Bacteria | 1757 |
| 207 | Ga0207659_10016670 | 3300025926 | Bacteria | 4787 |
| 208 | Ga0207687_10018688 | 3300025927 | Bacteria | 4580 |
| 209 | Ga0207700_10067310 | 3300025928 | Bacteria | 2741 |
| 210 | Ga0207644_10033432 | 3300025931 | Bacteria | 3593 |
| 211 | Ga0207690_10040226 | 3300025932 | Bacteria | 3055 |
| 212 | Ga0207690_10383583 | 3300025932 | Bacteria | 1117 |
| 213 | Ga0207706_10008103 | 3300025933 | Bacteria | 9697 |
| 214 | Ga0207686_10008312 | 3300025934 | Bacteria | 5599 |
| 215 | Ga0207670_10020428 | 3300025936 | Bacteria | 4069 |
| 216 | Ga0207669_10019553 | 3300025937 | Bacteria | 3529 |
| 217 | Ga0207704_10563890 | 3300025938 | Bacteria | 927 |
| 218 | Ga0207691_10023849 | 3300025940 | Bacteria | 5758 |
| 219 | Ga0207711_10025808 | 3300025941 | Bacteria | 4927 |
| 220 | Ga0207711_10771593 | 3300025941 | Unclassified | 896 |
| 221 | Ga0207689_10051943 | 3300025942 | Bacteria | 3379 |
| 222 | Ga0207661_10016764 | 3300025944 | Bacteria | 5409 |
| 223 | Ga0207661_10106849 | 3300025944 | Bacteria | 2360 |
| 224 | Ga0207679_10190530 | 3300025945 | Bacteria | 1705 |
| 225 | Ga0207679_10273544 | 3300025945 | Bacteria | 1445 |
| 226 | Ga0207667_10354487 | 3300025949 | Bacteria | 1496 |
| 227 | Ga0207651_10016867 | 3300025960 | Bacteria | 4295 |
| 228 | Ga0207651_11034254 | 3300025960 | Bacteria | 735 |
| 229 | Ga0207712_10046176 | 3300025961 | Bacteria | 3019 |
| 230 | Ga0207668_10029136 | 3300025972 | Bacteria | 3615 |
| 231 | Ga0207640_10278231 | 3300025981 | Bacteria | 1313 |
| 232 | Ga0207658_10118589 | 3300025986 | Bacteria | 2105 |
| 233 | Ga0207677_10530863 | 3300026023 | Bacteria | 1022 |
| 234 | Ga0207703_10064191 | 3300026035 | Bacteria | 3013 |
| 235 | Ga0207703_10552631 | 3300026035 | Bacteria | 1086 |
| 236 | Ga0207639_10210568 | 3300026041 | Bacteria | 1673 |
| 237 | Ga0207639_10280476 | 3300026041 | Bacteria | 1465 |
| 238 | Ga0207708_10000679 | 3300026075 | Bacteria | 26002 |
| 239 | Ga0207702_10295357 | 3300026078 | Bacteria | 1536 |
| 240 | Ga0207702_10790994 | 3300026078 | Bacteria | 937 |
| 241 | Ga0207648_10001913 | 3300026089 | Bacteria | 22748 |
| 242 | Ga0207676_10005821 | 3300026095 | Bacteria | 8715 |
| 243 | Ga0207674_10023205 | 3300026116 | Bacteria | 6649 |
| 244 | Ga0207675_100004582 | 3300026118 | Bacteria | 13325 |
| 245 | Ga0207683_10006472 | 3300026121 | Bacteria | 10023 |
| 246 | Ga0207698_10155619 | 3300026142 | Bacteria | 1991 |
| 247 | Ga0207698_10330091 | 3300026142 | Bacteria | 1432 |
| 248 | Ga0209371_1002008 | 3300027312 | Bacteria | 12240 |
| 249 | Ga0207428_10290881 | 3300027907 | Bacteria | 1211 |
| 250 | Ga0268266_10047366 | 3300028379 | Bacteria | 3682 |
| 251 | Ga0268265_11075541 | 3300028380 | Bacteria | 797 |
| 252 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 253 | Ga0268264_10019403 | 3300028381 | Bacteria | 5556 |
| 254 | Ga0268264_10378075 | 3300028381 | Bacteria | 1356 |
| 255 | Ga0268256_1001757 | 3300030500 | Bacteria | 12240 |
| 256 | Ga0265329_10003505 | 3300031242 | Bacteria | 6798 |
| 257 | Ga0265339_10000627 | 3300031249 | Bacteria | 27311 |
| 258 | Ga0265331_10076029 | 3300031250 | Bacteria | 1565 |
| 259 | Ga0265327_10158143 | 3300031251 | Bacteria | 1049 |
| 260 | Ga0265316_10086153 | 3300031344 | Bacteria | 2402 |
| 261 | Ga0307509_10006490 | 3300031507 | Bacteria | 15715 |
| 262 | Ga0307509_10220729 | 3300031507 | Bacteria | 1709 |
| 263 | Ga0307408_100005169 | 3300031548 | Bacteria | 8755 |
| 264 | Ga0265313_10009581 | 3300031595 | Bacteria | 6266 |
| 265 | Ga0265313_10094128 | 3300031595 | Bacteria | 1339 |
| 266 | Ga0307508_10000108 | 3300031616 | Bacteria | 97443 |
| 267 | Ga0265314_10001008 | 3300031711 | Bacteria | 32993 |
| 268 | Ga0265314_10001100 | 3300031711 | Bacteria | 31213 |
| 269 | Ga0265342_10043832 | 3300031712 | Bacteria | 2698 |
| 270 | Ga0316576_10698563 | 3300031727 | Unclassified | 735 |
| 271 | Ga0307516_10000908 | 3300031730 | Bacteria | 40669 |
| 272 | Ga0307516_10235896 | 3300031730 | Bacteria | 1530 |
| 273 | Ga0307410_10340616 | 3300031852 | Bacteria | 1195 |
| 274 | Ga0307407_10163530 | 3300031903 | Bacteria | 1459 |
| 275 | Ga0307412_10000014 | 3300031911 | Bacteria | 353795 |
| 276 | Ga0307409_100529907 | 3300031995 | Bacteria | 1152 |
| 277 | Ga0373934_0163697 | 3300035086 | Bacteria | 913 |
| 278 | Ga0373946_0349325 | 3300035171 | Bacteria | 739 |
| 279 | Ga0373955_0451953 | 3300035172 | Bacteria | 783 |
| 280 | Ga0373961_0336987 | 3300035241 | Bacteria | 566 |
| 281 | Ga0373924_0481826 | 3300035410 | Bacteria | 557 |
| 282 | Ga0373931_0148654 | 3300035691 | Bacteria | 1364 |
| 283 | Ga0373931_0498051 | 3300035691 | Bacteria | 785 |
| 284 | Ga0373931_0616099 | 3300035691 | Bacteria | 711 |
| 285 | Ga0373937_1257105 | 3300036401 | Bacteria | 688 |
| 286 | Ga0395900_0041674 | 3300037418 | Bacteria | 4732 |
| 287 | Ga0395898_0139449 | 3300037466 | Bacteria | 2321 |
| 288 | Ga0436364_0567892 | 3300037853 | Bacteria | 10612 |
| 289 | Ga0395901_0037001 | 3300038443 | Bacteria | 5047 |
| 290 | Ga0242420_099384 | 3300038996 | Bacteria | 618 |
| 291 | Ga0400483_217610 | 3300039062 | Bacteria | 1913 |
| 292 | Ga0400489_18479 | 3300039093 | Bacteria | 2032 |
| 293 | Ga0436363_1313259 | 3300039450 | Bacteria | 3200 |
| 294 | Ga0439436_0051993 | 3300041404 | Bacteria | 1156 |
| 295 | Ga0451793_0087511 | 3300041452 | Bacteria | 3323 |
| 296 | Ga0451795_0039163 | 3300041456 | Bacteria | 1104 |
| 297 | Ga0451577_0001798 | 3300042876 | Bacteria | 27438 |
| 298 | Ga0451577_0004743 | 3300042876 | Bacteria | 14234 |
| 299 | Ga0451577_0641786 | 3300042876 | Bacteria | 963 |
| 300 | Ga0451577_0892657 | 3300042876 | Unclassified | 801 |
| 301 | Ga0466963_0073993 | 3300044694 | Bacteria | 2298 |
| 302 | Ga0453684_0050546 | 3300044712 | Bacteria | 5466 |
| 303 | Ga0451576_0099519 | 3300045051 | Bacteria | 3025 |
| 304 | Ga0451576_1137445 | 3300045051 | Bacteria | 816 |
| 305 | Ga0495592_0118473 | 3300046454 | Bacteria | 1865 |
| 306 | Ga0495590_0025822 | 3300046457 | Bacteria | 2063 |
| 307 | Ga0495591_060021 | 3300046458 | Bacteria | 1013 |
| 308 | Ga0495629_0000034 | 3300046459 | Bacteria | 118709 |
| 309 | Ga0495629_0001013 | 3300046459 | Bacteria | 22585 |
| 310 | Ga0495629_0007389 | 3300046459 | Bacteria | 8100 |
| 311 | Ga0495638_0015393 | 3300046460 | Bacteria | 5137 |
| 312 | Ga0495641_0027950 | 3300046461 | Bacteria | 2735 |
| 313 | Ga0495651_0007769 | 3300046462 | Bacteria | 8207 |
| 314 | Ga0495651_0104894 | 3300046462 | Bacteria | 2098 |
| 315 | Ga0495651_0252380 | 3300046462 | Bacteria | 1204 |
| 316 | Ga0495653_0001766 | 3300046463 | Bacteria | 17042 |
| 317 | Ga0495653_0083128 | 3300046463 | Bacteria | 2361 |
| 318 | Ga0495653_0146215 | 3300046463 | Bacteria | 1656 |
| 319 | Ga0495650_0001635 | 3300046471 | Bacteria | 20815 |
| 320 | Ga0495650_0019002 | 3300046471 | Bacteria | 3399 |
| 321 | Ga0495650_0019198 | 3300046471 | Bacteria | 3375 |
| 322 | Ga0495650_0026693 | 3300046471 | Bacteria | 2680 |
| 323 | Ga0495650_0034988 | 3300046471 | Bacteria | 2216 |
| 324 | Ga0495580_0004501 | 3300046472 | Bacteria | 11707 |
| 325 | Ga0495580_0006375 | 3300046472 | Bacteria | 9626 |
| 326 | Ga0495580_0007438 | 3300046472 | Bacteria | 8804 |
| 327 | Ga0495582_0015387 | 3300046473 | Bacteria | 4202 |
| 328 | Ga0495605_0002834 | 3300046474 | Bacteria | 10539 |
| 329 | Ga0495662_0062221 | 3300046476 | Bacteria | 1803 |
| 330 | Ga0495664_0009482 | 3300046477 | Bacteria | 5448 |
| 331 | Ga0495664_0069254 | 3300046477 | Bacteria | 2106 |
| 332 | Ga0495664_0123795 | 3300046477 | Bacteria | 1564 |
| 333 | Ga0495584_0042189 | 3300046491 | Bacteria | 2303 |
| 334 | Ga0495584_0170052 | 3300046491 | Bacteria | 1108 |
| 335 | Ga0495584_0349168 | 3300046491 | Bacteria | 751 |
| 336 | Ga0495585_0245989 | 3300046492 | Bacteria | 894 |
| 337 | Ga0495596_0034101 | 3300046500 | Bacteria | 2023 |
| 338 | Ga0495596_0090560 | 3300046500 | Bacteria | 1187 |
| 339 | Ga0495607_0205520 | 3300046501 | Bacteria | 972 |
| 340 | Ga0495607_0419986 | 3300046501 | Bacteria | 605 |
| 341 | Ga0495583_0003116 | 3300046506 | Bacteria | 13113 |
| 342 | Ga0495606_0016303 | 3300046507 | Bacteria | 5673 |
| 343 | Ga0495606_0018047 | 3300046507 | Bacteria | 5306 |
| 344 | Ga0495606_0080382 | 3300046507 | Bacteria | 2028 |
| 345 | Ga0495608_0149753 | 3300046511 | Bacteria | 1487 |
| 346 | Ga0495608_0459800 | 3300046511 | Bacteria | 774 |
| 347 | Ga0495616_0161638 | 3300046513 | Bacteria | 1007 |
| 348 | Ga0495616_0195463 | 3300046513 | Bacteria | 892 |
| 349 | Ga0495618_0050693 | 3300046514 | Bacteria | 2622 |
| 350 | Ga0495618_0121028 | 3300046514 | Bacteria | 1676 |
| 351 | Ga0495620_0003580 | 3300046515 | Bacteria | 8876 |
| 352 | Ga0495628_0009315 | 3300046516 | Bacteria | 8389 |
| 353 | Ga0495628_0212788 | 3300046516 | Bacteria | 1453 |
| 354 | Ga0495630_0056510 | 3300046517 | Bacteria | 2940 |
| 355 | Ga0495630_0092904 | 3300046517 | Bacteria | 2280 |
| 356 | Ga0495630_0208177 | 3300046517 | Bacteria | 1493 |
| 357 | Ga0495631_0192594 | 3300046518 | Bacteria | 873 |
| 358 | Ga0495637_0056139 | 3300046520 | Bacteria | 1631 |
| 359 | Ga0495643_0092994 | 3300046522 | Bacteria | 1553 |
| 360 | Ga0495663_0060164 | 3300046525 | Bacteria | 1193 |
| 361 | Ga0495666_0026793 | 3300046526 | Bacteria | 2838 |
| 362 | Ga0495642_0001699 | 3300046528 | Bacteria | 9496 |
| 363 | Ga0495642_0020732 | 3300046528 | Bacteria | 2583 |
| 364 | Ga0495652_0005229 | 3300046529 | Bacteria | 12259 |
| 365 | Ga0495652_0054217 | 3300046529 | Bacteria | 3414 |
| 366 | Ga0495652_0100723 | 3300046529 | Bacteria | 2343 |
| 367 | Ga0495654_0001638 | 3300046530 | Bacteria | 15167 |
| 368 | Ga0495654_0082615 | 3300046530 | Bacteria | 1503 |
| 369 | Ga0495665_0022320 | 3300046531 | Bacteria | 3402 |
| 370 | Ga0495665_0038461 | 3300046531 | Bacteria | 2550 |
| 371 | Ga0495640_0026178 | 3300046533 | Bacteria | 4218 |
| 372 | Ga0495586_0489443 | 3300046535 | Unclassified | 710 |
| 373 | Ga0495587_0373384 | 3300046536 | Bacteria | 794 |
| 374 | Ga0495597_0006041 | 3300046542 | Bacteria | 6307 |
| 375 | Ga0495597_0071108 | 3300046542 | Bacteria | 1499 |
| 376 | Ga0495645_0001014 | 3300046543 | Bacteria | 19105 |
| 377 | Ga0495645_0088887 | 3300046543 | Bacteria | 2209 |
| 378 | Ga0495633_0291110 | 3300046558 | Bacteria | 742 |
| 379 | Ga0495667_0069190 | 3300046559 | Bacteria | 2304 |
| 380 | Ga0495668_0203386 | 3300046616 | Bacteria | 1084 |
| 381 | Ga0495668_0203746 | 3300046616 | Bacteria | 1083 |
| 382 | Ga0495634_0014874 | 3300046642 | Bacteria | 5594 |
| 383 | Ga0495659_0161391 | 3300046664 | Bacteria | 905 |
| 384 | Ga0495661_0007205 | 3300046665 | Bacteria | 7757 |
| 385 | Ga0495661_0036075 | 3300046665 | Bacteria | 3098 |
| 386 | Ga0495588_0010689 | 3300046674 | Bacteria | 4281 |
| 387 | Ga0495657_0015754 | 3300046675 | Bacteria | 5524 |
| 388 | Ga0495623_0013794 | 3300046679 | Bacteria | 5239 |
| 389 | Ga0495623_0014711 | 3300046679 | Bacteria | 5060 |
| 390 | Ga0495623_0539284 | 3300046679 | Bacteria | 612 |
| 391 | Ga0495646_0010051 | 3300046680 | Bacteria | 6018 |
| 392 | Ga0495646_0024779 | 3300046680 | Bacteria | 3777 |
| 393 | Ga0495646_0037504 | 3300046680 | Bacteria | 2997 |
| 394 | Ga0495669_0013198 | 3300046684 | Bacteria | 3518 |
| 395 | Ga0495669_0390043 | 3300046684 | Bacteria | 674 |
| 396 | Ga0495613_0020732 | 3300046689 | Bacteria | 4900 |
| 397 | Ga0495613_0024240 | 3300046689 | Bacteria | 4521 |
| 398 | Ga0495613_0168259 | 3300046689 | Bacteria | 1557 |
| 399 | Ga0495624_0002128 | 3300046690 | Bacteria | 15089 |
| 400 | Ga0495624_0030098 | 3300046690 | Bacteria | 3538 |
| 401 | Ga0495670_0288194 | 3300046691 | Bacteria | 879 |
| 402 | Ga0495649_0080110 | 3300046694 | Bacteria | 1746 |
| 403 | Ga0495589_0003147 | 3300046794 | Bacteria | 9029 |
| 404 | Ga0495589_0092619 | 3300046794 | Bacteria | 1467 |
| 405 | Ga0495581_0000534 | 3300047315 | Bacteria | 19544 |
| 406 | Ga0495604_0011449 | 3300047317 | Bacteria | 7043 |
| 407 | Ga0495604_0258244 | 3300047317 | Bacteria | 1185 |
| 408 | Ga0495636_0052449 | 3300047318 | Bacteria | 1711 |
| 409 | Ga0495636_0385839 | 3300047318 | Bacteria | 665 |
| 410 | Ga0495674_0044070 | 3300047319 | Bacteria | 3967 |
| 411 | Ga0495674_0048296 | 3300047319 | Bacteria | 3766 |
| 412 | Ga0495674_0121251 | 3300047319 | Bacteria | 2208 |
| 413 | Ga0495672_0083459 | 3300047320 | Bacteria | 1774 |
| 414 | Ga0495676_0184178 | 3300047321 | Bacteria | 1461 |
| 415 | Ga0495680_0034306 | 3300047322 | Bacteria | 4099 |
| 416 | Ga0495680_0109607 | 3300047322 | Bacteria | 2047 |
| 417 | Ga0495683_0009400 | 3300047323 | Bacteria | 5209 |
| 418 | Ga0495683_0019979 | 3300047323 | Bacteria | 3456 |
| 419 | Ga0495683_0023754 | 3300047323 | Bacteria | 3150 |
| 420 | Ga0495687_036872 | 3300047443 | Bacteria | 2183 |
| 421 | Ga0495679_000007 | 3300047446 | Bacteria | 401482 |
| 422 | Ga0495684_0191113 | 3300047471 | Bacteria | 1514 |
| 423 | Ga0495686_0042021 | 3300047472 | Bacteria | 2909 |
| 424 | Ga0495686_0105577 | 3300047472 | Bacteria | 1694 |
| 425 | Ga0495593_0018774 | 3300047673 | Bacteria | 3882 |
| 426 | Ga0495593_0091952 | 3300047673 | Bacteria | 1561 |
| 427 | Ga0495593_0118670 | 3300047673 | Bacteria | 1347 |
| 428 | Ga0495602_0092287 | 3300048088 | Bacteria | 2509 |
| 429 | Ga0495602_0122177 | 3300048088 | Bacteria | 2093 |
| 430 | Ga0495602_0157194 | 3300048088 | Bacteria | 1779 |
| 431 | Ga0495602_0162456 | 3300048088 | Bacteria | 1742 |
| 432 | Ga0495614_0005607 | 3300048089 | Bacteria | 5660 |
| 433 | Ga0495614_0006617 | 3300048089 | Bacteria | 5190 |
| 434 | Ga0495615_0110179 | 3300048090 | Bacteria | 787 |
| 435 | Ga0495626_0020272 | 3300048091 | Bacteria | 3315 |
| 436 | Ga0495626_0032791 | 3300048091 | Bacteria | 2492 |
| 437 | Ga0495626_0058049 | 3300048091 | Bacteria | 1770 |
| 438 | Ga0496100_0015825 | 3300048903 | Bacteria | 4413 |
| 439 | Ga0496101_0091019 | 3300048904 | Bacteria | 2269 |
| 440 | Ga0496101_0097176 | 3300048904 | Bacteria | 2199 |
| 441 | Ga0496102_0140003 | 3300048905 | Bacteria | 2268 |
| 442 | Ga0496103_0013122 | 3300048906 | Bacteria | 4912 |
| 443 | Ga0496104_0035201 | 3300048907 | Bacteria | 4675 |
| 444 | Ga0496104_0059994 | 3300048907 | Bacteria | 3603 |
| 445 | Ga0496105_0025266 | 3300048908 | Bacteria | 4833 |
| 446 | Ga0496106_0010888 | 3300048909 | Bacteria | 6719 |
| 447 | Ga0496106_0667518 | 3300048909 | Unclassified | 830 |
| 448 | Ga0496107_0012596 | 3300048910 | Bacteria | 5904 |
| 449 | Ga0496108_0043162 | 3300048911 | Bacteria | 3766 |
| 450 | Ga0496108_0274515 | 3300048911 | Bacteria | 1467 |
| 451 | Ga0496109_0082300 | 3300048912 | Bacteria | 2966 |
| 452 | Ga0496110_0009317 | 3300048913 | Bacteria | 7942 |
| 453 | Ga0496111_0053990 | 3300048914 | Bacteria | 2903 |
| 454 | Ga0496112_0013272 | 3300048915 | Bacteria | 7605 |
| 455 | Ga0496112_0193828 | 3300048915 | Bacteria | 1993 |
| 456 | Ga0496113_0017691 | 3300048916 | Bacteria | 4954 |
| 457 | Ga0496114_0007580 | 3300048917 | Bacteria | 8581 |
| 458 | Ga0496115_0020547 | 3300048918 | Bacteria | 5094 |
| 459 | Ga0496117_0031181 | 3300048920 | Bacteria | 4074 |
| 460 | Ga0496117_0124745 | 3300048920 | Bacteria | 1574 |
| 461 | Ga0496118_0011851 | 3300048921 | Bacteria | 8451 |
| 462 | Ga0496118_0019093 | 3300048921 | Bacteria | 6142 |
| 463 | Ga0496118_0021529 | 3300048921 | Bacteria | 5670 |
| 464 | Ga0496121_0228385 | 3300048924 | Bacteria | 1305 |
| 465 | Ga0496126_0310018 | 3300048929 | Bacteria | 1300 |
| 466 | Ga0495678_011639 | 3300049459 | Bacteria | 4203 |
| 467 | Ga0501032_0100351 | 3300049569 | Bacteria | 1918 |
| 468 | Ga0501034_0003885 | 3300049571 | Bacteria | 16815 |
| 469 | Ga0501034_0029278 | 3300049571 | Bacteria | 5597 |
| 470 | Ga0501034_0144853 | 3300049571 | Bacteria | 2353 |
| 471 | Ga0501034_0208241 | 3300049571 | Bacteria | 1911 |
| 472 | Ga0501034_0454368 | 3300049571 | Bacteria | 1198 |
| 473 | Ga0501036_0163756 | 3300049572 | Bacteria | 1875 |
| 474 | Ga0501037_0020022 | 3300049573 | Bacteria | 4940 |
| 475 | Ga0501038_0011338 | 3300049574 | Bacteria | 8137 |
| 476 | Ga0501039_0107136 | 3300049575 | Bacteria | 2183 |
| 477 | Ga0501043_0007910 | 3300049579 | Bacteria | 8403 |
| 478 | Ga0501043_0451399 | 3300049579 | Bacteria | 966 |
| 479 | Ga0501047_0015122 | 3300049581 | Bacteria | 7347 |
| 480 | Ga0501047_0030526 | 3300049581 | Bacteria | 5195 |
| 481 | Ga0501047_0198906 | 3300049581 | Bacteria | 1865 |
| 482 | Ga0501048_0178731 | 3300049582 | Bacteria | 1504 |
| 483 | Ga0501067_0101575 | 3300049583 | Bacteria | 1598 |
| 484 | Ga0501068_0024364 | 3300049584 | Bacteria | 3553 |
| 485 | Ga0501070_0068775 | 3300049586 | Bacteria | 2932 |
| 486 | Ga0501073_0026132 | 3300049589 | Bacteria | 4183 |
| 487 | Ga0501074_0091165 | 3300049590 | Bacteria | 2183 |
| 488 | Ga0501252_002308 | 3300049682 | Bacteria | 1882 |
| 489 | Ga0501080_0010363 | 3300049742 | Bacteria | 8524 |
| 490 | Ga0501080_0488402 | 3300049742 | Bacteria | 1101 |
| 491 | Ga0501083_0060709 | 3300049744 | Bacteria | 2525 |
| 492 | Ga0501083_0118090 | 3300049744 | Bacteria | 1740 |
| 493 | Ga0501035_0022655 | 3300049822 | Bacteria | 5770 |
| 494 | Ga0501044_0040451 | 3300049823 | Bacteria | 4859 |
| 495 | Ga0501044_0280972 | 3300049823 | Bacteria | 1598 |
| 496 | nmdc:mga03683_29007_c1 | 3300050489 | Bacteria | 2204 |
| 497 | nmdc:mga03n38_44650_c1 | 3300050490 | Bacteria | 1948 |
| 498 | nmdc:mga0k408_21731_c1 | 3300050493 | Bacteria | 3607 |
| 499 | nmdc:mga06z11_279263_c1 | 3300050494 | Bacteria | 989 |
| 500 | nmdc:mga06z11_97599_c1 | 3300050494 | Bacteria | 1606 |
| 501 | nmdc:mga04h51_85247_c1 | 3300050495 | Bacteria | 1128 |
| 502 | nmdc:mga05p37_146175_c1 | 3300050507 | Bacteria | 2895 |
| 503 | nmdc:mga05p37_56563_c1 | 3300050507 | Bacteria | 4830 |
| 504 | nmdc:mga05p37_59426_c1 | 3300050507 | Bacteria | 4708 |
| 505 | nmdc:mga09592_238893_c2 | 3300050508 | Bacteria | 1219 |
| 506 | nmdc:mga09592_655680_c1 | 3300050508 | Bacteria | 896 |
| 507 | nmdc:mga0qj67_162110_c1 | 3300050509 | Bacteria | 1815 |
| 508 | nmdc:mga06r32_1498709_c1 | 3300050510 | Bacteria | 615 |
| 509 | nmdc:mga08y16_1024065_c1 | 3300050511 | Bacteria | 804 |
| 510 | nmdc:mga08y16_478413_c1 | 3300050511 | Bacteria | 1267 |
| 511 | nmdc:mga08y16_558908_c1 | 3300050511 | Bacteria | 1157 |
| 512 | nmdc:mga0n895_196577_c1 | 3300050512 | Bacteria | 2048 |
| 513 | nmdc:mga0n895_248831_c1 | 3300050512 | Bacteria | 1804 |
| 514 | nmdc:mga0rr50_181482_c1 | 3300050513 | Bacteria | 1721 |
| 515 | nmdc:mga0rr50_781839_c1 | 3300050513 | Bacteria | 815 |
| 516 | nmdc:mga08x19_399929_c1 | 3300050514 | Bacteria | 963 |
| 517 | nmdc:mga0a205_261337_c1 | 3300050515 | Bacteria | 1609 |
| 518 | nmdc:mga0a205_540683_c1 | 3300050515 | Bacteria | 1021 |
| 519 | Ga0495601_0046194 | 3300053077 | Bacteria | 2741 |
| 520 | Ga0495601_0307652 | 3300053077 | Bacteria | 1032 |
| 521 | Ga0500647_0151008 | 3300053091 | Bacteria | 1084 |
| 522 | Ga0500595_011376 | 3300053119 | Bacteria | 3488 |
| 523 | Ga0500590_026672 | 3300053148 | Bacteria | 2997 |
| 524 | Ga0500616_0000603 | 3300053153 | Bacteria | 43497 |
| 525 | Ga0500645_000048 | 3300053730 | Bacteria | 103273 |
| 526 | Ga0501084_0584757 | 3300054114 | Bacteria | 944 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_1313259 | Ga0436363_1313259_410_949 | 151 |
| 2 | 3300046679 | Ga0495623_0539284 | Ga0495623_0539284_120_596 | 151 |
| 3 | 3300035241 | Ga0373961_0336987 | Ga0373961_0336987_12_485 | 155 |
| 4 | 3300035410 | Ga0373924_0481826 | Ga0373924_0481826_33_527 | 162 |
| 5 | 3300038996 | Ga0242420_099384 | Ga0242420_099384_104_598 | 162 |
| 6 | 3300048909 | Ga0496106_0667518 | Ga0496106_0667518_285_806 | 162 |
| 7 | 3300050509 | nmdc:mga0qj67_162110_c1 | nmdc:mga0qj67_162110_c1_516_1010 | 162 |
| 8 | 3300042876 | Ga0451577_0641786 | Ga0451577_0641786_399_899 | 163 |
| 9 | 3300013306 | Ga0163162_10041652 | Ga0163162_100416523 | 168 |
| 10 | 3300037466 | Ga0395898_0139449 | Ga0395898_0139449_1550_2071 | 169 |
| 11 | 3300035691 | Ga0373931_0148654 | Ga0373931_0148654_137_679 | 172 |
| 12 | 3300005295 | Ga0065707_10215091 | Ga0065707_102150911 | 175 |
| 13 | 3300005336 | Ga0070680_100814740 | Ga0070680_1008147401 | 175 |
| 14 | 3300005353 | Ga0070669_100218668 | Ga0070669_1002186681 | 175 |
| 15 | 3300005458 | Ga0070681_10697805 | Ga0070681_106978052 | 175 |
| 16 | 3300005535 | Ga0070684_100561707 | Ga0070684_1005617072 | 175 |
| 17 | 3300005843 | Ga0068860_101524486 | Ga0068860_1015244862 | 175 |
| 18 | 3300006173 | Ga0070716_100476996 | Ga0070716_1004769961 | 175 |
| 19 | 3300006844 | Ga0075428_100636678 | Ga0075428_1006366782 | 175 |
| 20 | 3300006846 | Ga0075430_100240608 | Ga0075430_1002406082 | 175 |
| 21 | 3300006847 | Ga0075431_100396136 | Ga0075431_1003961362 | 175 |
| 22 | 3300006852 | Ga0075433_10077157 | Ga0075433_100771573 | 175 |
| 23 | 3300006852 | Ga0075433_10231541 | Ga0075433_102315412 | 175 |
| 24 | 3300006871 | Ga0075434_100127256 | Ga0075434_1001272563 | 175 |
| 25 | 3300006871 | Ga0075434_100168759 | Ga0075434_1001687591 | 175 |
| 26 | 3300006880 | Ga0075429_100724610 | Ga0075429_1007246101 | 175 |
| 27 | 3300006914 | Ga0075436_100242896 | Ga0075436_1002428962 | 175 |
| 28 | 3300007076 | Ga0075435_100476687 | Ga0075435_1004766872 | 175 |
| 29 | 3300009094 | Ga0111539_10317799 | Ga0111539_103177992 | 175 |
| 30 | 3300009147 | Ga0114129_10053597 | Ga0114129_100535974 | 175 |
| 31 | 3300009147 | Ga0114129_10101997 | Ga0114129_101019974 | 175 |
| 32 | 3300009176 | Ga0105242_11058973 | Ga0105242_110589731 | 175 |
| 33 | 3300009177 | Ga0105248_10304508 | Ga0105248_103045082 | 175 |
| 34 | 3300013308 | Ga0157375_10980136 | Ga0157375_109801361 | 175 |
| 35 | 3300014968 | Ga0157379_10786355 | Ga0157379_107863551 | 175 |
| 36 | 3300025917 | Ga0207660_10667758 | Ga0207660_106677581 | 175 |
| 37 | 3300025941 | Ga0207711_10771593 | Ga0207711_107715931 | 175 |
| 38 | 3300035086 | Ga0373934_0163697 | Ga0373934_0163697_305_838 | 175 |
| 39 | 3300035172 | Ga0373955_0451953 | Ga0373955_0451953_112_645 | 175 |
| 40 | 3300035691 | Ga0373931_0616099 | Ga0373931_0616099_154_687 | 175 |
| 41 | 3300036401 | Ga0373937_1257105 | Ga0373937_1257105_80_613 | 175 |
| 42 | 3300045051 | Ga0451576_1137445 | Ga0451576_1137445_13_546 | 175 |
| 43 | 3300046511 | Ga0495608_0459800 | Ga0495608_0459800_76_609 | 175 |
| 44 | 3300046536 | Ga0495587_0373384 | Ga0495587_0373384_50_583 | 175 |
| 45 | 3300046558 | Ga0495633_0291110 | Ga0495633_0291110_66_599 | 175 |
| 46 | 3300046664 | Ga0495659_0161391 | Ga0495659_0161391_348_881 | 175 |
| 47 | 3300047318 | Ga0495636_0052449 | Ga0495636_0052449_1160_1693 | 175 |
| 48 | 3300050507 | nmdc:mga05p37_146175_c1 | nmdc:mga05p37_146175_c1_1948_2481 | 175 |
| 49 | 3300050507 | nmdc:mga05p37_56563_c1 | nmdc:mga05p37_56563_c1_2313_2846 | 175 |
| 50 | 3300050507 | nmdc:mga05p37_59426_c1 | nmdc:mga05p37_59426_c1_1276_1809 | 175 |
| 51 | 3300050508 | nmdc:mga09592_238893_c2 | nmdc:mga09592_238893_c2_65_598 | 175 |
| 52 | 3300050508 | nmdc:mga09592_655680_c1 | nmdc:mga09592_655680_c1_122_655 | 175 |
| 53 | 3300050510 | nmdc:mga06r32_1498709_c1 | nmdc:mga06r32_1498709_c1_39_572 | 175 |
| 54 | 3300050511 | nmdc:mga08y16_558908_c1 | nmdc:mga08y16_558908_c1_398_931 | 175 |
| 55 | 3300050512 | nmdc:mga0n895_196577_c1 | nmdc:mga0n895_196577_c1_877_1410 | 175 |
| 56 | 3300050512 | nmdc:mga0n895_248831_c1 | nmdc:mga0n895_248831_c1_582_1115 | 175 |
| 57 | 3300050513 | nmdc:mga0rr50_181482_c1 | nmdc:mga0rr50_181482_c1_335_868 | 175 |
| 58 | 3300050513 | nmdc:mga0rr50_781839_c1 | nmdc:mga0rr50_781839_c1_63_596 | 175 |
| 59 | 3300050514 | nmdc:mga08x19_399929_c1 | nmdc:mga08x19_399929_c1_153_686 | 175 |
| 60 | 3300050515 | nmdc:mga0a205_261337_c1 | nmdc:mga0a205_261337_c1_904_1437 | 175 |
| 61 | 3300050515 | nmdc:mga0a205_540683_c1 | nmdc:mga0a205_540683_c1_124_657 | 175 |
| 62 | 3300046501 | Ga0495607_0419986 | Ga0495607_0419986_13_543 | 176 |
| 63 | 3300047318 | Ga0495636_0385839 | Ga0495636_0385839_84_650 | 180 |
| 64 | 3300005841 | Ga0068863_101495169 | Ga0068863_1014951691 | 181 |
| 65 | 3300025912 | Ga0207707_10785228 | Ga0207707_107852282 | 181 |
| 66 | 3300025960 | Ga0207651_11034254 | Ga0207651_110342541 | 181 |
| 67 | 3300031727 | Ga0316576_10698563 | Ga0316576_106985631 | 181 |
| 68 | 3300046471 | Ga0495650_0034988 | Ga0495650_0034988_46_624 | 181 |
| 69 | 3300046535 | Ga0495586_0489443 | Ga0495586_0489443_26_586 | 181 |
| 70 | 3300046684 | Ga0495669_0390043 | Ga0495669_0390043_33_593 | 181 |
| 71 | 3300005356 | Ga0070674_100052636 | Ga0070674_1000526363 | 182 |
| 72 | 3300005364 | Ga0070673_100150943 | Ga0070673_1001509431 | 182 |
| 73 | 3300005456 | Ga0070678_101012649 | Ga0070678_1010126491 | 182 |
| 74 | 3300005548 | Ga0070665_100303922 | Ga0070665_1003039222 | 182 |
| 75 | 3300006353 | Ga0075370_10032793 | Ga0075370_100327933 | 183 |
| 76 | 3300025904 | Ga0207647_10025467 | Ga0207647_100254673 | 183 |
| 77 | 3300050489 | nmdc:mga03683_29007_c1 | nmdc:mga03683_29007_c1_1597_2172 | 183 |
| 78 | 3300050490 | nmdc:mga03n38_44650_c1 | nmdc:mga03n38_44650_c1_1203_1778 | 183 |
| 79 | 3300050493 | nmdc:mga0k408_21731_c1 | nmdc:mga0k408_21731_c1_1200_1775 | 183 |
| 80 | 3300050494 | nmdc:mga06z11_97599_c1 | nmdc:mga06z11_97599_c1_510_1085 | 183 |
| 81 | 3300002075 | JGI24738J21930_10001268 | JGI24738J21930_100012683 | 185 |
| 82 | 3300014497 | Ga0182008_10026033 | Ga0182008_100260332 | 185 |
| 83 | 3300046507 | Ga0495606_0080382 | Ga0495606_0080382_1193_1816 | 185 |
| 84 | 3300049571 | Ga0501034_0144853 | Ga0501034_0144853_1715_2296 | 185 |
| 85 | 3300049571 | Ga0501034_0454368 | Ga0501034_0454368_560_1141 | 185 |
| 86 | 3300049579 | Ga0501043_0451399 | Ga0501043_0451399_220_801 | 185 |
| 87 | 3300049581 | Ga0501047_0198906 | Ga0501047_0198906_1091_1672 | 185 |
| 88 | 3300013105 | Ga0157369_10214911 | Ga0157369_102149111 | 186 |
| 89 | 3300046500 | Ga0495596_0034101 | Ga0495596_0034101_89_712 | 186 |
| 90 | 3300048920 | Ga0496117_0031181 | Ga0496117_0031181_748_1371 | 186 |
| 91 | 3300048921 | Ga0496118_0011851 | Ga0496118_0011851_4722_5345 | 186 |
| 92 | 3300005471 | Ga0070698_100021013 | Ga0070698_1000210135 | 187 |
| 93 | 3300005518 | Ga0070699_100003337 | Ga0070699_10000333710 | 187 |
| 94 | 3300025914 | Ga0207671_10013631 | Ga0207671_100136315 | 187 |
| 95 | 3300025922 | Ga0207646_11073116 | Ga0207646_110731162 | 187 |
| 96 | 3300028381 | Ga0268264_10378075 | Ga0268264_103780752 | 187 |
| 97 | 3300031507 | Ga0307509_10006490 | Ga0307509_1000649010 | 187 |
| 98 | 3300031730 | Ga0307516_10235896 | Ga0307516_102358962 | 187 |
| 99 | 3300048907 | Ga0496104_0059994 | Ga0496104_0059994_2077_2706 | 187 |
| 100 | 3300049581 | Ga0501047_0030526 | Ga0501047_0030526_547_1158 | 187 |
| 101 | 3300053730 | Ga0500645_000048 | Ga0500645_000048_35837_36505 | 187 |
| 102 | iso_pu_bacteria | 2508501125 | 2509129267 | 187 |
| 103 | 3300031616 | Ga0307508_10000108 | Ga0307508_100001081 | 188 |
| 104 | 3300035171 | Ga0373946_0349325 | Ga0373946_0349325_90_665 | 188 |
| 105 | 3300042876 | Ga0451577_0001798 | Ga0451577_0001798_10194_10775 | 188 |
| 106 | 3300042876 | Ga0451577_0004743 | Ga0451577_0004743_10214_10795 | 188 |
| 107 | 3300044712 | Ga0453684_0050546 | Ga0453684_0050546_3000_3581 | 188 |
| 108 | iso_pu_bacteria | 2744054900 | 2746086511 | 188 |
| 109 | iso_pu_bacteria | 2744054901 | 2746093910 | 188 |
| 110 | iso_pu_bacteria | 2842324504 | 2842328863 | 188 |
| 111 | iso_pu_bacteria | 2842348783 | 2842353718 | 188 |
| 112 | iso_pu_bacteria | 2842454564 | 2842459194 | 188 |
| 113 | 3300003756 | Ga0055533_1000175 | Ga0055533_10001759 | 189 |
| 114 | 3300003756 | Ga0055533_1000234 | Ga0055533_100023414 | 189 |
| 115 | 3300003856 | Ga0058692_1020413 | Ga0058692_10204132 | 189 |
| 116 | 3300009551 | Ga0105238_10252943 | Ga0105238_102529432 | 189 |
| 117 | 3300020081 | Ga0206354_11182836 | Ga0206354_111828362 | 189 |
| 118 | 3300025226 | Ga0209674_100017 | Ga0209674_100017157 | 189 |
| 119 | 3300025226 | Ga0209674_100085 | Ga0209674_10008564 | 189 |
| 120 | 3300025913 | Ga0207695_10321335 | Ga0207695_103213352 | 189 |
| 121 | 3300025945 | Ga0207679_10190530 | Ga0207679_101905302 | 189 |
| 122 | 3300027312 | Ga0209371_1002008 | Ga0209371_10020086 | 189 |
| 123 | 3300030500 | Ga0268256_1001757 | Ga0268256_10017573 | 189 |
| 124 | 3300037418 | Ga0395900_0041674 | Ga0395900_0041674_1488_2075 | 189 |
| 125 | 3300038443 | Ga0395901_0037001 | Ga0395901_0037001_1916_2503 | 189 |
| 126 | 3300053153 | Ga0500616_0000603 | Ga0500616_0000603_27277_27909 | 189 |
| 127 | 3300003758 | Ga0055532_1000031 | Ga0055532_1000031216 | 190 |
| 128 | 3300003760 | Ga0055527_1000020 | Ga0055527_1000020216 | 190 |
| 129 | 3300003761 | Ga0055535_1000023 | Ga0055535_10000233 | 190 |
| 130 | 3300003762 | Ga0055542_1000035 | Ga0055542_1000035216 | 190 |
| 131 | 3300003763 | Ga0055529_1000039 | Ga0055529_10000393 | 190 |
| 132 | 3300005327 | Ga0070658_10237045 | Ga0070658_102370452 | 190 |
| 133 | 3300005329 | Ga0070683_100147792 | Ga0070683_1001477922 | 190 |
| 134 | 3300005339 | Ga0070660_100886136 | Ga0070660_1008861361 | 190 |
| 135 | 3300005344 | Ga0070661_100311382 | Ga0070661_1003113822 | 190 |
| 136 | 3300005366 | Ga0070659_100114744 | Ga0070659_1001147442 | 190 |
| 137 | 3300005535 | Ga0070684_100155033 | Ga0070684_1001550332 | 190 |
| 138 | 3300005539 | Ga0068853_100762296 | Ga0068853_1007622961 | 190 |
| 139 | 3300005563 | Ga0068855_100104012 | Ga0068855_1001040124 | 190 |
| 140 | 3300005563 | Ga0068855_100709611 | Ga0068855_1007096111 | 190 |
| 141 | 3300005564 | Ga0070664_100131617 | Ga0070664_1001316172 | 190 |
| 142 | 3300005614 | Ga0068856_100072329 | Ga0068856_1000723294 | 190 |
| 143 | 3300005616 | Ga0068852_100120901 | Ga0068852_1001209012 | 190 |
| 144 | 3300013105 | Ga0157369_10261033 | Ga0157369_102610332 | 190 |
| 145 | 3300013307 | Ga0157372_10150560 | Ga0157372_101505602 | 190 |
| 146 | 3300025228 | Ga0209672_100001 | Ga0209672_1000012094 | 190 |
| 147 | 3300025229 | Ga0209147_100001 | Ga0209147_1000012094 | 190 |
| 148 | 3300025242 | Ga0209258_100001 | Ga0209258_1000012094 | 190 |
| 149 | 3300025254 | Ga0209148_1000003 | Ga0209148_10000032094 | 190 |
| 150 | 3300025272 | Ga0209455_1000001 | Ga0209455_10000012094 | 190 |
| 151 | 3300025911 | Ga0207654_10435032 | Ga0207654_104350322 | 190 |
| 152 | 3300025924 | Ga0207694_10642357 | Ga0207694_106423572 | 190 |
| 153 | 3300025932 | Ga0207690_10383583 | Ga0207690_103835832 | 190 |
| 154 | 3300025944 | Ga0207661_10016764 | Ga0207661_100167645 | 190 |
| 155 | 3300025949 | Ga0207667_10354487 | Ga0207667_103544872 | 190 |
| 156 | 3300026035 | Ga0207703_10552631 | Ga0207703_105526311 | 190 |
| 157 | 3300026041 | Ga0207639_10280476 | Ga0207639_102804762 | 190 |
| 158 | 3300026078 | Ga0207702_10295357 | Ga0207702_102953572 | 190 |
| 159 | 3300026142 | Ga0207698_10330091 | Ga0207698_103300912 | 190 |
| 160 | 3300042876 | Ga0451577_0892657 | Ga0451577_0892657_207_785 | 190 |
| 161 | 3300045051 | Ga0451576_0099519 | Ga0451576_0099519_1023_1640 | 190 |
| 162 | 3300046507 | Ga0495606_0016303 | Ga0495606_0016303_3652_4287 | 190 |
| 163 | 3300047323 | Ga0495683_0009400 | Ga0495683_0009400_478_1113 | 190 |
| 164 | 3300047443 | Ga0495687_036872 | Ga0495687_036872_655_1290 | 190 |
| 165 | 3300048091 | Ga0495626_0032791 | Ga0495626_0032791_971_1606 | 190 |
| 166 | 3300049742 | Ga0501080_0488402 | Ga0501080_0488402_499_1080 | 190 |
| 167 | 3300049744 | Ga0501083_0060709 | Ga0501083_0060709_1194_1775 | 190 |
| 168 | 3300054114 | Ga0501084_0584757 | Ga0501084_0584757_232_813 | 190 |
| 169 | iso_pu_bacteria | 2513237151 | 2513959347 | 190 |
| 170 | iso_pu_bacteria | 2526164713 | 2527080162 | 190 |
| 171 | iso_pu_bacteria | 2738541296 | 2738822363 | 190 |
| 172 | iso_pu_bacteria | 2738541298 | 2738835820 | 190 |
| 173 | iso_pu_bacteria | 2738541306 | 2738876049 | 190 |
| 174 | iso_pu_bacteria | 2738543002 | 2739188001 | 190 |
| 175 | iso_pu_bacteria | 2738543008 | 2739222647 | 190 |
| 176 | iso_pu_bacteria | 2900634093 | 2900636565 | 190 |
| 177 | iso_pu_bacteria | 2945934425 | 2945935071 | 190 |
| 178 | iso_pu_bacteria | 2990703756 | 2990704337 | 190 |
| 179 | iso_pu_bacteria | 641736151 | 642422490 | 190 |
| 180 | iso_pu_bacteria | 642555113 | 642619975 | 190 |
| 181 | 3300001979 | JGI24740J21852_10003389 | JGI24740J21852_100033893 | 191 |
| 182 | 3300005339 | Ga0070660_100970553 | Ga0070660_1009705531 | 191 |
| 183 | 3300031730 | Ga0307516_10000908 | Ga0307516_1000090821 | 191 |
| 184 | 3300046529 | Ga0495652_0100723 | Ga0495652_0100723_455_1063 | 191 |
| 185 | 3300053148 | Ga0500590_026672 | Ga0500590_026672_1852_2445 | 191 |
| 186 | iso_pu_bacteria | 2857537821 | 2857538916 | 191 |
| 187 | iso_pu_bacteria | 8055301274 | 8055304223 | 191 |
| 188 | 3300002244 | JGI24742J22300_10007474 | JGI24742J22300_100074742 | 192 |
| 189 | 3300005548 | Ga0070665_100162598 | Ga0070665_1001625982 | 192 |
| 190 | 3300005843 | Ga0068860_100000433 | Ga0068860_10000043320 | 192 |
| 191 | 3300028381 | Ga0268264_10000062 | Ga0268264_1000006267 | 192 |
| 192 | 3300031507 | Ga0307509_10220729 | Ga0307509_102207292 | 192 |
| 193 | 3300031548 | Ga0307408_100005169 | Ga0307408_1000051696 | 192 |
| 194 | 3300031903 | Ga0307407_10163530 | Ga0307407_101635301 | 192 |
| 195 | 3300031995 | Ga0307409_100529907 | Ga0307409_1005299071 | 192 |
| 196 | 3300046471 | Ga0495650_0026693 | Ga0495650_0026693_517_1134 | 192 |
| 197 | iso_pu_bacteria | 2818991450 | 2819625183 | 192 |
| 198 | iso_pu_bacteria | 2928108538 | 2928109357 | 192 |
| 199 | iso_pu_bacteria | 2928135762 | 2928137189 | 192 |
| 200 | iso_pu_bacteria | 2928503688 | 2928509888 | 192 |
| 201 | iso_pu_bacteria | 8055266321 | 8055268024 | 192 |
| 202 | 3300014968 | Ga0157379_10045233 | Ga0157379_100452333 | 193 |
| 203 | 3300039062 | Ga0400483_217610 | Ga0400483_217610_144_752 | 193 |
| 204 | 3300039093 | Ga0400489_18479 | Ga0400489_18479_1235_1843 | 193 |
| 205 | 3300050511 | nmdc:mga08y16_1024065_c1 | nmdc:mga08y16_1024065_c1_95_697 | 193 |
| 206 | 3300002705 | JGI25156J39149_1002719 | JGI25156J39149_10027194 | 194 |
| 207 | 3300002705 | JGI25156J39149_1004311 | JGI25156J39149_10043111 | 194 |
| 208 | 3300003756 | Ga0055533_1004342 | Ga0055533_10043421 | 194 |
| 209 | 3300005455 | Ga0070663_100064656 | Ga0070663_1000646562 | 194 |
| 210 | 3300014325 | Ga0163163_10027358 | Ga0163163_100273584 | 194 |
| 211 | 3300021388 | Ga0213875_10002701 | Ga0213875_100027017 | 194 |
| 212 | 3300025226 | Ga0209674_100143 | Ga0209674_10014360 | 194 |
| 213 | 3300025256 | Ga0209759_1000092 | Ga0209759_1000092152 | 194 |
| 214 | 3300025256 | Ga0209759_1000200 | Ga0209759_10002005 | 194 |
| 215 | 3300031249 | Ga0265339_10000627 | Ga0265339_100006278 | 194 |
| 216 | 3300031250 | Ga0265331_10076029 | Ga0265331_100760292 | 194 |
| 217 | 3300031595 | Ga0265313_10094128 | Ga0265313_100941281 | 194 |
| 218 | 3300031711 | Ga0265314_10001008 | Ga0265314_1000100824 | 194 |
| 219 | 3300031712 | Ga0265342_10043832 | Ga0265342_100438324 | 194 |
| 220 | 3300031911 | Ga0307412_10000014 | Ga0307412_10000014299 | 194 |
| 221 | 3300037853 | Ga0436364_0567892 | Ga0436364_0567892_6284_6904 | 194 |
| 222 | 3300046457 | Ga0495590_0025822 | Ga0495590_0025822_1159_1773 | 194 |
| 223 | 3300046459 | Ga0495629_0000034 | Ga0495629_0000034_75332_75946 | 194 |
| 224 | 3300046460 | Ga0495638_0015393 | Ga0495638_0015393_2156_2770 | 194 |
| 225 | 3300046462 | Ga0495651_0104894 | Ga0495651_0104894_845_1459 | 194 |
| 226 | 3300046463 | Ga0495653_0001766 | Ga0495653_0001766_9334_9948 | 194 |
| 227 | 3300046471 | Ga0495650_0019198 | Ga0495650_0019198_2256_2870 | 194 |
| 228 | 3300046472 | Ga0495580_0006375 | Ga0495580_0006375_4925_5539 | 194 |
| 229 | 3300046472 | Ga0495580_0007438 | Ga0495580_0007438_2669_3283 | 194 |
| 230 | 3300046474 | Ga0495605_0002834 | Ga0495605_0002834_8839_9453 | 194 |
| 231 | 3300046477 | Ga0495664_0069254 | Ga0495664_0069254_399_1013 | 194 |
| 232 | 3300046491 | Ga0495584_0170052 | Ga0495584_0170052_357_971 | 194 |
| 233 | 3300046491 | Ga0495584_0349168 | Ga0495584_0349168_27_656 | 194 |
| 234 | 3300046506 | Ga0495583_0003116 | Ga0495583_0003116_664_1278 | 194 |
| 235 | 3300046507 | Ga0495606_0018047 | Ga0495606_0018047_3199_3813 | 194 |
| 236 | 3300046514 | Ga0495618_0121028 | Ga0495618_0121028_1027_1641 | 194 |
| 237 | 3300046515 | Ga0495620_0003580 | Ga0495620_0003580_3534_4148 | 194 |
| 238 | 3300046516 | Ga0495628_0009315 | Ga0495628_0009315_4719_5333 | 194 |
| 239 | 3300046517 | Ga0495630_0092904 | Ga0495630_0092904_1001_1615 | 194 |
| 240 | 3300046522 | Ga0495643_0092994 | Ga0495643_0092994_642_1271 | 194 |
| 241 | 3300046528 | Ga0495642_0020732 | Ga0495642_0020732_1895_2524 | 194 |
| 242 | 3300046531 | Ga0495665_0038461 | Ga0495665_0038461_926_1540 | 194 |
| 243 | 3300046542 | Ga0495597_0006041 | Ga0495597_0006041_5433_6062 | 194 |
| 244 | 3300046616 | Ga0495668_0203386 | Ga0495668_0203386_366_995 | 194 |
| 245 | 3300046665 | Ga0495661_0007205 | Ga0495661_0007205_7025_7654 | 194 |
| 246 | 3300046665 | Ga0495661_0036075 | Ga0495661_0036075_508_1122 | 194 |
| 247 | 3300046680 | Ga0495646_0037504 | Ga0495646_0037504_1090_1704 | 194 |
| 248 | 3300046689 | Ga0495613_0020732 | Ga0495613_0020732_1117_1731 | 194 |
| 249 | 3300046690 | Ga0495624_0002128 | Ga0495624_0002128_13061_13675 | 194 |
| 250 | 3300046690 | Ga0495624_0030098 | Ga0495624_0030098_951_1565 | 194 |
| 251 | 3300046694 | Ga0495649_0080110 | Ga0495649_0080110_501_1115 | 194 |
| 252 | 3300047317 | Ga0495604_0011449 | Ga0495604_0011449_2716_3342 | 194 |
| 253 | 3300047319 | Ga0495674_0044070 | Ga0495674_0044070_1480_2094 | 194 |
| 254 | 3300047319 | Ga0495674_0048296 | Ga0495674_0048296_1875_2489 | 194 |
| 255 | 3300047320 | Ga0495672_0083459 | Ga0495672_0083459_244_858 | 194 |
| 256 | 3300047321 | Ga0495676_0184178 | Ga0495676_0184178_197_811 | 194 |
| 257 | 3300047322 | Ga0495680_0109607 | Ga0495680_0109607_270_896 | 194 |
| 258 | 3300047323 | Ga0495683_0019979 | Ga0495683_0019979_58_672 | 194 |
| 259 | 3300047446 | Ga0495679_000007 | Ga0495679_000007_300009_300623 | 194 |
| 260 | 3300047472 | Ga0495686_0042021 | Ga0495686_0042021_1593_2207 | 194 |
| 261 | 3300047472 | Ga0495686_0105577 | Ga0495686_0105577_34_648 | 194 |
| 262 | 3300047673 | Ga0495593_0018774 | Ga0495593_0018774_1395_2009 | 194 |
| 263 | 3300048088 | Ga0495602_0092287 | Ga0495602_0092287_1038_1652 | 194 |
| 264 | 3300048088 | Ga0495602_0122177 | Ga0495602_0122177_785_1399 | 194 |
| 265 | 3300048091 | Ga0495626_0020272 | Ga0495626_0020272_2115_2729 | 194 |
| 266 | 3300048920 | Ga0496117_0124745 | Ga0496117_0124745_270_884 | 194 |
| 267 | 3300048921 | Ga0496118_0019093 | Ga0496118_0019093_1654_2268 | 194 |
| 268 | 3300048929 | Ga0496126_0310018 | Ga0496126_0310018_613_1227 | 194 |
| 269 | 3300049459 | Ga0495678_011639 | Ga0495678_011639_18_632 | 194 |
| 270 | 3300049569 | Ga0501032_0100351 | Ga0501032_0100351_128_736 | 194 |
| 271 | 3300049571 | Ga0501034_0208241 | Ga0501034_0208241_695_1303 | 194 |
| 272 | 3300049572 | Ga0501036_0163756 | Ga0501036_0163756_779_1387 | 194 |
| 273 | 3300049573 | Ga0501037_0020022 | Ga0501037_0020022_2720_3328 | 194 |
| 274 | 3300049574 | Ga0501038_0011338 | Ga0501038_0011338_5476_6084 | 194 |
| 275 | 3300049575 | Ga0501039_0107136 | Ga0501039_0107136_154_762 | 194 |
| 276 | 3300049579 | Ga0501043_0007910 | Ga0501043_0007910_406_1014 | 194 |
| 277 | 3300049581 | Ga0501047_0015122 | Ga0501047_0015122_1549_2157 | 194 |
| 278 | 3300049582 | Ga0501048_0178731 | Ga0501048_0178731_850_1458 | 194 |
| 279 | 3300049583 | Ga0501067_0101575 | Ga0501067_0101575_695_1303 | 194 |
| 280 | 3300049586 | Ga0501070_0068775 | Ga0501070_0068775_1848_2456 | 194 |
| 281 | 3300049589 | Ga0501073_0026132 | Ga0501073_0026132_2551_3159 | 194 |
| 282 | 3300049590 | Ga0501074_0091165 | Ga0501074_0091165_1016_1624 | 194 |
| 283 | 3300049742 | Ga0501080_0010363 | Ga0501080_0010363_6254_6862 | 194 |
| 284 | 3300049744 | Ga0501083_0118090 | Ga0501083_0118090_183_791 | 194 |
| 285 | 3300049822 | Ga0501035_0022655 | Ga0501035_0022655_740_1348 | 194 |
| 286 | 3300049823 | Ga0501044_0280972 | Ga0501044_0280972_360_968 | 194 |
| 287 | 3300053091 | Ga0500647_0151008 | Ga0500647_0151008_167_790 | 194 |
| 288 | 3300053119 | Ga0500595_011376 | Ga0500595_011376_2259_2870 | 194 |
| 289 | iso_pu_bacteria | 2904483920 | 2904488382 | 194 |
| 290 | iso_pu_bacteria | 2919527303 | 2919531998 | 194 |
| 291 | 3300007788 | Ga0099795_10002946 | Ga0099795_100029463 | 195 |
| 292 | 3300010159 | Ga0099796_10004984 | Ga0099796_100049843 | 195 |
| 293 | 3300044694 | Ga0466963_0073993 | Ga0466963_0073993_1378_1995 | 195 |
| 294 | 3300049571 | Ga0501034_0003885 | Ga0501034_0003885_6247_6864 | 195 |
| 295 | 3300049571 | Ga0501034_0029278 | Ga0501034_0029278_3861_4475 | 195 |
| 296 | 3300049584 | Ga0501068_0024364 | Ga0501068_0024364_1356_1973 | 195 |
| 297 | 3300049823 | Ga0501044_0040451 | Ga0501044_0040451_1461_2078 | 195 |
| 298 | 3300001989 | JGI24739J22299_10002488 | JGI24739J22299_100024883 | 196 |
| 299 | 3300001989 | JGI24739J22299_10016174 | JGI24739J22299_100161742 | 196 |
| 300 | 3300002067 | JGI24735J21928_10036658 | JGI24735J21928_100366582 | 196 |
| 301 | 3300005367 | Ga0070667_100049175 | Ga0070667_1000491752 | 196 |
| 302 | 3300009011 | Ga0105251_10000269 | Ga0105251_100002693 | 196 |
| 303 | 3300009011 | Ga0105251_10063827 | Ga0105251_100638272 | 196 |
| 304 | 3300013105 | Ga0157369_10252038 | Ga0157369_102520382 | 196 |
| 305 | 3300015262 | Ga0182007_10002279 | Ga0182007_100022794 | 196 |
| 306 | 3300025735 | Ga0207713_1000435 | Ga0207713_100043540 | 196 |
| 307 | 3300025735 | Ga0207713_1105724 | Ga0207713_11057242 | 196 |
| 308 | 3300025904 | Ga0207647_10012684 | Ga0207647_100126843 | 196 |
| 309 | 3300025904 | Ga0207647_10059672 | Ga0207647_100596722 | 196 |
| 310 | 3300041404 | Ga0439436_0051993 | Ga0439436_0051993_361_1014 | 196 |
| 311 | 3300046454 | Ga0495592_0118473 | Ga0495592_0118473_531_1157 | 196 |
| 312 | 3300046459 | Ga0495629_0007389 | Ga0495629_0007389_140_766 | 196 |
| 313 | 3300046461 | Ga0495641_0027950 | Ga0495641_0027950_1154_1780 | 196 |
| 314 | 3300046463 | Ga0495653_0083128 | Ga0495653_0083128_268_894 | 196 |
| 315 | 3300046471 | Ga0495650_0019002 | Ga0495650_0019002_1610_2236 | 196 |
| 316 | 3300046473 | Ga0495582_0015387 | Ga0495582_0015387_3354_3980 | 196 |
| 317 | 3300046477 | Ga0495664_0009482 | Ga0495664_0009482_1139_1765 | 196 |
| 318 | 3300046477 | Ga0495664_0123795 | Ga0495664_0123795_498_1133 | 196 |
| 319 | 3300046514 | Ga0495618_0050693 | Ga0495618_0050693_1565_2191 | 196 |
| 320 | 3300046516 | Ga0495628_0212788 | Ga0495628_0212788_322_957 | 196 |
| 321 | 3300046517 | Ga0495630_0056510 | Ga0495630_0056510_1490_2116 | 196 |
| 322 | 3300046526 | Ga0495666_0026793 | Ga0495666_0026793_1405_2031 | 196 |
| 323 | 3300046529 | Ga0495652_0005229 | Ga0495652_0005229_7647_8273 | 196 |
| 324 | 3300046533 | Ga0495640_0026178 | Ga0495640_0026178_1566_2192 | 196 |
| 325 | 3300046543 | Ga0495645_0088887 | Ga0495645_0088887_824_1450 | 196 |
| 326 | 3300046559 | Ga0495667_0069190 | Ga0495667_0069190_318_944 | 196 |
| 327 | 3300046642 | Ga0495634_0014874 | Ga0495634_0014874_1319_1945 | 196 |
| 328 | 3300046675 | Ga0495657_0015754 | Ga0495657_0015754_3871_4497 | 196 |
| 329 | 3300046679 | Ga0495623_0014711 | Ga0495623_0014711_748_1374 | 196 |
| 330 | 3300046680 | Ga0495646_0010051 | Ga0495646_0010051_1392_2018 | 196 |
| 331 | 3300046689 | Ga0495613_0168259 | Ga0495613_0168259_82_708 | 196 |
| 332 | 3300046794 | Ga0495589_0092619 | Ga0495589_0092619_10_636 | 196 |
| 333 | 3300047319 | Ga0495674_0121251 | Ga0495674_0121251_145_771 | 196 |
| 334 | 3300047322 | Ga0495680_0034306 | Ga0495680_0034306_520_1146 | 196 |
| 335 | 3300047323 | Ga0495683_0023754 | Ga0495683_0023754_1108_1734 | 196 |
| 336 | 3300047471 | Ga0495684_0191113 | Ga0495684_0191113_181_807 | 196 |
| 337 | 3300047673 | Ga0495593_0091952 | Ga0495593_0091952_648_1274 | 196 |
| 338 | 3300048088 | Ga0495602_0162456 | Ga0495602_0162456_621_1256 | 196 |
| 339 | 3300048089 | Ga0495614_0005607 | Ga0495614_0005607_1381_2007 | 196 |
| 340 | 3300048921 | Ga0496118_0021529 | Ga0496118_0021529_3797_4426 | 196 |
| 341 | 3300002067 | JGI24735J21928_10022697 | JGI24735J21928_100226972 | 197 |
| 342 | 3300002705 | JGI25156J39149_1001787 | JGI25156J39149_10017874 | 197 |
| 343 | 3300003214 | JGI25165J46597_1001807 | JGI25165J46597_10018072 | 197 |
| 344 | 3300025231 | Ga0207427_101362 | Ga0207427_1013624 | 197 |
| 345 | 3300025256 | Ga0209759_1000037 | Ga0209759_100003790 | 197 |
| 346 | 3300025261 | Ga0209233_1000123 | Ga0209233_10001233 | 197 |
| 347 | 3300031595 | Ga0265313_10009581 | Ga0265313_100095814 | 197 |
| 348 | 3300046459 | Ga0495629_0001013 | Ga0495629_0001013_9974_10603 | 197 |
| 349 | 3300046462 | Ga0495651_0007769 | Ga0495651_0007769_3453_4073 | 197 |
| 350 | 3300046462 | Ga0495651_0252380 | Ga0495651_0252380_438_1067 | 197 |
| 351 | 3300046463 | Ga0495653_0146215 | Ga0495653_0146215_555_1184 | 197 |
| 352 | 3300046471 | Ga0495650_0001635 | Ga0495650_0001635_11696_12325 | 197 |
| 353 | 3300046472 | Ga0495580_0004501 | Ga0495580_0004501_10322_10951 | 197 |
| 354 | 3300046476 | Ga0495662_0062221 | Ga0495662_0062221_67_696 | 197 |
| 355 | 3300046501 | Ga0495607_0205520 | Ga0495607_0205520_252_881 | 197 |
| 356 | 3300046511 | Ga0495608_0149753 | Ga0495608_0149753_333_953 | 197 |
| 357 | 3300046513 | Ga0495616_0161638 | Ga0495616_0161638_301_930 | 197 |
| 358 | 3300046517 | Ga0495630_0208177 | Ga0495630_0208177_451_1080 | 197 |
| 359 | 3300046520 | Ga0495637_0056139 | Ga0495637_0056139_810_1421 | 197 |
| 360 | 3300046528 | Ga0495642_0001699 | Ga0495642_0001699_4008_4637 | 197 |
| 361 | 3300046529 | Ga0495652_0054217 | Ga0495652_0054217_356_976 | 197 |
| 362 | 3300046530 | Ga0495654_0082615 | Ga0495654_0082615_691_1320 | 197 |
| 363 | 3300046531 | Ga0495665_0022320 | Ga0495665_0022320_1949_2578 | 197 |
| 364 | 3300046543 | Ga0495645_0001014 | Ga0495645_0001014_11693_12322 | 197 |
| 365 | 3300046674 | Ga0495588_0010689 | Ga0495588_0010689_1267_1896 | 197 |
| 366 | 3300046679 | Ga0495623_0013794 | Ga0495623_0013794_3323_3943 | 197 |
| 367 | 3300046680 | Ga0495646_0024779 | Ga0495646_0024779_2081_2710 | 197 |
| 368 | 3300046684 | Ga0495669_0013198 | Ga0495669_0013198_2464_3093 | 197 |
| 369 | 3300046689 | Ga0495613_0024240 | Ga0495613_0024240_2727_3356 | 197 |
| 370 | 3300046794 | Ga0495589_0003147 | Ga0495589_0003147_7166_7795 | 197 |
| 371 | 3300047315 | Ga0495581_0000534 | Ga0495581_0000534_6826_7455 | 197 |
| 372 | 3300047673 | Ga0495593_0118670 | Ga0495593_0118670_52_681 | 197 |
| 373 | 3300048088 | Ga0495602_0157194 | Ga0495602_0157194_27_641 | 197 |
| 374 | 3300048089 | Ga0495614_0006617 | Ga0495614_0006617_3282_3911 | 197 |
| 375 | 3300048904 | Ga0496101_0097176 | Ga0496101_0097176_913_1542 | 197 |
| 376 | 3300053077 | Ga0495601_0307652 | Ga0495601_0307652_279_899 | 197 |
| 377 | 3300031242 | Ga0265329_10003505 | Ga0265329_100035054 | 199 |
| 378 | 3300031344 | Ga0265316_10086153 | Ga0265316_100861533 | 199 |
| 379 | 3300031711 | Ga0265314_10001100 | Ga0265314_1000110025 | 199 |
| 380 | 3300041452 | Ga0451793_0087511 | Ga0451793_0087511_1609_2271 | 199 |
| 381 | 3300041456 | Ga0451795_0039163 | Ga0451795_0039163_104_724 | 199 |
| 382 | 3300046542 | Ga0495597_0071108 | Ga0495597_0071108_866_1477 | 199 |
| 383 | 3300048090 | Ga0495615_0110179 | Ga0495615_0110179_49_675 | 199 |
| 384 | 3300031251 | Ga0265327_10158143 | Ga0265327_101581431 | 200 |
| 385 | 3300048924 | Ga0496121_0228385 | Ga0496121_0228385_51_761 | 200 |
| 386 | 3300031852 | Ga0307410_10340616 | Ga0307410_103406162 | 201 |
| 387 | 3300046530 | Ga0495654_0001638 | Ga0495654_0001638_3888_4577 | 201 |
| 388 | 3300049682 | Ga0501252_002308 | Ga0501252_002308_1024_1638 | 201 |
| 389 | 3300001977 | JGI24746J21847_1023768 | JGI24746J21847_10237682 | 203 |
| 390 | 3300001991 | JGI24743J22301_10003100 | JGI24743J22301_100031001 | 203 |
| 391 | 3300002075 | JGI24738J21930_10052018 | JGI24738J21930_100520181 | 203 |
| 392 | 3300002077 | JGI24744J21845_10007709 | JGI24744J21845_100077092 | 203 |
| 393 | 3300002239 | JGI24034J26672_10037608 | JGI24034J26672_100376081 | 203 |
| 394 | 3300002244 | JGI24742J22300_10008907 | JGI24742J22300_100089072 | 203 |
| 395 | 3300005328 | Ga0070676_10405462 | Ga0070676_104054621 | 203 |
| 396 | 3300005329 | Ga0070683_100161802 | Ga0070683_1001618021 | 203 |
| 397 | 3300005330 | Ga0070690_100212432 | Ga0070690_1002124322 | 203 |
| 398 | 3300005331 | Ga0070670_100404367 | Ga0070670_1004043671 | 203 |
| 399 | 3300005334 | Ga0068869_100056254 | Ga0068869_1000562542 | 203 |
| 400 | 3300005337 | Ga0070682_100633974 | Ga0070682_1006339741 | 203 |
| 401 | 3300005338 | Ga0068868_100008027 | Ga0068868_1000080276 | 203 |
| 402 | 3300005339 | Ga0070660_100169685 | Ga0070660_1001696852 | 203 |
| 403 | 3300005340 | Ga0070689_100128639 | Ga0070689_1001286392 | 203 |
| 404 | 3300005341 | Ga0070691_10057024 | Ga0070691_100570241 | 203 |
| 405 | 3300005343 | Ga0070687_100013129 | Ga0070687_1000131291 | 203 |
| 406 | 3300005344 | Ga0070661_100228110 | Ga0070661_1002281102 | 203 |
| 407 | 3300005345 | Ga0070692_10023724 | Ga0070692_100237243 | 203 |
| 408 | 3300005347 | Ga0070668_100086182 | Ga0070668_1000861822 | 203 |
| 409 | 3300005353 | Ga0070669_100469581 | Ga0070669_1004695812 | 203 |
| 410 | 3300005354 | Ga0070675_100033460 | Ga0070675_1000334603 | 203 |
| 411 | 3300005356 | Ga0070674_100491397 | Ga0070674_1004913972 | 203 |
| 412 | 3300005364 | Ga0070673_100023147 | Ga0070673_1000231472 | 203 |
| 413 | 3300005365 | Ga0070688_100040057 | Ga0070688_1000400572 | 203 |
| 414 | 3300005366 | Ga0070659_100108405 | Ga0070659_1001084051 | 203 |
| 415 | 3300005367 | Ga0070667_100021215 | Ga0070667_1000212155 | 203 |
| 416 | 3300005436 | Ga0070713_100083972 | Ga0070713_1000839722 | 203 |
| 417 | 3300005437 | Ga0070710_10088465 | Ga0070710_100884652 | 203 |
| 418 | 3300005438 | Ga0070701_10005793 | Ga0070701_100057933 | 203 |
| 419 | 3300005439 | Ga0070711_100052070 | Ga0070711_1000520702 | 203 |
| 420 | 3300005441 | Ga0070700_100098643 | Ga0070700_1000986431 | 203 |
| 421 | 3300005444 | Ga0070694_100457517 | Ga0070694_1004575171 | 203 |
| 422 | 3300005455 | Ga0070663_100142424 | Ga0070663_1001424243 | 203 |
| 423 | 3300005456 | Ga0070678_100045543 | Ga0070678_1000455432 | 203 |
| 424 | 3300005457 | Ga0070662_100091612 | Ga0070662_1000916121 | 203 |
| 425 | 3300005459 | Ga0068867_100007166 | Ga0068867_1000071665 | 203 |
| 426 | 3300005466 | Ga0070685_10000890 | Ga0070685_100008908 | 203 |
| 427 | 3300005539 | Ga0068853_100066529 | Ga0068853_1000665294 | 203 |
| 428 | 3300005543 | Ga0070672_100027998 | Ga0070672_1000279984 | 203 |
| 429 | 3300005546 | Ga0070696_100308722 | Ga0070696_1003087221 | 203 |
| 430 | 3300005547 | Ga0070693_100332959 | Ga0070693_1003329592 | 203 |
| 431 | 3300005548 | Ga0070665_100367337 | Ga0070665_1003673372 | 203 |
| 432 | 3300005549 | Ga0070704_100040984 | Ga0070704_1000409843 | 203 |
| 433 | 3300005564 | Ga0070664_100875444 | Ga0070664_1008754441 | 203 |
| 434 | 3300005577 | Ga0068857_100077671 | Ga0068857_1000776712 | 203 |
| 435 | 3300005578 | Ga0068854_100030942 | Ga0068854_1000309422 | 203 |
| 436 | 3300005614 | Ga0068856_100166830 | Ga0068856_1001668301 | 203 |
| 437 | 3300005615 | Ga0070702_100088503 | Ga0070702_1000885032 | 203 |
| 438 | 3300005617 | Ga0068859_100102096 | Ga0068859_1001020962 | 203 |
| 439 | 3300005618 | Ga0068864_100007658 | Ga0068864_1000076585 | 203 |
| 440 | 3300005834 | Ga0068851_10145731 | Ga0068851_101457311 | 203 |
| 441 | 3300005840 | Ga0068870_10006338 | Ga0068870_100063384 | 203 |
| 442 | 3300005841 | Ga0068863_100001818 | Ga0068863_1000018182 | 203 |
| 443 | 3300005842 | Ga0068858_100018691 | Ga0068858_1000186913 | 203 |
| 444 | 3300005843 | Ga0068860_100016352 | Ga0068860_1000163529 | 203 |
| 445 | 3300005844 | Ga0068862_100003882 | Ga0068862_10000388210 | 203 |
| 446 | 3300006028 | Ga0070717_10141338 | Ga0070717_101413382 | 203 |
| 447 | 3300006042 | Ga0075368_10070669 | Ga0075368_100706691 | 203 |
| 448 | 3300006163 | Ga0070715_10071751 | Ga0070715_100717511 | 203 |
| 449 | 3300006177 | Ga0075362_10111515 | Ga0075362_101115153 | 203 |
| 450 | 3300006237 | Ga0097621_100368620 | Ga0097621_1003686202 | 203 |
| 451 | 3300006353 | Ga0075370_10203956 | Ga0075370_102039562 | 203 |
| 452 | 3300006358 | Ga0068871_100022390 | Ga0068871_1000223903 | 203 |
| 453 | 3300006931 | Ga0097620_100102102 | Ga0097620_1001021022 | 203 |
| 454 | 3300009094 | Ga0111539_10064533 | Ga0111539_100645333 | 203 |
| 455 | 3300009098 | Ga0105245_10132707 | Ga0105245_101327073 | 203 |
| 456 | 3300009101 | Ga0105247_10013108 | Ga0105247_100131085 | 203 |
| 457 | 3300009176 | Ga0105242_10074845 | Ga0105242_100748452 | 203 |
| 458 | 3300009177 | Ga0105248_10095110 | Ga0105248_100951101 | 203 |
| 459 | 3300009545 | Ga0105237_10081836 | Ga0105237_100818362 | 203 |
| 460 | 3300009551 | Ga0105238_10770237 | Ga0105238_107702372 | 203 |
| 461 | 3300009553 | Ga0105249_10059014 | Ga0105249_100590142 | 203 |
| 462 | 3300010375 | Ga0105239_10061461 | Ga0105239_100614613 | 203 |
| 463 | 3300011119 | Ga0105246_10019081 | Ga0105246_100190813 | 203 |
| 464 | 3300013102 | Ga0157371_10203192 | Ga0157371_102031922 | 203 |
| 465 | 3300013296 | Ga0157374_10073828 | Ga0157374_100738282 | 203 |
| 466 | 3300013306 | Ga0163162_10113557 | Ga0163162_101135573 | 203 |
| 467 | 3300013308 | Ga0157375_10175189 | Ga0157375_101751892 | 203 |
| 468 | 3300014968 | Ga0157379_10108896 | Ga0157379_101088963 | 203 |
| 469 | 3300014969 | Ga0157376_10027570 | Ga0157376_100275705 | 203 |
| 470 | 3300017792 | Ga0163161_10145796 | Ga0163161_101457962 | 203 |
| 471 | 3300025315 | Ga0207697_10099834 | Ga0207697_100998341 | 203 |
| 472 | 3300025321 | Ga0207656_10036613 | Ga0207656_100366133 | 203 |
| 473 | 3300025898 | Ga0207692_10408297 | Ga0207692_104082972 | 203 |
| 474 | 3300025900 | Ga0207710_10011112 | Ga0207710_100111124 | 203 |
| 475 | 3300025901 | Ga0207688_10000092 | Ga0207688_1000009220 | 203 |
| 476 | 3300025903 | Ga0207680_10046917 | Ga0207680_100469172 | 203 |
| 477 | 3300025905 | Ga0207685_10056026 | Ga0207685_100560261 | 203 |
| 478 | 3300025907 | Ga0207645_10003528 | Ga0207645_1000352812 | 203 |
| 479 | 3300025908 | Ga0207643_10001083 | Ga0207643_100010835 | 203 |
| 480 | 3300025916 | Ga0207663_10038672 | Ga0207663_100386723 | 203 |
| 481 | 3300025918 | Ga0207662_10001580 | Ga0207662_100015809 | 203 |
| 482 | 3300025919 | Ga0207657_10125119 | Ga0207657_101251192 | 203 |
| 483 | 3300025923 | Ga0207681_10207086 | Ga0207681_102070862 | 203 |
| 484 | 3300025925 | Ga0207650_10165000 | Ga0207650_101650001 | 203 |
| 485 | 3300025926 | Ga0207659_10016670 | Ga0207659_100166702 | 203 |
| 486 | 3300025927 | Ga0207687_10018688 | Ga0207687_100186882 | 203 |
| 487 | 3300025928 | Ga0207700_10067310 | Ga0207700_100673102 | 203 |
| 488 | 3300025931 | Ga0207644_10033432 | Ga0207644_100334325 | 203 |
| 489 | 3300025932 | Ga0207690_10040226 | Ga0207690_100402262 | 203 |
| 490 | 3300025933 | Ga0207706_10008103 | Ga0207706_100081034 | 203 |
| 491 | 3300025934 | Ga0207686_10008312 | Ga0207686_100083125 | 203 |
| 492 | 3300025936 | Ga0207670_10020428 | Ga0207670_100204285 | 203 |
| 493 | 3300025937 | Ga0207669_10019553 | Ga0207669_100195533 | 203 |
| 494 | 3300025938 | Ga0207704_10563890 | Ga0207704_105638901 | 203 |
| 495 | 3300025940 | Ga0207691_10023849 | Ga0207691_100238494 | 203 |
| 496 | 3300025941 | Ga0207711_10025808 | Ga0207711_100258083 | 203 |
| 497 | 3300025942 | Ga0207689_10051943 | Ga0207689_100519433 | 203 |
| 498 | 3300025944 | Ga0207661_10106849 | Ga0207661_101068492 | 203 |
| 499 | 3300025945 | Ga0207679_10273544 | Ga0207679_102735441 | 203 |
| 500 | 3300025960 | Ga0207651_10016867 | Ga0207651_100168672 | 203 |
| 501 | 3300025961 | Ga0207712_10046176 | Ga0207712_100461761 | 203 |
| 502 | 3300025972 | Ga0207668_10029136 | Ga0207668_100291363 | 203 |
| 503 | 3300025981 | Ga0207640_10278231 | Ga0207640_102782312 | 203 |
| 504 | 3300025986 | Ga0207658_10118589 | Ga0207658_101185892 | 203 |
| 505 | 3300026023 | Ga0207677_10530863 | Ga0207677_105308632 | 203 |
| 506 | 3300026035 | Ga0207703_10064191 | Ga0207703_100641911 | 203 |
| 507 | 3300026041 | Ga0207639_10210568 | Ga0207639_102105682 | 203 |
| 508 | 3300026075 | Ga0207708_10000679 | Ga0207708_1000067912 | 203 |
| 509 | 3300026078 | Ga0207702_10790994 | Ga0207702_107909942 | 203 |
| 510 | 3300026089 | Ga0207648_10001913 | Ga0207648_100019132 | 203 |
| 511 | 3300026095 | Ga0207676_10005821 | Ga0207676_100058215 | 203 |
| 512 | 3300026116 | Ga0207674_10023205 | Ga0207674_100232052 | 203 |
| 513 | 3300026118 | Ga0207675_100004582 | Ga0207675_1000045823 | 203 |
| 514 | 3300026121 | Ga0207683_10006472 | Ga0207683_100064728 | 203 |
| 515 | 3300026142 | Ga0207698_10155619 | Ga0207698_101556192 | 203 |
| 516 | 3300027907 | Ga0207428_10290881 | Ga0207428_102908812 | 203 |
| 517 | 3300028379 | Ga0268266_10047366 | Ga0268266_100473663 | 203 |
| 518 | 3300028380 | Ga0268265_11075541 | Ga0268265_110755411 | 203 |
| 519 | 3300028381 | Ga0268264_10019403 | Ga0268264_100194032 | 203 |
| 520 | 3300035691 | Ga0373931_0498051 | Ga0373931_0498051_22_633 | 203 |
| 521 | 3300046458 | Ga0495591_060021 | Ga0495591_060021_342_953 | 203 |
| 522 | 3300046491 | Ga0495584_0042189 | Ga0495584_0042189_1519_2130 | 203 |
| 523 | 3300046492 | Ga0495585_0245989 | Ga0495585_0245989_142_762 | 203 |
| 524 | 3300046500 | Ga0495596_0090560 | Ga0495596_0090560_120_731 | 203 |
| 525 | 3300046513 | Ga0495616_0195463 | Ga0495616_0195463_202_813 | 203 |
| 526 | 3300046518 | Ga0495631_0192594 | Ga0495631_0192594_157_768 | 203 |
| 527 | 3300046525 | Ga0495663_0060164 | Ga0495663_0060164_477_1097 | 203 |
| 528 | 3300046616 | Ga0495668_0203746 | Ga0495668_0203746_411_1022 | 203 |
| 529 | 3300046691 | Ga0495670_0288194 | Ga0495670_0288194_196_807 | 203 |
| 530 | 3300047317 | Ga0495604_0258244 | Ga0495604_0258244_132_743 | 203 |
| 531 | 3300048091 | Ga0495626_0058049 | Ga0495626_0058049_665_1276 | 203 |
| 532 | 3300048903 | Ga0496100_0015825 | Ga0496100_0015825_1390_2001 | 203 |
| 533 | 3300048904 | Ga0496101_0091019 | Ga0496101_0091019_1418_2029 | 203 |
| 534 | 3300048905 | Ga0496102_0140003 | Ga0496102_0140003_240_851 | 203 |
| 535 | 3300048906 | Ga0496103_0013122 | Ga0496103_0013122_1360_1971 | 203 |
| 536 | 3300048907 | Ga0496104_0035201 | Ga0496104_0035201_240_851 | 203 |
| 537 | 3300048908 | Ga0496105_0025266 | Ga0496105_0025266_2474_3085 | 203 |
| 538 | 3300048909 | Ga0496106_0010888 | Ga0496106_0010888_2871_3482 | 203 |
| 539 | 3300048910 | Ga0496107_0012596 | Ga0496107_0012596_1298_1909 | 203 |
| 540 | 3300048911 | Ga0496108_0043162 | Ga0496108_0043162_71_682 | 203 |
| 541 | 3300048911 | Ga0496108_0274515 | Ga0496108_0274515_364_975 | 203 |
| 542 | 3300048912 | Ga0496109_0082300 | Ga0496109_0082300_2313_2924 | 203 |
| 543 | 3300048913 | Ga0496110_0009317 | Ga0496110_0009317_5367_5978 | 203 |
| 544 | 3300048914 | Ga0496111_0053990 | Ga0496111_0053990_729_1340 | 203 |
| 545 | 3300048915 | Ga0496112_0013272 | Ga0496112_0013272_2229_2840 | 203 |
| 546 | 3300048915 | Ga0496112_0193828 | Ga0496112_0193828_326_937 | 203 |
| 547 | 3300048916 | Ga0496113_0017691 | Ga0496113_0017691_3500_4111 | 203 |
| 548 | 3300048917 | Ga0496114_0007580 | Ga0496114_0007580_4259_4870 | 203 |
| 549 | 3300048918 | Ga0496115_0020547 | Ga0496115_0020547_199_810 | 203 |
| 550 | 3300050494 | nmdc:mga06z11_279263_c1 | nmdc:mga06z11_279263_c1_312_923 | 203 |
| 551 | 3300050495 | nmdc:mga04h51_85247_c1 | nmdc:mga04h51_85247_c1_424_1044 | 203 |
| 552 | 3300050511 | nmdc:mga08y16_478413_c1 | nmdc:mga08y16_478413_c1_239_850 | 203 |
| 553 | 3300053077 | Ga0495601_0046194 | Ga0495601_0046194_1061_1672 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b0u-assembly2.cif.gz_C | structure of the calpl/t10 complex | 0.4174 | 1 | 64 |
| 7unh-assembly1.cif.gz_A | de novo designed chlorophyll dimer protein in apo state, sp2 | 0.3833 | 117 | 199 |
| 1fr0-assembly1.cif.gz_A | solution structure of the histidine-containing phosphotransfer domain of anaerobic sensor kinase arcb from escherichia coli. | 0.3085 | 119 | 199 |
| 6lo8-assembly1.cif.gz_A | cryo-em structure of the tim22 complex from yeast | 0.3063 | 121 | 203 |
| 6akj-assembly1.cif.gz_B | the crystal structure of emc complex | 0.3032 | 7 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32867_31_225_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.566 | 119 | 198 | 1.20.58.70 |
| af_P39926_34_229_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.5515 | 119 | 197 | 1.20.58.70 |
| af_Q59YF0_33_231_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.4948 | 119 | 198 | 1.20.58.70 |
| 2rcvH01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.4556 | 119 | 203 | 1.10.287.990 |
| 2rcvH01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.4465 | 119 | 203 | 1.10.287.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I6WPV1-F1-model_v4 | Uncharacterized protein | 0.9792 | 137 | 190 |
|
| AF-A0A539D1T3-F1-model_v4 | Uncharacterized protein | 0.9702 | 5 | 65 |
|
| AF-A0A6B3UQS1-F1-model_v4 | DUF2239 family protein | 0.9699 | 124 | 194 |
|
| AF-A0A519K0E2-F1-model_v4 | DUF2239 family protein | 0.9685 | 5 | 57 |
|
| AF-A0A1L6M3J6-F1-model_v4 | deleted | 0.9543 | 91 | 193 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar