F462882

General Info

Members Datasets Scaffolds Average Seq Length
553 296 552 327

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0030413|Ga0373924_0030413_922_2151
Length 390
Sequence MTGACRIGSRAPPSIYSAALSGTEPKLSVENFGNPTIVAGAALMASVMPAGAITRCRVEPVFMTISKTWTRMALVAASAVLLNVLPVAAADYPSRPVTLVVAFTPGGPSDVLARIVGKKMEQLLGQPFVIENRPGAGGNIAAEGVAHSAPDGYTLLMGNNSILATNEALYKHINYSPGKDFVPITLIGTQANILVVNPDVPAHSLKELIALAKAQPGKINFASSGYGAAAHLAGELFKSDAKIDIVHVPYKGAAPALQDVIGGHDQMMFATAASVIGHIEGGRVRALAVTTLKRTKILPDIPTMDEAGLQGFDASTWHGLVAPAGTPPQVIAALHDAAVKELHDPGVEASLAKLGVDIVADTPQEFQAYINSEIPKWTAIVKASGATLDK

Samples

Sample ID Description Type Environment
1 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
293 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.18
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0
Rhizoplane 8.5
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10039483 3300003203 Bacteria 1682
2 JGI25404J52841_10004865 3300003659 Bacteria 2754
3 Ga0070683_100000652 3300005329 Bacteria 25052
4 Ga0070683_100008015 3300005329 Bacteria 8966
5 Ga0070683_100193400 3300005329 Bacteria 1932
6 Ga0070690_100128515 3300005330 Bacteria 1709
7 Ga0070689_100027638 3300005340 Bacteria 4278
8 Ga0070689_100159958 3300005340 Bacteria 1820
9 Ga0070691_10033142 3300005341 Bacteria 2430
10 Ga0070687_100092917 3300005343 Bacteria 1672
11 Ga0070668_100106892 3300005347 Bacteria 2224
12 Ga0070668_100302320 3300005347 Bacteria 1342
13 Ga0070669_100055307 3300005353 Bacteria 2908
14 Ga0070675_100032023 3300005354 Bacteria 4253
15 Ga0070675_100044652 3300005354 Bacteria 3624
16 Ga0070674_100016936 3300005356 Bacteria 4574
17 Ga0070674_100030817 3300005356 Bacteria 3547
18 Ga0070673_100070614 3300005364 Bacteria 2803
19 Ga0070688_100007756 3300005365 Bacteria 5797
20 Ga0070688_100021478 3300005365 Bacteria 3771
21 Ga0070667_100118160 3300005367 Bacteria 2304
22 Ga0070709_10021759 3300005434 Bacteria 3740
23 Ga0070714_100016878 3300005435 Bacteria 5906
24 Ga0070714_100069197 3300005435 Bacteria 3047
25 Ga0070714_100142073 3300005435 Bacteria 2156
26 Ga0070713_100068149 3300005436 Bacteria 2998
27 Ga0070713_100370067 3300005436 Bacteria 1333
28 Ga0070710_10003697 3300005437 Bacteria 7233
29 Ga0070710_10032418 3300005437 Bacteria 2830
30 Ga0070710_10131786 3300005437 Bacteria 1525
31 Ga0070711_100080357 3300005439 Bacteria 2321
32 Ga0070711_100168653 3300005439 Bacteria 1666
33 Ga0070678_100012032 3300005456 Bacteria 5362
34 Ga0070678_100014517 3300005456 Unclassified 4974
35 Ga0070678_100054480 3300005456 Bacteria 2915
36 Ga0070681_10012646 3300005458 Bacteria 8373
37 Ga0070681_10105886 3300005458 Bacteria 2754
38 Ga0068867_100210048 3300005459 Bacteria 1563
39 Ga0070685_10189458 3300005466 Bacteria 1329
40 Ga0070685_10190953 3300005466 Bacteria 1325
41 Ga0070679_100007804 3300005530 Bacteria 10029
42 Ga0070684_100001124 3300005535 Bacteria 19191
43 Ga0070684_100221521 3300005535 Bacteria 1726
44 Ga0070686_100061397 3300005544 Bacteria 2429
45 Ga0070695_100170987 3300005545 Bacteria 1533
46 Ga0068855_100009947 3300005563 Bacteria 11468
47 Ga0068855_100022548 3300005563 Bacteria 7545
48 Ga0068854_100079351 3300005578 Bacteria 2420
49 Ga0070702_100189329 3300005615 Bacteria 1353
50 Ga0068852_100013278 3300005616 Bacteria 6299
51 Ga0068852_100120335 3300005616 Bacteria 2402
52 Ga0068859_100161307 3300005617 Bacteria 2321
53 Ga0068859_100277172 3300005617 Bacteria 1769
54 Ga0068864_100108703 3300005618 Bacteria 2468
55 Ga0068864_100311901 3300005618 Bacteria 1475
56 Ga0068861_100189591 3300005719 Bacteria 1718
57 Ga0068863_100159818 3300005841 Bacteria 2158
58 Ga0068858_100019328 3300005842 Bacteria 6370
59 Ga0068860_100088490 3300005843 Bacteria 2948
60 Ga0081538_10006861 3300005981 Bacteria 9918
61 Ga0081540_1000183 3300005983 Bacteria 65356
62 Ga0081540_1013782 3300005983 Bacteria 5234
63 Ga0081539_10000734 3300005985 Bacteria 65712
64 Ga0070717_10001430 3300006028 Bacteria 16442
65 Ga0070717_10037786 3300006028 Bacteria 3922
66 Ga0070717_10171911 3300006028 Bacteria 1885
67 Ga0075365_10222344 3300006038 Bacteria 1325
68 Ga0075364_10030887 3300006051 Bacteria 3440
69 Ga0075364_10075072 3300006051 Bacteria 2230
70 Ga0070715_10014082 3300006163 Bacteria 2953
71 Ga0070712_100055389 3300006175 Bacteria 2777
72 Ga0075362_10015230 3300006177 Bacteria 3123
73 Ga0075362_10047260 3300006177 Bacteria 1916
74 Ga0075427_10000369 3300006194 Bacteria 4986
75 Ga0068871_100043950 3300006358 Bacteria 3591
76 Ga0068871_100129648 3300006358 Bacteria 2137
77 Ga0075428_100164742 3300006844 Bacteria 2405
78 Ga0075428_100167039 3300006844 Bacteria 2387
79 Ga0075428_100329881 3300006844 Bacteria 1639
80 Ga0075430_100019015 3300006846 Bacteria 5844
81 Ga0075431_100030512 3300006847 Bacteria 5553
82 Ga0075434_100154601 3300006871 Bacteria 2313
83 Ga0075434_100459863 3300006871 Bacteria 1294
84 Ga0068865_100092550 3300006881 Bacteria 2197
85 Ga0068865_100214662 3300006881 Bacteria 1501
86 Ga0097620_100161319 3300006931 Bacteria 2321
87 Ga0097620_100277161 3300006931 Bacteria 1769
88 Ga0075435_100010184 3300007076 Bacteria 6868
89 Ga0075435_100066604 3300007076 Bacteria 2931
90 Ga0075435_100106724 3300007076 Bacteria 2326
91 Ga0099795_10042628 3300007788 Bacteria 1620
92 Ga0105251_10058468 3300009011 Bacteria 1820
93 Ga0111539_10001374 3300009094 Bacteria 32371
94 Ga0111539_10121756 3300009094 Bacteria 3057
95 Ga0111539_10202572 3300009094 Bacteria 2314
96 Ga0111539_10299303 3300009094 Bacteria 1872
97 Ga0111539_10522252 3300009094 Bacteria 1383
98 Ga0105245_10186781 3300009098 Bacteria 1983
99 Ga0114129_10000243 3300009147 Bacteria 61230
100 Ga0114129_10033779 3300009147 Bacteria 7226
101 Ga0114129_10967891 3300009147 Bacteria 1074
102 Ga0105242_10074279 3300009176 Bacteria 2829
103 Ga0105248_10002115 3300009177 Bacteria 21954
104 Ga0105248_10024799 3300009177 Bacteria 6670
105 Ga0105248_10107832 3300009177 Bacteria 3140
106 Ga0105237_10099482 3300009545 Bacteria 2900
107 Ga0105238_10024417 3300009551 Bacteria 6162
108 Ga0099796_10088559 3300010159 Bacteria 1147
109 Ga0105239_10312708 3300010375 Bacteria 1770
110 Ga0105246_10076595 3300011119 Bacteria 2370
111 Ga0157371_10134948 3300013102 Bacteria 1757
112 Ga0157370_10149334 3300013104 Bacteria 2175
113 Ga0157369_10049187 3300013105 Bacteria 4571
114 Ga0157378_10001272 3300013297 Bacteria 22662
115 Ga0163162_10064062 3300013306 Bacteria 3721
116 Ga0163162_10127781 3300013306 Bacteria 2649
117 Ga0163162_10389869 3300013306 Bacteria 1526
118 Ga0163162_10637826 3300013306 Bacteria 1190
119 Ga0157372_10484794 3300013307 Bacteria 1441
120 Ga0157375_10081037 3300013308 Bacteria 3285
121 Ga0157375_10120073 3300013308 Bacteria 2737
122 Ga0157375_10178227 3300013308 Bacteria 2276
123 Ga0157375_10230097 3300013308 Bacteria 2013
124 Ga0163163_10067557 3300014325 Bacteria 3555
125 Ga0163163_10237098 3300014325 Bacteria 1874
126 Ga0157376_10000711 3300014969 Bacteria 21531
127 Ga0206353_12034808 3300020082 Bacteria 1626
128 Ga0213876_10081189 3300021384 Bacteria 1715
129 Ga0213871_10001061 3300021441 Bacteria 4346
130 Ga0207426_1021296 3300025302 Bacteria 2242
131 Ga0207426_1022544 3300025302 Bacteria 2160
132 Ga0207426_1023995 3300025302 Bacteria 2075
133 Ga0207656_10114340 3300025321 Bacteria 1250
134 Ga0207692_10040578 3300025898 Bacteria 2297
135 Ga0207685_10006929 3300025905 Bacteria 3124
136 Ga0207699_10030084 3300025906 Bacteria 3036
137 Ga0207645_10047433 3300025907 Bacteria 2743
138 Ga0207643_10088953 3300025908 Bacteria 1798
139 Ga0207705_10166389 3300025909 Bacteria 1658
140 Ga0207707_10218731 3300025912 Bacteria 1658
141 Ga0207707_10232607 3300025912 Bacteria 1603
142 Ga0207695_10078348 3300025913 Bacteria 3353
143 Ga0207671_10235021 3300025914 Bacteria 1439
144 Ga0207693_10071700 3300025915 Bacteria 2712
145 Ga0207693_10111447 3300025915 Bacteria 2146
146 Ga0207693_10128165 3300025915 Bacteria 1995
147 Ga0207663_10039513 3300025916 Bacteria 2860
148 Ga0207660_10048981 3300025917 Bacteria 2992
149 Ga0207662_10081017 3300025918 Bacteria 1981
150 Ga0207657_10023292 3300025919 Bacteria 5769
151 Ga0207649_10033244 3300025920 Bacteria 3080
152 Ga0207649_10128317 3300025920 Bacteria 1719
153 Ga0207652_10037747 3300025921 Bacteria 4090
154 Ga0207652_10049983 3300025921 Bacteria 3581
155 Ga0207681_10239625 3300025923 Bacteria 1411
156 Ga0207694_10012374 3300025924 Bacteria 6429
157 Ga0207694_10027429 3300025924 Bacteria 4338
158 Ga0207650_10258441 3300025925 Bacteria 1412
159 Ga0207659_10051164 3300025926 Bacteria 2937
160 Ga0207659_10146905 3300025926 Bacteria 1837
161 Ga0207700_10002378 3300025928 Bacteria 10818
162 Ga0207700_10023435 3300025928 Bacteria 4255
163 Ga0207700_10032112 3300025928 Bacteria 3740
164 Ga0207664_10081616 3300025929 Bacteria 2632
165 Ga0207644_10042454 3300025931 Bacteria 3223
166 Ga0207644_10048005 3300025931 Bacteria 3049
167 Ga0207706_10019741 3300025933 Bacteria 6062
168 Ga0207706_10089101 3300025933 Bacteria 2713
169 Ga0207686_10016927 3300025934 Bacteria 4097
170 Ga0207709_10061876 3300025935 Bacteria 2341
171 Ga0207709_10105504 3300025935 Bacteria 1873
172 Ga0207709_10128232 3300025935 Bacteria 1724
173 Ga0207670_10005407 3300025936 Bacteria 7007
174 Ga0207670_10235185 3300025936 Bacteria 1409
175 Ga0207704_10054480 3300025938 Bacteria 2439
176 Ga0207704_10174305 3300025938 Bacteria 1547
177 Ga0207665_10000750 3300025939 Bacteria 21849
178 Ga0207665_10036787 3300025939 Bacteria 3256
179 Ga0207691_10215684 3300025940 Bacteria 1665
180 Ga0207711_10001396 3300025941 Bacteria 22654
181 Ga0207711_10009733 3300025941 Bacteria 7998
182 Ga0207711_10010444 3300025941 Bacteria 7707
183 Ga0207711_10013935 3300025941 Bacteria 6677
184 Ga0207711_10490352 3300025941 Bacteria 1145
185 Ga0207661_10000358 3300025944 Bacteria 29302
186 Ga0207661_10015125 3300025944 Bacteria 5672
187 Ga0207661_10177266 3300025944 Bacteria 1859
188 Ga0207667_10028639 3300025949 Bacteria 6048
189 Ga0207667_10043710 3300025949 Bacteria 4753
190 Ga0207667_10289985 3300025949 Bacteria 1672
191 Ga0207651_10158135 3300025960 Bacteria 1773
192 Ga0207668_10435155 3300025972 Bacteria 1116
193 Ga0207678_10161497 3300026067 Bacteria 1913
194 Ga0207678_10370177 3300026067 Bacteria 1238
195 Ga0207678_10512564 3300026067 Bacteria 1046
196 Ga0207702_10135928 3300026078 Bacteria 2218
197 Ga0207702_10559470 3300026078 Bacteria 1119
198 Ga0207648_10137292 3300026089 Bacteria 2154
199 Ga0207676_10016135 3300026095 Bacteria 5404
200 Ga0207676_10053591 3300026095 Bacteria 3157
201 Ga0207676_10064625 3300026095 Bacteria 2911
202 Ga0207675_100252758 3300026118 Bacteria 1706
203 Ga0207675_100484695 3300026118 Bacteria 1229
204 Ga0207683_10008034 3300026121 Bacteria 9022
205 Ga0207698_10010082 3300026142 Bacteria 6052
206 Ga0207698_10119373 3300026142 Bacteria 2228
207 Ga0207428_10000114 3300027907 Bacteria 109533
208 Ga0268266_10001951 3300028379 Bacteria 23184
209 Ga0268264_10116273 3300028381 Bacteria 2351
210 Ga0265336_10026649 3300028666 Bacteria 1815
211 Ga0265338_10033445 3300028800 Bacteria 4989
212 Ga0265338_10102614 3300028800 Bacteria 2325
213 Ga0265330_10020875 3300031235 Bacteria 2993
214 Ga0265332_10000542 3300031238 Bacteria 25657
215 Ga0265325_10004554 3300031241 Bacteria 8731
216 Ga0265325_10030871 3300031241 Bacteria 2872
217 Ga0265325_10050999 3300031241 Bacteria 2128
218 Ga0265340_10001039 3300031247 Bacteria 15832
219 Ga0265340_10029005 3300031247 Bacteria 2781
220 Ga0265340_10042778 3300031247 Bacteria 2222
221 Ga0265339_10000085 3300031249 Bacteria 79483
222 Ga0265339_10001756 3300031249 Bacteria 15968
223 Ga0265339_10005936 3300031249 Bacteria 8076
224 Ga0265339_10011316 3300031249 Bacteria 5500
225 Ga0265331_10103735 3300031250 Bacteria 1307
226 Ga0265316_10258337 3300031344 Bacteria 1278
227 Ga0265313_10000505 3300031595 Bacteria 40966
228 Ga0265313_10005423 3300031595 Bacteria 9393
229 Ga0265314_10005690 3300031711 Bacteria 11186
230 Ga0265314_10022029 3300031711 Bacteria 4886
231 Ga0265342_10000050 3300031712 Bacteria 124639
232 Ga0265342_10023921 3300031712 Bacteria 3860
233 Ga0373930_0002870 3300034816 Bacteria 2706
234 Ga0373950_0014272 3300034818 Bacteria 1335
235 Ga0373958_0002797 3300034819 Bacteria 2479
236 Ga0373958_0028799 3300034819 Bacteria 1077
237 Ga0373959_0008287 3300034820 Bacteria 1766
238 Ga0373938_0001106 3300034957 Bacteria 4336
239 Ga0373929_0005388 3300035085 Bacteria 2302
240 Ga0373923_0014196 3300035111 Bacteria 2987
241 Ga0373932_0003262 3300035112 Bacteria 3924
242 Ga0373936_0009737 3300035113 Bacteria 3625
243 Ga0373941_0007101 3300035115 Bacteria 2727
244 Ga0373945_0004472 3300035116 Bacteria 4443
245 Ga0373945_0046573 3300035116 Bacteria 1583
246 Ga0373945_0075473 3300035116 Bacteria 1283
247 Ga0373953_0008926 3300035117 Bacteria 3424
248 Ga0373954_0000716 3300035118 Bacteria 12776
249 Ga0373954_0001345 3300035118 Bacteria 9912
250 Ga0373956_0002334 3300035119 Bacteria 7775
251 Ga0373960_0007268 3300035121 Bacteria 2621
252 Ga0373943_0000451 3300035170 Bacteria 17417
253 Ga0373943_0035807 3300035170 Bacteria 2374
254 Ga0373943_0047798 3300035170 Bacteria 2093
255 Ga0373943_0054398 3300035170 Bacteria 1980
256 Ga0373946_0003257 3300035171 Bacteria 5765
257 Ga0373946_0026164 3300035171 Bacteria 2299
258 Ga0373946_0035754 3300035171 Bacteria 2011
259 Ga0373955_0005309 3300035172 Bacteria 5786
260 Ga0373955_0022986 3300035172 Bacteria 3171
261 Ga0373955_0072935 3300035172 Bacteria 1924
262 Ga0373962_0014472 3300035242 Bacteria 2010
263 Ga0373962_0045813 3300035242 Bacteria 1246
264 Ga0373924_0024547 3300035410 Bacteria 2376
265 Ga0373924_0030413 3300035410 Bacteria 2165
266 Ga0373931_0002378 3300035691 Bacteria 8324
267 Ga0373931_0012185 3300035691 Bacteria 4163
268 Ga0373931_0023795 3300035691 Bacteria 3095
269 Ga0373931_0029357 3300035691 Bacteria 2822
270 Ga0373931_0029750 3300035691 Bacteria 2807
271 Ga0373935_0000058 3300035692 Bacteria 45823
272 Ga0373935_0047087 3300035692 Bacteria 2725
273 Ga0373927_0025167 3300035695 Bacteria 3891
274 Ga0373927_0028424 3300035695 Bacteria 3647
275 Ga0373933_0000674 3300035724 Bacteria 21160
276 Ga0373933_0002754 3300035724 Bacteria 9816
277 Ga0373933_0056101 3300035724 Bacteria 2364
278 Ga0373933_0166821 3300035724 Bacteria 1400
279 Ga0373947_0008471 3300035725 Bacteria 5922
280 Ga0373937_0000624 3300036401 Bacteria 31078
281 Ga0373937_0004226 3300036401 Bacteria 12176
282 Ga0373937_0010149 3300036401 Bacteria 8217
283 Ga0373937_0042694 3300036401 Bacteria 4137
284 Ga0373937_0342994 3300036401 Bacteria 1415
285 Ga0373925_0000069 3300037068 Bacteria 108796
286 Ga0373925_0199949 3300037068 Bacteria 1589
287 Ga0395899_0155536 3300037312 Bacteria 1618
288 Ga0395900_0005185 3300037418 Bacteria 13681
289 Ga0395900_0022683 3300037418 Bacteria 6424
290 Ga0395898_0013898 3300037466 Bacteria 8273
291 Ga0395898_0022154 3300037466 Bacteria 6436
292 Ga0395898_0178182 3300037466 Bacteria 2031
293 Ga0395901_0046168 3300038443 Bacteria 4524
294 Ga0395901_0435960 3300038443 Bacteria 1342
295 Ga0436365_1908596 3300039437 Bacteria 3907
296 Ga0436360_0893150 3300039438 Bacteria 4448
297 Ga0436362_0561887 3300039453 Bacteria 1128
298 Ga0466966_0022484 3300044684 Bacteria 4136
299 Ga0466963_0057664 3300044694 Bacteria 2587
300 Ga0466957_0207700 3300044842 Bacteria 1288
301 Ga0451576_0680321 3300045051 Bacteria 1081
302 Ga0466958_0017616 3300045836 Bacteria 4133
303 Ga0466967_0590985 3300045976 Bacteria 1095
304 Ga0495592_0000009 3300046454 Bacteria 171624
305 Ga0495592_0024412 3300046454 Bacteria 4596
306 Ga0495592_0079204 3300046454 Bacteria 2378
307 Ga0495629_0064270 3300046459 Bacteria 2562
308 Ga0495641_0021426 3300046461 Bacteria 3253
309 Ga0495641_0025217 3300046461 Bacteria 2920
310 Ga0495651_0004786 3300046462 Bacteria 10364
311 Ga0495651_0046835 3300046462 Bacteria 3346
312 Ga0495651_0052539 3300046462 Bacteria 3138
313 Ga0495651_0205425 3300046462 Bacteria 1375
314 Ga0495653_0001004 3300046463 Bacteria 21758
315 Ga0495653_0009407 3300046463 Bacteria 7996
316 Ga0495653_0042049 3300046463 Bacteria 3562
317 Ga0495580_0024969 3300046472 Bacteria 4369
318 Ga0495582_0007119 3300046473 Bacteria 6211
319 Ga0495582_0049437 3300046473 Bacteria 2315
320 Ga0495639_0014548 3300046475 Bacteria 3407
321 Ga0495662_0005870 3300046476 Bacteria 6141
322 Ga0495662_0078786 3300046476 Bacteria 1601
323 Ga0495664_0000002 3300046477 Bacteria 625183
324 Ga0495584_0012806 3300046491 Bacteria 4280
325 Ga0495584_0057434 3300046491 Bacteria 1958
326 Ga0495585_0025468 3300046492 Bacteria 3387
327 Ga0495594_0059295 3300046499 Bacteria 2116
328 Ga0495594_0149369 3300046499 Bacteria 1326
329 Ga0495607_0060783 3300046501 Bacteria 2149
330 Ga0495608_0000009 3300046511 Bacteria 266614
331 Ga0495608_0090340 3300046511 Bacteria 1981
332 Ga0495618_0001315 3300046514 Bacteria 16713
333 Ga0495618_0029543 3300046514 Bacteria 3420
334 Ga0495618_0043109 3300046514 Bacteria 2846
335 Ga0495618_0257451 3300046514 Bacteria 1093
336 Ga0495628_0000002 3300046516 Bacteria 589399
337 Ga0495628_0006539 3300046516 Bacteria 10171
338 Ga0495630_0012154 3300046517 Bacteria 6243
339 Ga0495644_0014442 3300046523 Bacteria 3026
340 Ga0495666_0007866 3300046526 Bacteria 5340
341 Ga0495666_0071703 3300046526 Bacteria 1646
342 Ga0495652_0000004 3300046529 Bacteria 588877
343 Ga0495665_0059864 3300046531 Bacteria 2010
344 Ga0495640_0000005 3300046533 Bacteria 318271
345 Ga0495640_0023368 3300046533 Bacteria 4504
346 Ga0495587_0000018 3300046536 Bacteria 166488
347 Ga0495587_0005891 3300046536 Bacteria 7986
348 Ga0495587_0159621 3300046536 Bacteria 1283
349 Ga0495609_0104719 3300046538 Bacteria 1224
350 Ga0495645_0000003 3300046543 Bacteria 570133
351 Ga0495645_0003657 3300046543 Bacteria 10446
352 Ga0495645_0138918 3300046543 Bacteria 1697
353 Ga0495622_0092916 3300046557 Bacteria 1385
354 Ga0495633_0014772 3300046558 Bacteria 4068
355 Ga0495667_0000002 3300046559 Bacteria 437535
356 Ga0495667_0031058 3300046559 Bacteria 3587
357 Ga0495667_0178241 3300046559 Bacteria 1364
358 Ga0495656_0006991 3300046615 Bacteria 3973
359 Ga0495634_0045735 3300046642 Bacteria 2958
360 Ga0495634_0049955 3300046642 Bacteria 2810
361 Ga0495634_0098078 3300046642 Bacteria 1896
362 Ga0495635_0000285 3300046663 Bacteria 32542
363 Ga0495635_0045751 3300046663 Bacteria 3019
364 Ga0495659_0029999 3300046664 Bacteria 1890
365 Ga0495588_0085514 3300046674 Bacteria 1649
366 Ga0495657_0001222 3300046675 Bacteria 22563
367 Ga0495657_0001285 3300046675 Bacteria 21813
368 Ga0495657_0011136 3300046675 Bacteria 6739
369 Ga0495657_0114829 3300046675 Bacteria 1702
370 Ga0495599_0000241 3300046678 Bacteria 34529
371 Ga0495599_0021447 3300046678 Bacteria 4031
372 Ga0495599_0028439 3300046678 Bacteria 3504
373 Ga0495623_0000281 3300046679 Bacteria 33061
374 Ga0495623_0000659 3300046679 Bacteria 22934
375 Ga0495623_0012783 3300046679 Bacteria 5435
376 Ga0495646_0000025 3300046680 Bacteria 106144
377 Ga0495646_0008339 3300046680 Bacteria 6590
378 Ga0495646_0050284 3300046680 Bacteria 2527
379 Ga0495658_0000968 3300046683 Bacteria 15245
380 Ga0495658_0047331 3300046683 Bacteria 2421
381 Ga0495658_0250190 3300046683 Bacteria 1114
382 Ga0495613_0036083 3300046689 Bacteria 3666
383 Ga0495613_0237344 3300046689 Bacteria 1276
384 Ga0495600_0000798 3300046809 Bacteria 16673
385 Ga0495600_0002330 3300046809 Bacteria 10831
386 Ga0495600_0027913 3300046809 Bacteria 3650
387 Ga0495581_0010216 3300047315 Bacteria 5430
388 Ga0495604_0000747 3300047317 Bacteria 27312
389 Ga0495604_0012323 3300047317 Bacteria 6797
390 Ga0495604_0046289 3300047317 Bacteria 3392
391 Ga0495604_0123275 3300047317 Bacteria 1873
392 Ga0495674_0000003 3300047319 Bacteria 562126
393 Ga0495674_0010712 3300047319 Bacteria 8672
394 Ga0495674_0034391 3300047319 Bacteria 4584
395 Ga0495674_0051830 3300047319 Bacteria 3616
396 Ga0495674_0123502 3300047319 Bacteria 2186
397 Ga0495676_0014548 3300047321 Bacteria 7039
398 Ga0495676_0053084 3300047321 Bacteria 3232
399 Ga0495676_0109131 3300047321 Bacteria 2034
400 Ga0495676_0246910 3300047321 Bacteria 1219
401 Ga0495680_0000745 3300047322 Bacteria 36458
402 Ga0495680_0013432 3300047322 Bacteria 7145
403 Ga0495680_0017129 3300047322 Bacteria 6201
404 Ga0495680_0018150 3300047322 Bacteria 5983
405 Ga0495680_0054810 3300047322 Bacteria 3094
406 Ga0495675_0000322 3300047444 Bacteria 34157
407 Ga0495684_0000405 3300047471 Bacteria 35298
408 Ga0495684_0020169 3300047471 Bacteria 5134
409 Ga0495593_0000954 3300047673 Bacteria 16902
410 Ga0495593_0027021 3300047673 Bacteria 3163
411 Ga0495593_0031251 3300047673 Bacteria 2910
412 Ga0495602_0003262 3300048088 Bacteria 16755
413 Ga0495602_0021024 3300048088 Bacteria 6432
414 Ga0495602_0027080 3300048088 Bacteria 5518
415 Ga0495602_0321716 3300048088 Bacteria 1125
416 Ga0496100_0024714 3300048903 Bacteria 3666
417 Ga0496100_0067033 3300048903 Bacteria 2383
418 Ga0496101_0010164 3300048904 Bacteria 6209
419 Ga0496101_0145009 3300048904 Bacteria 1812
420 Ga0496102_0117452 3300048905 Bacteria 2482
421 Ga0496103_0003575 3300048906 Bacteria 9491
422 Ga0496104_0000289 3300048907 Bacteria 44331
423 Ga0496104_0027010 3300048907 Bacteria 5307
424 Ga0496104_0060651 3300048907 Bacteria 3583
425 Ga0496104_0145084 3300048907 Bacteria 2279
426 Ga0496104_0162853 3300048907 Bacteria 2139
427 Ga0496105_0027671 3300048908 Bacteria 4634
428 Ga0496105_0050154 3300048908 Bacteria 3448
429 Ga0496105_0086491 3300048908 Bacteria 2591
430 Ga0496105_0121202 3300048908 Bacteria 2156
431 Ga0496106_0016237 3300048909 Bacteria 5508
432 Ga0496106_0043151 3300048909 Bacteria 3383
433 Ga0496106_0048187 3300048909 Bacteria 3208
434 Ga0496107_0027434 3300048910 Bacteria 4043
435 Ga0496107_0028627 3300048910 Bacteria 3960
436 Ga0496107_0099760 3300048910 Bacteria 2128
437 Ga0496108_0032039 3300048911 Bacteria 4363
438 Ga0496108_0043256 3300048911 Bacteria 3763
439 Ga0496108_0136709 3300048911 Bacteria 2109
440 Ga0496108_0266057 3300048911 Bacteria 1492
441 Ga0496109_0195855 3300048912 Bacteria 1899
442 Ga0496110_0026878 3300048913 Bacteria 4928
443 Ga0496110_0034056 3300048913 Bacteria 4409
444 Ga0496110_0202232 3300048913 Bacteria 1805
445 Ga0496111_0017758 3300048914 Bacteria 4920
446 Ga0496111_0019945 3300048914 Bacteria 4663
447 Ga0496111_0036639 3300048914 Bacteria 3508
448 Ga0496111_0151484 3300048914 Bacteria 1720
449 Ga0496111_0261308 3300048914 Bacteria 1284
450 Ga0496112_0068007 3300048915 Bacteria 3517
451 Ga0496112_0160725 3300048915 Bacteria 2213
452 Ga0496112_0213330 3300048915 Bacteria 1887
453 Ga0496113_0049360 3300048916 Bacteria 3133
454 Ga0496113_0057903 3300048916 Bacteria 2914
455 Ga0496114_0028120 3300048917 Bacteria 4611
456 Ga0496114_0044243 3300048917 Bacteria 3693
457 Ga0496115_0003610 3300048918 Bacteria 11126
458 Ga0496115_0003653 3300048918 Bacteria 11071
459 Ga0496115_0018941 3300048918 Bacteria 5294
460 Ga0496115_0154476 3300048918 Bacteria 1895
461 Ga0496115_0172163 3300048918 Bacteria 1790
462 Ga0496115_0358264 3300048918 Bacteria 1189
463 Ga0501031_0014149 3300049568 Bacteria 5191
464 Ga0501032_0045482 3300049569 Bacteria 2968
465 Ga0501033_0097443 3300049570 Bacteria 2148
466 Ga0501034_0102278 3300049571 Bacteria 2858
467 Ga0501034_0186197 3300049571 Bacteria 2039
468 Ga0501034_0337083 3300049571 Bacteria 1439
469 Ga0501037_0026906 3300049573 Bacteria 4248
470 Ga0501038_0031075 3300049574 Bacteria 4721
471 Ga0501039_0005600 3300049575 Bacteria 9505
472 Ga0501042_0095096 3300049578 Bacteria 2140
473 Ga0501043_0101907 3300049579 Bacteria 2256
474 Ga0501046_0021756 3300049580 Bacteria 5287
475 Ga0501047_0074603 3300049581 Bacteria 3265
476 Ga0501048_0044557 3300049582 Bacteria 3171
477 Ga0501067_0025973 3300049583 Bacteria 3245
478 Ga0501067_0136529 3300049583 Bacteria 1366
479 Ga0501068_0019428 3300049584 Bacteria 3946
480 Ga0501069_0015111 3300049585 Bacteria 4135
481 Ga0501070_0085549 3300049586 Bacteria 2610
482 Ga0501071_0022725 3300049587 Bacteria 4374
483 Ga0501072_0031344 3300049588 Bacteria 4161
484 Ga0501073_0021800 3300049589 Bacteria 4615
485 Ga0501075_0247368 3300049591 Bacteria 1359
486 Ga0501076_0121530 3300049592 Bacteria 2115
487 Ga0501080_0046049 3300049742 Bacteria 4062
488 Ga0501080_0139909 3300049742 Bacteria 2238
489 Ga0501083_0055553 3300049744 Bacteria 2654
490 Ga0501035_0123082 3300049822 Bacteria 2265
491 Ga0501044_0007557 3300049823 Bacteria 11948
492 Ga0501044_0133355 3300049823 Bacteria 2476
493 nmdc:mga0yw44_116230_c1 3300050492 Bacteria 1719
494 nmdc:mga0yw44_47866_c1 3300050492 Bacteria 2576
495 nmdc:mga0k408_21981_c1 3300050493 Bacteria 3588
496 nmdc:mga0k408_30818_c2 3300050493 Bacteria 2669
497 nmdc:mga0k408_8112_c1 3300050493 Bacteria 5628
498 nmdc:mga05p37_1364_c1 3300050507 Bacteria 28406
499 nmdc:mga05p37_241529_c1 3300050507 Bacteria 2171
500 nmdc:mga05p37_54763_c1 3300050507 Bacteria 4907
501 nmdc:mga09592_15777_c1 3300050508 Bacteria 6172
502 nmdc:mga09592_28362_c1 3300050508 Bacteria 4651
503 nmdc:mga0qj67_14545_c1 3300050509 Bacteria 5952
504 nmdc:mga0qj67_15877_c1 3300050509 Bacteria 5702
505 nmdc:mga06r32_151_c1 3300050510 Bacteria 52848
506 nmdc:mga06r32_71986_c1 3300050510 Bacteria 3347
507 nmdc:mga08y16_100428_c1 3300050511 Bacteria 3013
508 nmdc:mga08y16_166833_c1 3300050511 Bacteria 2287
509 nmdc:mga08y16_170167_c1 3300050511 Bacteria 2263
510 nmdc:mga08y16_86_c1 3300050511 Bacteria 78136
511 nmdc:mga0n895_141219_c1 3300050512 Bacteria 2437
512 nmdc:mga0n895_22982_c1 3300050512 Bacteria 5853
513 nmdc:mga0n895_28479_c1 3300050512 Bacteria 5313
514 nmdc:mga0n895_404568_c1 3300050512 Bacteria 1380
515 nmdc:mga0rr50_178817_c1 3300050513 Bacteria 1733
516 nmdc:mga0rr50_253113_c1 3300050513 Bacteria 1463
517 nmdc:mga0rr50_92508_c1 3300050513 Bacteria 2358
518 nmdc:mga08x19_95303_c1 3300050514 Bacteria 1969
519 nmdc:mga0a205_22305_c1 3300050515 Bacteria 2287
520 nmdc:mga0a205_9463_c1 3300050515 Bacteria 8912
521 Ga0495601_0000010 3300053077 Bacteria 266222
522 Ga0495601_0002450 3300053077 Bacteria 10539
523 Ga0495601_0012123 3300053077 Bacteria 5167
524 Ga0495601_0019792 3300053077 Bacteria 4108
525 Ga0495601_0040702 3300053077 Bacteria 2911
526 Ga0495612_0001416 3300053078 Bacteria 9857
527 Ga0495612_0013678 3300053078 Bacteria 3268
528 Ga0495612_0019466 3300053078 Bacteria 2717
529 Ga0495595_0000129 3300053084 Bacteria 31475
530 Ga0495595_0000386 3300053084 Bacteria 16729
531 Ga0495595_0000618 3300053084 Bacteria 13566
532 Ga0495595_0010666 3300053084 Bacteria 3825
533 Ga0495595_0018013 3300053084 Bacteria 3046
534 Ga0495595_0034387 3300053084 Bacteria 2292
535 Ga0495595_0070401 3300053084 Bacteria 1652
536 Ga0495619_0000002 3300053085 Bacteria 530226
537 Ga0495619_0000927 3300053085 Bacteria 19293
538 Ga0495619_0003524 3300053085 Bacteria 10093
539 Ga0495619_0024586 3300053085 Bacteria 3864
540 Ga0495619_0199142 3300053085 Bacteria 1386
541 Ga0500643_008449 3300053087 Bacteria 4042
542 Ga0500644_0000592 3300053088 Bacteria 13833
543 Ga0500651_0048666 3300053093 Bacteria 2663
544 Ga0500556_0092305 3300053104 Bacteria 1158
545 Ga0500593_058283 3300053117 Bacteria 1700
546 Ga0500595_000010 3300053119 Bacteria 275806
547 Ga0500618_030498 3300053125 Bacteria 1268
548 Ga0500655_023389 3300053133 Bacteria 1167
549 Ga0500616_0000001 3300053153 Bacteria 1986011
550 Ga0501084_0082590 3300054114 Bacteria 2696
551 Ga0501084_0423698 3300054114 Bacteria 1125
552 Ga0466962_0023616 3300061719 Bacteria 2955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100459863 Ga0075434_1004598631 287
2 3300050512 nmdc:mga0n895_404568_c1 nmdc:mga0n895_404568_c1_293_1228 287
3 3300025908 Ga0207643_10088953 Ga0207643_100889532 303
4 3300044694 Ga0466963_0057664 Ga0466963_0057664_756_1685 303
5 3300005434 Ga0070709_10021759 Ga0070709_100217592 305
6 3300005435 Ga0070714_100142073 Ga0070714_1001420732 305
7 3300005436 Ga0070713_100068149 Ga0070713_1000681492 305
8 3300005437 Ga0070710_10131786 Ga0070710_101317861 305
9 3300025898 Ga0207692_10040578 Ga0207692_100405782 305
10 3300025916 Ga0207663_10039513 Ga0207663_100395135 305
11 3300025928 Ga0207700_10032112 Ga0207700_100321122 305
12 3300025929 Ga0207664_10081616 Ga0207664_100816164 305
13 3300046462 Ga0495651_0205425 Ga0495651_0205425_33_1019 307
14 3300046516 Ga0495628_0006539 Ga0495628_0006539_3913_4899 307
15 3300046675 Ga0495657_0114829 Ga0495657_0114829_333_1319 307
16 3300046680 Ga0495646_0050284 Ga0495646_0050284_1447_2490 307
17 3300053078 Ga0495612_0001416 Ga0495612_0001416_8778_9821 307
18 3300053084 Ga0495595_0070401 Ga0495595_0070401_168_1154 307
19 3300053085 Ga0495619_0199142 Ga0495619_0199142_166_1152 307
20 3300036401 Ga0373937_0042694 Ga0373937_0042694_1390_2433 308
21 3300046454 Ga0495592_0079204 Ga0495592_0079204_33_1076 308
22 3300046543 Ga0495645_0003657 Ga0495645_0003657_7742_8785 308
23 3300046559 Ga0495667_0031058 Ga0495667_0031058_2485_3528 308
24 3300046675 Ga0495657_0011136 Ga0495657_0011136_1307_2350 308
25 3300046678 Ga0495599_0021447 Ga0495599_0021447_1827_2870 308
26 3300046679 Ga0495623_0012783 Ga0495623_0012783_3088_4131 308
27 3300047319 Ga0495674_0123502 Ga0495674_0123502_941_1984 308
28 3300047322 Ga0495680_0013432 Ga0495680_0013432_3574_4617 308
29 3300048088 Ga0495602_0021024 Ga0495602_0021024_4836_5879 308
30 3300048907 Ga0496104_0000289 Ga0496104_0000289_7231_8232 308
31 3300053077 Ga0495601_0002450 Ga0495601_0002450_8023_9066 308
32 3300053084 Ga0495595_0000618 Ga0495595_0000618_7990_9033 308
33 3300053085 Ga0495619_0024586 Ga0495619_0024586_941_1984 308
34 3300005458 Ga0070681_10105886 Ga0070681_101058864 310
35 3300034819 Ga0373958_0028799 Ga0373958_0028799_67_1056 310
36 3300036401 Ga0373937_0342994 Ga0373937_0342994_427_1395 311
37 3300048918 Ga0496115_0358264 Ga0496115_0358264_126_1094 311
38 3300053104 Ga0500556_0092305 Ga0500556_0092305_144_1082 311
39 3300049823 Ga0501044_0007557 Ga0501044_0007557_4313_5302 312
40 3300005435 Ga0070714_100016878 Ga0070714_1000168783 313
41 3300005437 Ga0070710_10003697 Ga0070710_100036978 313
42 3300005439 Ga0070711_100080357 Ga0070711_1000803572 313
43 3300005618 Ga0068864_100311901 Ga0068864_1003119011 313
44 3300005841 Ga0068863_100159818 Ga0068863_1001598182 313
45 3300006028 Ga0070717_10001430 Ga0070717_1000143017 313
46 3300006175 Ga0070712_100055389 Ga0070712_1000553892 313
47 3300009011 Ga0105251_10058468 Ga0105251_100584682 313
48 3300009094 Ga0111539_10001374 Ga0111539_1000137416 313
49 3300009094 Ga0111539_10522252 Ga0111539_105222522 313
50 3300009147 Ga0114129_10000243 Ga0114129_1000024352 313
51 3300009177 Ga0105248_10002115 Ga0105248_100021152 313
52 3300013297 Ga0157378_10001272 Ga0157378_1000127219 313
53 3300025302 Ga0207426_1021296 Ga0207426_10212962 313
54 3300025302 Ga0207426_1023995 Ga0207426_10239952 313
55 3300025915 Ga0207693_10111447 Ga0207693_101114472 313
56 3300025928 Ga0207700_10002378 Ga0207700_100023786 313
57 3300025931 Ga0207644_10048005 Ga0207644_100480052 313
58 3300025939 Ga0207665_10000750 Ga0207665_1000075012 313
59 3300025941 Ga0207711_10001396 Ga0207711_100013962 313
60 3300026095 Ga0207676_10053591 Ga0207676_100535912 313
61 3300028379 Ga0268266_10001951 Ga0268266_100019512 313
62 3300037418 Ga0395900_0022683 Ga0395900_0022683_2082_3053 313
63 3300037466 Ga0395898_0022154 Ga0395898_0022154_3622_4593 313
64 3300038443 Ga0395901_0046168 Ga0395901_0046168_3017_3988 313
65 3300048903 Ga0496100_0024714 Ga0496100_0024714_309_1295 313
66 3300048909 Ga0496106_0048187 Ga0496106_0048187_1525_2511 313
67 3300048911 Ga0496108_0032039 Ga0496108_0032039_1326_2312 313
68 3300048914 Ga0496111_0019945 Ga0496111_0019945_1653_2639 313
69 3300049571 Ga0501034_0102278 Ga0501034_0102278_1257_2228 313
70 3300050507 nmdc:mga05p37_1364_c1 nmdc:mga05p37_1364_c1_16304_17320 313
71 3300050508 nmdc:mga09592_15777_c1 nmdc:mga09592_15777_c1_1181_2197 313
72 3300050509 nmdc:mga0qj67_15877_c1 nmdc:mga0qj67_15877_c1_998_2014 313
73 3300050510 nmdc:mga06r32_151_c1 nmdc:mga06r32_151_c1_35491_36507 313
74 3300050511 nmdc:mga08y16_86_c1 nmdc:mga08y16_86_c1_60793_61809 313
75 3300049742 Ga0501080_0139909 Ga0501080_0139909_511_1464 316
76 3300006028 Ga0070717_10037786 Ga0070717_100377866 317
77 3300025936 Ga0207670_10235185 Ga0207670_102351851 317
78 3300005983 Ga0081540_1013782 Ga0081540_10137822 318
79 3300006194 Ga0075427_10000369 Ga0075427_100003693 318
80 3300006847 Ga0075431_100030512 Ga0075431_1000305123 318
81 3300007076 Ga0075435_100066604 Ga0075435_1000666043 318
82 3300009147 Ga0114129_10033779 Ga0114129_100337793 318
83 3300027907 Ga0207428_10000114 Ga0207428_100001144 318
84 3300044684 Ga0466966_0022484 Ga0466966_0022484_2140_3117 318
85 3300044842 Ga0466957_0207700 Ga0466957_0207700_145_1122 318
86 3300045836 Ga0466958_0017616 Ga0466958_0017616_1718_2695 318
87 3300046462 Ga0495651_0046835 Ga0495651_0046835_1498_2487 318
88 3300047317 Ga0495604_0046289 Ga0495604_0046289_1741_2730 318
89 3300047319 Ga0495674_0051830 Ga0495674_0051830_1744_2733 318
90 3300047322 Ga0495680_0017129 Ga0495680_0017129_1688_2677 318
91 3300048918 Ga0496115_0154476 Ga0496115_0154476_248_1261 318
92 3300050508 nmdc:mga09592_28362_c1 nmdc:mga09592_28362_c1_737_1741 318
93 3300050510 nmdc:mga06r32_71986_c1 nmdc:mga06r32_71986_c1_1607_2611 318
94 3300050511 nmdc:mga08y16_100428_c1 nmdc:mga08y16_100428_c1_1607_2611 318
95 3300050512 nmdc:mga0n895_22982_c1 nmdc:mga0n895_22982_c1_2367_3371 318
96 3300050513 nmdc:mga0rr50_178817_c1 nmdc:mga0rr50_178817_c1_569_1552 318
97 3300050515 nmdc:mga0a205_9463_c1 nmdc:mga0a205_9463_c1_6177_7181 318
98 3300053077 Ga0495601_0012123 Ga0495601_0012123_2020_3009 318
99 3300053085 Ga0495619_0000927 Ga0495619_0000927_4803_5792 318
100 3300061719 Ga0466962_0023616 Ga0466962_0023616_1482_2459 318
101 3300005329 Ga0070683_100008015 Ga0070683_1000080153 319
102 3300005341 Ga0070691_10033142 Ga0070691_100331421 319
103 3300005347 Ga0070668_100302320 Ga0070668_1003023202 319
104 3300005356 Ga0070674_100030817 Ga0070674_1000308176 319
105 3300005364 Ga0070673_100070614 Ga0070673_1000706142 319
106 3300005367 Ga0070667_100118160 Ga0070667_1001181602 319
107 3300005436 Ga0070713_100370067 Ga0070713_1003700671 319
108 3300005437 Ga0070710_10032418 Ga0070710_100324182 319
109 3300005456 Ga0070678_100012032 Ga0070678_1000120323 319
110 3300005456 Ga0070678_100014517 Ga0070678_1000145171 319
111 3300005466 Ga0070685_10189458 Ga0070685_101894582 319
112 3300005535 Ga0070684_100221521 Ga0070684_1002215212 319
113 3300005545 Ga0070695_100170987 Ga0070695_1001709872 319
114 3300005617 Ga0068859_100277172 Ga0068859_1002771722 319
115 3300005842 Ga0068858_100019328 Ga0068858_1000193284 319
116 3300005843 Ga0068860_100088490 Ga0068860_1000884902 319
117 3300006028 Ga0070717_10171911 Ga0070717_101719112 319
118 3300006163 Ga0070715_10014082 Ga0070715_100140822 319
119 3300006358 Ga0068871_100043950 Ga0068871_1000439502 319
120 3300006358 Ga0068871_100129648 Ga0068871_1001296482 319
121 3300006881 Ga0068865_100092550 Ga0068865_1000925502 319
122 3300006931 Ga0097620_100277161 Ga0097620_1002771612 319
123 3300007076 Ga0075435_100010184 Ga0075435_1000101847 319
124 3300009098 Ga0105245_10186781 Ga0105245_101867813 319
125 3300009176 Ga0105242_10074279 Ga0105242_100742793 319
126 3300009177 Ga0105248_10107832 Ga0105248_101078324 319
127 3300009545 Ga0105237_10099482 Ga0105237_100994823 319
128 3300009551 Ga0105238_10024417 Ga0105238_100244173 319
129 3300010375 Ga0105239_10312708 Ga0105239_103127082 319
130 3300011119 Ga0105246_10076595 Ga0105246_100765953 319
131 3300013306 Ga0163162_10064062 Ga0163162_100640622 319
132 3300013306 Ga0163162_10389869 Ga0163162_103898692 319
133 3300013308 Ga0157375_10178227 Ga0157375_101782272 319
134 3300014325 Ga0163163_10237098 Ga0163163_102370982 319
135 3300014969 Ga0157376_10000711 Ga0157376_1000071119 319
136 3300025905 Ga0207685_10006929 Ga0207685_100069292 319
137 3300025906 Ga0207699_10030084 Ga0207699_100300841 319
138 3300025914 Ga0207671_10235021 Ga0207671_102350212 319
139 3300025915 Ga0207693_10128165 Ga0207693_101281652 319
140 3300025920 Ga0207649_10033244 Ga0207649_100332444 319
141 3300025920 Ga0207649_10128317 Ga0207649_101283171 319
142 3300025921 Ga0207652_10037747 Ga0207652_100377472 319
143 3300025924 Ga0207694_10027429 Ga0207694_100274294 319
144 3300025928 Ga0207700_10023435 Ga0207700_100234353 319
145 3300025933 Ga0207706_10019741 Ga0207706_100197412 319
146 3300025934 Ga0207686_10016927 Ga0207686_100169273 319
147 3300025935 Ga0207709_10061876 Ga0207709_100618762 319
148 3300025935 Ga0207709_10128232 Ga0207709_101282321 319
149 3300025938 Ga0207704_10054480 Ga0207704_100544802 319
150 3300025939 Ga0207665_10036787 Ga0207665_100367873 319
151 3300025941 Ga0207711_10013935 Ga0207711_100139355 319
152 3300025944 Ga0207661_10015125 Ga0207661_100151254 319
153 3300025960 Ga0207651_10158135 Ga0207651_101581352 319
154 3300026067 Ga0207678_10370177 Ga0207678_103701771 319
155 3300026078 Ga0207702_10135928 Ga0207702_101359282 319
156 3300026118 Ga0207675_100484695 Ga0207675_1004846951 319
157 3300026121 Ga0207683_10008034 Ga0207683_1000803412 319
158 3300028381 Ga0268264_10116273 Ga0268264_101162732 319
159 3300034816 Ga0373930_0002870 Ga0373930_0002870_345_1331 319
160 3300034818 Ga0373950_0014272 Ga0373950_0014272_237_1223 319
161 3300034819 Ga0373958_0002797 Ga0373958_0002797_1374_2360 319
162 3300034820 Ga0373959_0008287 Ga0373959_0008287_10_996 319
163 3300034957 Ga0373938_0001106 Ga0373938_0001106_873_1859 319
164 3300035112 Ga0373932_0003262 Ga0373932_0003262_1307_2293 319
165 3300035115 Ga0373941_0007101 Ga0373941_0007101_1300_2286 319
166 3300035116 Ga0373945_0004472 Ga0373945_0004472_1500_2486 319
167 3300035116 Ga0373945_0046573 Ga0373945_0046573_311_1297 319
168 3300035118 Ga0373954_0000716 Ga0373954_0000716_7055_8041 319
169 3300035119 Ga0373956_0002334 Ga0373956_0002334_3729_4715 319
170 3300035170 Ga0373943_0035807 Ga0373943_0035807_56_1042 319
171 3300035170 Ga0373943_0047798 Ga0373943_0047798_101_1087 319
172 3300035171 Ga0373946_0026164 Ga0373946_0026164_520_1506 319
173 3300035171 Ga0373946_0035754 Ga0373946_0035754_1009_1995 319
174 3300035172 Ga0373955_0005309 Ga0373955_0005309_1344_2330 319
175 3300035242 Ga0373962_0014472 Ga0373962_0014472_575_1561 319
176 3300035410 Ga0373924_0030413 Ga0373924_0030413_922_2151 319
177 3300035691 Ga0373931_0029357 Ga0373931_0029357_461_1447 319
178 3300035692 Ga0373935_0047087 Ga0373935_0047087_1693_2679 319
179 3300035695 Ga0373927_0025167 Ga0373927_0025167_989_1975 319
180 3300035724 Ga0373933_0002754 Ga0373933_0002754_7951_8937 319
181 3300035724 Ga0373933_0056101 Ga0373933_0056101_458_1444 319
182 3300036401 Ga0373937_0004226 Ga0373937_0004226_7836_8822 319
183 3300045051 Ga0451576_0680321 Ga0451576_0680321_16_1002 319
184 3300046454 Ga0495592_0024412 Ga0495592_0024412_2041_3027 319
185 3300046461 Ga0495641_0021426 Ga0495641_0021426_54_1040 319
186 3300046461 Ga0495641_0025217 Ga0495641_0025217_1509_2495 319
187 3300046462 Ga0495651_0052539 Ga0495651_0052539_1415_2401 319
188 3300046463 Ga0495653_0009407 Ga0495653_0009407_97_1083 319
189 3300046463 Ga0495653_0042049 Ga0495653_0042049_1493_2479 319
190 3300046472 Ga0495580_0024969 Ga0495580_0024969_2380_3366 319
191 3300046473 Ga0495582_0007119 Ga0495582_0007119_4129_5115 319
192 3300046475 Ga0495639_0014548 Ga0495639_0014548_896_1882 319
193 3300046476 Ga0495662_0078786 Ga0495662_0078786_330_1316 319
194 3300046491 Ga0495584_0057434 Ga0495584_0057434_757_1743 319
195 3300046492 Ga0495585_0025468 Ga0495585_0025468_848_1834 319
196 3300046499 Ga0495594_0059295 Ga0495594_0059295_915_1901 319
197 3300046499 Ga0495594_0149369 Ga0495594_0149369_301_1287 319
198 3300046501 Ga0495607_0060783 Ga0495607_0060783_406_1392 319
199 3300046511 Ga0495608_0090340 Ga0495608_0090340_693_1679 319
200 3300046514 Ga0495618_0029543 Ga0495618_0029543_1336_2322 319
201 3300046514 Ga0495618_0043109 Ga0495618_0043109_1756_2742 319
202 3300046514 Ga0495618_0257451 Ga0495618_0257451_75_1061 319
203 3300046523 Ga0495644_0014442 Ga0495644_0014442_1025_2011 319
204 3300046526 Ga0495666_0007866 Ga0495666_0007866_3267_4253 319
205 3300046526 Ga0495666_0071703 Ga0495666_0071703_65_1051 319
206 3300046531 Ga0495665_0059864 Ga0495665_0059864_522_1508 319
207 3300046533 Ga0495640_0023368 Ga0495640_0023368_1014_2000 319
208 3300046536 Ga0495587_0005891 Ga0495587_0005891_1409_2395 319
209 3300046536 Ga0495587_0159621 Ga0495587_0159621_210_1196 319
210 3300046538 Ga0495609_0104719 Ga0495609_0104719_121_1107 319
211 3300046543 Ga0495645_0138918 Ga0495645_0138918_429_1415 319
212 3300046557 Ga0495622_0092916 Ga0495622_0092916_336_1322 319
213 3300046558 Ga0495633_0014772 Ga0495633_0014772_700_1686 319
214 3300046559 Ga0495667_0178241 Ga0495667_0178241_132_1118 319
215 3300046615 Ga0495656_0006991 Ga0495656_0006991_403_1389 319
216 3300046642 Ga0495634_0049955 Ga0495634_0049955_122_1108 319
217 3300046642 Ga0495634_0098078 Ga0495634_0098078_95_1081 319
218 3300046663 Ga0495635_0045751 Ga0495635_0045751_1969_2955 319
219 3300046664 Ga0495659_0029999 Ga0495659_0029999_748_1734 319
220 3300046674 Ga0495588_0085514 Ga0495588_0085514_103_1089 319
221 3300046675 Ga0495657_0001222 Ga0495657_0001222_10847_11833 319
222 3300046678 Ga0495599_0028439 Ga0495599_0028439_519_1505 319
223 3300046679 Ga0495623_0000281 Ga0495623_0000281_22697_23683 319
224 3300046680 Ga0495646_0008339 Ga0495646_0008339_4912_5898 319
225 3300046683 Ga0495658_0000968 Ga0495658_0000968_14224_15210 319
226 3300046683 Ga0495658_0047331 Ga0495658_0047331_875_1861 319
227 3300046683 Ga0495658_0250190 Ga0495658_0250190_91_1077 319
228 3300046809 Ga0495600_0002330 Ga0495600_0002330_8099_9085 319
229 3300046809 Ga0495600_0027913 Ga0495600_0027913_2520_3506 319
230 3300047315 Ga0495581_0010216 Ga0495581_0010216_707_1693 319
231 3300047317 Ga0495604_0012323 Ga0495604_0012323_5689_6675 319
232 3300047319 Ga0495674_0010712 Ga0495674_0010712_4555_5541 319
233 3300047319 Ga0495674_0034391 Ga0495674_0034391_3233_4219 319
234 3300047321 Ga0495676_0014548 Ga0495676_0014548_3891_4877 319
235 3300047321 Ga0495676_0053084 Ga0495676_0053084_2017_3003 319
236 3300047321 Ga0495676_0109131 Ga0495676_0109131_869_1855 319
237 3300047322 Ga0495680_0018150 Ga0495680_0018150_3034_4020 319
238 3300047322 Ga0495680_0054810 Ga0495680_0054810_1963_2949 319
239 3300047471 Ga0495684_0020169 Ga0495684_0020169_3899_4885 319
240 3300047673 Ga0495593_0027021 Ga0495593_0027021_2160_3146 319
241 3300047673 Ga0495593_0031251 Ga0495593_0031251_610_1596 319
242 3300048088 Ga0495602_0027080 Ga0495602_0027080_3311_4297 319
243 3300048904 Ga0496101_0145009 Ga0496101_0145009_140_1126 319
244 3300048905 Ga0496102_0117452 Ga0496102_0117452_871_1857 319
245 3300048906 Ga0496103_0003575 Ga0496103_0003575_298_1284 319
246 3300048907 Ga0496104_0027010 Ga0496104_0027010_2044_3030 319
247 3300048907 Ga0496104_0060651 Ga0496104_0060651_1525_2511 319
248 3300048907 Ga0496104_0162853 Ga0496104_0162853_81_1067 319
249 3300048908 Ga0496105_0086491 Ga0496105_0086491_105_1091 319
250 3300048908 Ga0496105_0121202 Ga0496105_0121202_438_1424 319
251 3300048910 Ga0496107_0027434 Ga0496107_0027434_2457_3443 319
252 3300048910 Ga0496107_0028627 Ga0496107_0028627_787_1773 319
253 3300048911 Ga0496108_0043256 Ga0496108_0043256_1705_2691 319
254 3300048911 Ga0496108_0266057 Ga0496108_0266057_496_1482 319
255 3300048912 Ga0496109_0195855 Ga0496109_0195855_394_1380 319
256 3300048914 Ga0496111_0261308 Ga0496111_0261308_140_1126 319
257 3300048915 Ga0496112_0160725 Ga0496112_0160725_117_1103 319
258 3300048916 Ga0496113_0057903 Ga0496113_0057903_376_1362 319
259 3300048917 Ga0496114_0044243 Ga0496114_0044243_457_1443 319
260 3300048918 Ga0496115_0018941 Ga0496115_0018941_1473_2459 319
261 3300048918 Ga0496115_0172163 Ga0496115_0172163_748_1734 319
262 3300050512 nmdc:mga0n895_141219_c1 nmdc:mga0n895_141219_c1_41_1027 319
263 3300050513 nmdc:mga0rr50_253113_c1 nmdc:mga0rr50_253113_c1_278_1264 319
264 3300050514 nmdc:mga08x19_95303_c1 nmdc:mga08x19_95303_c1_789_1775 319
265 3300053077 Ga0495601_0019792 Ga0495601_0019792_1367_2353 319
266 3300053077 Ga0495601_0040702 Ga0495601_0040702_1233_2219 319
267 3300053078 Ga0495612_0013678 Ga0495612_0013678_1970_2956 319
268 3300053084 Ga0495595_0000129 Ga0495595_0000129_19413_20399 319
269 3300053084 Ga0495595_0010666 Ga0495595_0010666_1458_2444 319
270 3300053085 Ga0495619_0003524 Ga0495619_0003524_6827_7813 319
271 3300053125 Ga0500618_030498 Ga0500618_030498_221_1207 319
272 3300005329 Ga0070683_100000652 Ga0070683_10000065210 320
273 3300005535 Ga0070684_100001124 Ga0070684_1000011248 320
274 3300005615 Ga0070702_100189329 Ga0070702_1001893292 320
275 3300006038 Ga0075365_10222344 Ga0075365_102223442 320
276 3300006051 Ga0075364_10030887 Ga0075364_100308874 320
277 3300006844 Ga0075428_100164742 Ga0075428_1001647422 320
278 3300006844 Ga0075428_100167039 Ga0075428_1001670393 320
279 3300007788 Ga0099795_10042628 Ga0099795_100426282 320
280 3300010159 Ga0099796_10088559 Ga0099796_100885591 320
281 3300013307 Ga0157372_10484794 Ga0157372_104847942 320
282 3300025944 Ga0207661_10000358 Ga0207661_1000035826 320
283 3300031241 Ga0265325_10050999 Ga0265325_100509992 320
284 3300031247 Ga0265340_10042778 Ga0265340_100427782 320
285 3300031249 Ga0265339_10005936 Ga0265339_100059366 320
286 3300031595 Ga0265313_10005423 Ga0265313_100054235 320
287 3300035172 Ga0373955_0022986 Ga0373955_0022986_230_1201 320
288 3300035724 Ga0373933_0166821 Ga0373933_0166821_230_1228 320
289 3300036401 Ga0373937_0010149 Ga0373937_0010149_2617_3588 320
290 3300037466 Ga0395898_0178182 Ga0395898_0178182_720_1697 320
291 3300038443 Ga0395901_0435960 Ga0395901_0435960_302_1279 320
292 3300048909 Ga0496106_0043151 Ga0496106_0043151_1496_2515 320
293 3300050507 nmdc:mga05p37_241529_c1 nmdc:mga05p37_241529_c1_919_1884 320
294 3300053088 Ga0500644_0000592 Ga0500644_0000592_10199_11209 320
295 3300053133 Ga0500655_023389 Ga0500655_023389_142_1152 320
296 3300053153 Ga0500616_0000001 Ga0500616_0000001_800118_801128 320
297 iso_pu_bacteria 2939631187 2939634528 320
298 3300005356 Ga0070674_100016936 Ga0070674_1000169364 321
299 3300006844 Ga0075428_100329881 Ga0075428_1003298812 321
300 3300009094 Ga0111539_10121756 Ga0111539_101217563 321
301 3300009177 Ga0105248_10024799 Ga0105248_100247997 321
302 3300021384 Ga0213876_10081189 Ga0213876_100811891 321
303 3300025940 Ga0207691_10215684 Ga0207691_102156842 321
304 3300025941 Ga0207711_10010444 Ga0207711_100104444 321
305 3300025949 Ga0207667_10289985 Ga0207667_102899851 321
306 3300026067 Ga0207678_10161497 Ga0207678_101614972 321
307 3300031241 Ga0265325_10004554 Ga0265325_100045544 321
308 3300031711 Ga0265314_10005690 Ga0265314_100056902 321
309 3300035691 Ga0373931_0002378 Ga0373931_0002378_2241_3239 321
310 3300039437 Ga0436365_1908596 Ga0436365_1908596_1422_2387 321
311 3300039453 Ga0436362_0561887 Ga0436362_0561887_107_1072 321
312 3300048904 Ga0496101_0010164 Ga0496101_0010164_2620_3618 321
313 3300048907 Ga0496104_0145084 Ga0496104_0145084_1259_2257 321
314 3300048908 Ga0496105_0050154 Ga0496105_0050154_1912_2910 321
315 3300048913 Ga0496110_0034056 Ga0496110_0034056_49_1047 321
316 3300048914 Ga0496111_0017758 Ga0496111_0017758_56_1054 321
317 3300048917 Ga0496114_0028120 Ga0496114_0028120_156_1142 321
318 3300048918 Ga0496115_0003653 Ga0496115_0003653_4190_5188 321
319 3300050492 nmdc:mga0yw44_116230_c1 nmdc:mga0yw44_116230_c1_153_1217 321
320 3300050507 nmdc:mga05p37_54763_c1 nmdc:mga05p37_54763_c1_822_1880 321
321 3300050511 nmdc:mga08y16_166833_c1 nmdc:mga08y16_166833_c1_728_1708 321
322 3300053087 Ga0500643_008449 Ga0500643_008449_2661_3686 321
323 3300053093 Ga0500651_0048666 Ga0500651_0048666_1375_2463 321
324 3300053117 Ga0500593_058283 Ga0500593_058283_672_1643 321
325 3300053119 Ga0500595_000010 Ga0500595_000010_19805_20893 321
326 3300005329 Ga0070683_100193400 Ga0070683_1001934002 322
327 3300005330 Ga0070690_100128515 Ga0070690_1001285152 322
328 3300005340 Ga0070689_100159958 Ga0070689_1001599582 322
329 3300005343 Ga0070687_100092917 Ga0070687_1000929171 322
330 3300005347 Ga0070668_100106892 Ga0070668_1001068923 322
331 3300005365 Ga0070688_100021478 Ga0070688_1000214782 322
332 3300005435 Ga0070714_100069197 Ga0070714_1000691972 322
333 3300005439 Ga0070711_100168653 Ga0070711_1001686531 322
334 3300005466 Ga0070685_10190953 Ga0070685_101909532 322
335 3300005544 Ga0070686_100061397 Ga0070686_1000613972 322
336 3300005563 Ga0068855_100009947 Ga0068855_1000099478 322
337 3300005563 Ga0068855_100022548 Ga0068855_1000225484 322
338 3300005616 Ga0068852_100013278 Ga0068852_1000132786 322
339 3300005616 Ga0068852_100120335 Ga0068852_1001203352 322
340 3300005719 Ga0068861_100189591 Ga0068861_1001895912 322
341 3300005981 Ga0081538_10006861 Ga0081538_100068617 322
342 3300006051 Ga0075364_10075072 Ga0075364_100750722 322
343 3300006177 Ga0075362_10015230 Ga0075362_100152303 322
344 3300006871 Ga0075434_100154601 Ga0075434_1001546012 322
345 3300007076 Ga0075435_100106724 Ga0075435_1001067242 322
346 3300009094 Ga0111539_10202572 Ga0111539_102025722 322
347 3300009094 Ga0111539_10299303 Ga0111539_102993032 322
348 3300013308 Ga0157375_10081037 Ga0157375_100810372 322
349 3300021441 Ga0213871_10001061 Ga0213871_100010611 322
350 3300025321 Ga0207656_10114340 Ga0207656_101143401 322
351 3300025907 Ga0207645_10047433 Ga0207645_100474332 322
352 3300025912 Ga0207707_10218731 Ga0207707_102187312 322
353 3300025915 Ga0207693_10071700 Ga0207693_100717002 322
354 3300025918 Ga0207662_10081017 Ga0207662_100810172 322
355 3300025923 Ga0207681_10239625 Ga0207681_102396252 322
356 3300025924 Ga0207694_10012374 Ga0207694_100123746 322
357 3300025935 Ga0207709_10105504 Ga0207709_101055042 322
358 3300025941 Ga0207711_10490352 Ga0207711_104903521 322
359 3300025944 Ga0207661_10177266 Ga0207661_101772661 322
360 3300025949 Ga0207667_10028639 Ga0207667_100286394 322
361 3300025949 Ga0207667_10043710 Ga0207667_100437102 322
362 3300026078 Ga0207702_10559470 Ga0207702_105594701 322
363 3300026095 Ga0207676_10064625 Ga0207676_100646252 322
364 3300026118 Ga0207675_100252758 Ga0207675_1002527582 322
365 3300026142 Ga0207698_10010082 Ga0207698_100100825 322
366 3300026142 Ga0207698_10119373 Ga0207698_101193732 322
367 3300031711 Ga0265314_10022029 Ga0265314_100220293 322
368 3300035085 Ga0373929_0005388 Ga0373929_0005388_1122_2099 322
369 3300035111 Ga0373923_0014196 Ga0373923_0014196_182_1153 322
370 3300035113 Ga0373936_0009737 Ga0373936_0009737_2024_2995 322
371 3300035116 Ga0373945_0075473 Ga0373945_0075473_123_1094 322
372 3300035117 Ga0373953_0008926 Ga0373953_0008926_950_1921 322
373 3300035118 Ga0373954_0001345 Ga0373954_0001345_6318_7289 322
374 3300035170 Ga0373943_0000451 Ga0373943_0000451_16086_17057 322
375 3300035170 Ga0373943_0054398 Ga0373943_0054398_831_1808 322
376 3300035171 Ga0373946_0003257 Ga0373946_0003257_342_1313 322
377 3300035172 Ga0373955_0072935 Ga0373955_0072935_730_1701 322
378 3300035410 Ga0373924_0024547 Ga0373924_0024547_304_1275 322
379 3300035691 Ga0373931_0029750 Ga0373931_0029750_165_1142 322
380 3300035692 Ga0373935_0000058 Ga0373935_0000058_44302_45273 322
381 3300035695 Ga0373927_0028424 Ga0373927_0028424_2497_3468 322
382 3300035724 Ga0373933_0000674 Ga0373933_0000674_1971_2942 322
383 3300035725 Ga0373947_0008471 Ga0373947_0008471_14_985 322
384 3300036401 Ga0373937_0000624 Ga0373937_0000624_197_1168 322
385 3300037068 Ga0373925_0000069 Ga0373925_0000069_11918_12889 322
386 3300037068 Ga0373925_0199949 Ga0373925_0199949_580_1551 322
387 3300037312 Ga0395899_0155536 Ga0395899_0155536_284_1324 322
388 3300037418 Ga0395900_0005185 Ga0395900_0005185_11429_12469 322
389 3300037466 Ga0395898_0013898 Ga0395898_0013898_1205_2245 322
390 3300039438 Ga0436360_0893150 Ga0436360_0893150_3167_4186 322
391 3300045976 Ga0466967_0590985 Ga0466967_0590985_33_1004 322
392 3300046454 Ga0495592_0000009 Ga0495592_0000009_187_1158 322
393 3300046459 Ga0495629_0064270 Ga0495629_0064270_1156_2127 322
394 3300046462 Ga0495651_0004786 Ga0495651_0004786_9249_10220 322
395 3300046463 Ga0495653_0001004 Ga0495653_0001004_5268_6239 322
396 3300046473 Ga0495582_0049437 Ga0495582_0049437_127_1098 322
397 3300046476 Ga0495662_0005870 Ga0495662_0005870_5000_5971 322
398 3300046477 Ga0495664_0000002 Ga0495664_0000002_453224_454195 322
399 3300046491 Ga0495584_0012806 Ga0495584_0012806_2068_3060 322
400 3300046511 Ga0495608_0000009 Ga0495608_0000009_26240_27211 322
401 3300046514 Ga0495618_0001315 Ga0495618_0001315_15564_16535 322
402 3300046516 Ga0495628_0000002 Ga0495628_0000002_417609_418580 322
403 3300046517 Ga0495630_0012154 Ga0495630_0012154_5034_6005 322
404 3300046529 Ga0495652_0000004 Ga0495652_0000004_170303_171274 322
405 3300046533 Ga0495640_0000005 Ga0495640_0000005_26255_27226 322
406 3300046536 Ga0495587_0000018 Ga0495587_0000018_165211_166182 322
407 3300046543 Ga0495645_0000003 Ga0495645_0000003_398860_399831 322
408 3300046559 Ga0495667_0000002 Ga0495667_0000002_19143_20114 322
409 3300046642 Ga0495634_0045735 Ga0495634_0045735_423_1394 322
410 3300046663 Ga0495635_0000285 Ga0495635_0000285_26193_27164 322
411 3300046675 Ga0495657_0001285 Ga0495657_0001285_5266_6237 322
412 3300046678 Ga0495599_0000241 Ga0495599_0000241_18205_19176 322
413 3300046679 Ga0495623_0000659 Ga0495623_0000659_10445_11416 322
414 3300046680 Ga0495646_0000025 Ga0495646_0000025_88880_89851 322
415 3300046689 Ga0495613_0036083 Ga0495613_0036083_403_1374 322
416 3300046689 Ga0495613_0237344 Ga0495613_0237344_271_1242 322
417 3300046809 Ga0495600_0000798 Ga0495600_0000798_177_1148 322
418 3300047317 Ga0495604_0000747 Ga0495604_0000747_26133_27104 322
419 3300047319 Ga0495674_0000003 Ga0495674_0000003_143546_144517 322
420 3300047321 Ga0495676_0246910 Ga0495676_0246910_24_995 322
421 3300047322 Ga0495680_0000745 Ga0495680_0000745_34954_35925 322
422 3300047444 Ga0495675_0000322 Ga0495675_0000322_32995_33966 322
423 3300047471 Ga0495684_0000405 Ga0495684_0000405_18777_19748 322
424 3300047673 Ga0495593_0000954 Ga0495593_0000954_15529_16500 322
425 3300048088 Ga0495602_0003262 Ga0495602_0003262_220_1191 322
426 3300048903 Ga0496100_0067033 Ga0496100_0067033_572_1540 322
427 3300049583 Ga0501067_0136529 Ga0501067_0136529_65_1036 322
428 3300050492 nmdc:mga0yw44_47866_c1 nmdc:mga0yw44_47866_c1_205_1179 322
429 3300050493 nmdc:mga0k408_21981_c1 nmdc:mga0k408_21981_c1_1459_2433 322
430 3300050493 nmdc:mga0k408_8112_c1 nmdc:mga0k408_8112_c1_3427_4404 322
431 3300050511 nmdc:mga08y16_170167_c1 nmdc:mga08y16_170167_c1_1195_2196 322
432 3300050512 nmdc:mga0n895_28479_c1 nmdc:mga0n895_28479_c1_1204_2205 322
433 3300050513 nmdc:mga0rr50_92508_c1 nmdc:mga0rr50_92508_c1_1248_2249 322
434 3300050515 nmdc:mga0a205_22305_c1 nmdc:mga0a205_22305_c1_741_1742 322
435 3300053077 Ga0495601_0000010 Ga0495601_0000010_170257_171228 322
436 3300053078 Ga0495612_0019466 Ga0495612_0019466_1577_2548 322
437 3300053084 Ga0495595_0000386 Ga0495595_0000386_189_1160 322
438 3300053084 Ga0495595_0018013 Ga0495595_0018013_1934_2911 322
439 3300053085 Ga0495619_0000002 Ga0495619_0000002_417612_418583 322
440 3300054114 Ga0501084_0423698 Ga0501084_0423698_126_1097 322
441 3300003203 JGI25406J46586_10039483 JGI25406J46586_100394832 323
442 3300003659 JGI25404J52841_10004865 JGI25404J52841_100048652 323
443 3300005340 Ga0070689_100027638 Ga0070689_1000276383 323
444 3300005353 Ga0070669_100055307 Ga0070669_1000553072 323
445 3300005354 Ga0070675_100032023 Ga0070675_1000320233 323
446 3300005354 Ga0070675_100044652 Ga0070675_1000446523 323
447 3300005365 Ga0070688_100007756 Ga0070688_1000077563 323
448 3300005456 Ga0070678_100054480 Ga0070678_1000544802 323
449 3300005458 Ga0070681_10012646 Ga0070681_100126468 323
450 3300005459 Ga0068867_100210048 Ga0068867_1002100482 323
451 3300005530 Ga0070679_100007804 Ga0070679_1000078042 323
452 3300005578 Ga0068854_100079351 Ga0068854_1000793512 323
453 3300005617 Ga0068859_100161307 Ga0068859_1001613072 323
454 3300005618 Ga0068864_100108703 Ga0068864_1001087032 323
455 3300005983 Ga0081540_1000183 Ga0081540_100018314 323
456 3300005985 Ga0081539_10000734 Ga0081539_1000073458 323
457 3300006177 Ga0075362_10047260 Ga0075362_100472602 323
458 3300006846 Ga0075430_100019015 Ga0075430_1000190153 323
459 3300006881 Ga0068865_100214662 Ga0068865_1002146622 323
460 3300006931 Ga0097620_100161319 Ga0097620_1001613192 323
461 3300009147 Ga0114129_10967891 Ga0114129_109678911 323
462 3300013102 Ga0157371_10134948 Ga0157371_101349482 323
463 3300013104 Ga0157370_10149334 Ga0157370_101493343 323
464 3300013105 Ga0157369_10049187 Ga0157369_100491875 323
465 3300013306 Ga0163162_10127781 Ga0163162_101277812 323
466 3300013306 Ga0163162_10637826 Ga0163162_106378261 323
467 3300013308 Ga0157375_10120073 Ga0157375_101200733 323
468 3300013308 Ga0157375_10230097 Ga0157375_102300972 323
469 3300014325 Ga0163163_10067557 Ga0163163_100675573 323
470 3300020082 Ga0206353_12034808 Ga0206353_120348082 323
471 3300025302 Ga0207426_1022544 Ga0207426_10225442 323
472 3300025909 Ga0207705_10166389 Ga0207705_101663892 323
473 3300025912 Ga0207707_10232607 Ga0207707_102326071 323
474 3300025913 Ga0207695_10078348 Ga0207695_100783482 323
475 3300025917 Ga0207660_10048981 Ga0207660_100489813 323
476 3300025919 Ga0207657_10023292 Ga0207657_100232923 323
477 3300025921 Ga0207652_10049983 Ga0207652_100499833 323
478 3300025925 Ga0207650_10258441 Ga0207650_102584412 323
479 3300025926 Ga0207659_10051164 Ga0207659_100511643 323
480 3300025926 Ga0207659_10146905 Ga0207659_101469051 323
481 3300025931 Ga0207644_10042454 Ga0207644_100424543 323
482 3300025933 Ga0207706_10089101 Ga0207706_100891012 323
483 3300025936 Ga0207670_10005407 Ga0207670_100054072 323
484 3300025938 Ga0207704_10174305 Ga0207704_101743052 323
485 3300025941 Ga0207711_10009733 Ga0207711_100097335 323
486 3300025972 Ga0207668_10435155 Ga0207668_104351552 323
487 3300026067 Ga0207678_10512564 Ga0207678_105125641 323
488 3300026089 Ga0207648_10137292 Ga0207648_101372923 323
489 3300026095 Ga0207676_10016135 Ga0207676_100161354 323
490 3300028666 Ga0265336_10026649 Ga0265336_100266492 323
491 3300028800 Ga0265338_10033445 Ga0265338_100334454 323
492 3300028800 Ga0265338_10102614 Ga0265338_101026142 323
493 3300031235 Ga0265330_10020875 Ga0265330_100208752 323
494 3300031238 Ga0265332_10000542 Ga0265332_1000054213 323
495 3300031241 Ga0265325_10030871 Ga0265325_100308712 323
496 3300031247 Ga0265340_10001039 Ga0265340_1000103915 323
497 3300031247 Ga0265340_10029005 Ga0265340_100290053 323
498 3300031249 Ga0265339_10000085 Ga0265339_1000008526 323
499 3300031249 Ga0265339_10001756 Ga0265339_100017567 323
500 3300031249 Ga0265339_10011316 Ga0265339_100113165 323
501 3300031250 Ga0265331_10103735 Ga0265331_101037352 323
502 3300031344 Ga0265316_10258337 Ga0265316_102583372 323
503 3300031595 Ga0265313_10000505 Ga0265313_1000050527 323
504 3300031712 Ga0265342_10000050 Ga0265342_1000005046 323
505 3300031712 Ga0265342_10023921 Ga0265342_100239213 323
506 3300035121 Ga0373960_0007268 Ga0373960_0007268_673_1650 323
507 3300035242 Ga0373962_0045813 Ga0373962_0045813_111_1088 323
508 3300035691 Ga0373931_0012185 Ga0373931_0012185_218_1192 323
509 3300035691 Ga0373931_0023795 Ga0373931_0023795_1641_2618 323
510 3300047317 Ga0495604_0123275 Ga0495604_0123275_641_1615 323
511 3300048088 Ga0495602_0321716 Ga0495602_0321716_23_997 323
512 3300048908 Ga0496105_0027671 Ga0496105_0027671_498_1475 323
513 3300048909 Ga0496106_0016237 Ga0496106_0016237_87_1064 323
514 3300048910 Ga0496107_0099760 Ga0496107_0099760_315_1292 323
515 3300048911 Ga0496108_0136709 Ga0496108_0136709_545_1522 323
516 3300048913 Ga0496110_0026878 Ga0496110_0026878_586_1563 323
517 3300048913 Ga0496110_0202232 Ga0496110_0202232_247_1221 323
518 3300048914 Ga0496111_0036639 Ga0496111_0036639_1232_2209 323
519 3300048914 Ga0496111_0151484 Ga0496111_0151484_36_1010 323
520 3300048915 Ga0496112_0068007 Ga0496112_0068007_548_1525 323
521 3300048915 Ga0496112_0213330 Ga0496112_0213330_106_1080 323
522 3300048916 Ga0496113_0049360 Ga0496113_0049360_1493_2467 323
523 3300048918 Ga0496115_0003610 Ga0496115_0003610_7486_8463 323
524 3300049568 Ga0501031_0014149 Ga0501031_0014149_3095_4084 323
525 3300049569 Ga0501032_0045482 Ga0501032_0045482_965_1954 323
526 3300049570 Ga0501033_0097443 Ga0501033_0097443_1112_2101 323
527 3300049571 Ga0501034_0186197 Ga0501034_0186197_966_1955 323
528 3300049571 Ga0501034_0337083 Ga0501034_0337083_26_1000 323
529 3300049573 Ga0501037_0026906 Ga0501037_0026906_1449_2438 323
530 3300049574 Ga0501038_0031075 Ga0501038_0031075_740_1729 323
531 3300049575 Ga0501039_0005600 Ga0501039_0005600_7547_8536 323
532 3300049578 Ga0501042_0095096 Ga0501042_0095096_397_1386 323
533 3300049579 Ga0501043_0101907 Ga0501043_0101907_656_1645 323
534 3300049580 Ga0501046_0021756 Ga0501046_0021756_1758_2747 323
535 3300049581 Ga0501047_0074603 Ga0501047_0074603_972_1961 323
536 3300049582 Ga0501048_0044557 Ga0501048_0044557_1211_2200 323
537 3300049583 Ga0501067_0025973 Ga0501067_0025973_798_1787 323
538 3300049584 Ga0501068_0019428 Ga0501068_0019428_1757_2746 323
539 3300049585 Ga0501069_0015111 Ga0501069_0015111_1854_2843 323
540 3300049586 Ga0501070_0085549 Ga0501070_0085549_966_1955 323
541 3300049587 Ga0501071_0022725 Ga0501071_0022725_410_1399 323
542 3300049588 Ga0501072_0031344 Ga0501072_0031344_1173_2162 323
543 3300049589 Ga0501073_0021800 Ga0501073_0021800_2602_3591 323
544 3300049591 Ga0501075_0247368 Ga0501075_0247368_265_1239 323
545 3300049592 Ga0501076_0121530 Ga0501076_0121530_990_1979 323
546 3300049742 Ga0501080_0046049 Ga0501080_0046049_1608_2597 323
547 3300049744 Ga0501083_0055553 Ga0501083_0055553_990_1979 323
548 3300049822 Ga0501035_0123082 Ga0501035_0123082_311_1300 323
549 3300049823 Ga0501044_0133355 Ga0501044_0133355_522_1511 323
550 3300050493 nmdc:mga0k408_30818_c2 nmdc:mga0k408_30818_c2_1642_2616 323
551 3300050509 nmdc:mga0qj67_14545_c1 nmdc:mga0qj67_14545_c1_4029_5003 323
552 3300053084 Ga0495595_0034387 Ga0495595_0034387_532_1506 323
553 3300054114 Ga0501084_0082590 Ga0501084_0082590_1315_2304 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

112

386

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9727 26 322
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.969 30 323
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9658 26 323
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9638 26 321
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9632 26 322
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9523 126 243 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9429 126 247 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9409 126 247 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9336 127 247 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9306 126 244 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5C8CF86-F1-model_v4 deleted 0.9864 37 323
AF-A0A520EAY2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.983 29 323
AF-A0A6P2EN17-F1-model_v4 Argininosuccinate lyase 0.9815 26 323 GO:0016829
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9808 34 323
AF-C5TCY3-F1-model_v4 Extra-cytoplasmic solute receptor 0.9799 46 323

Feature Viewer

pLDDT pTM Quality
92.91 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map