F462867

General Info

Members Datasets Scaffolds Average Seq Length
553 223 1106 272

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10132619|Ga0207706_101326192
Length 332
Sequence MNPLRPADRYIAVNGLRLHCLDWGGDGPPLLLLHGFTGHAHAWDTLSIALQPHFHVYALDQRGHGESDPAEVYNPVVAFDDINGVLAELGLTTLTVIGLSMGGRNAMYFAAKRPEAVRRLVIVDIGPEISKKMSQAPPGPPEPETWDSIEQAAQHLLRGNPYPGIHYYRWVASHSLKARPDGRLVWQWHPSIKERRTQSDIDWWTVLKTIPAPTLVLRGAESPILDRDVAERMATTLPNGHFVEIPRAVCGATCLSTRWTRHGALIFRGKPKSLRFRIPASVTRSASPRSSNQSHCRDLIIADAADMPYRAAWFRTEAGNPRHVIVSAAFPR

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
167 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
168 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.54
Rhizosphere 99.46
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10132619 3300025933 Bacteria 2191
2 JGI25406J46586_10020311 3300003203 Bacteria 2688
3 JGI26141J51220_1001257 3300003503 Bacteria 1526
4 Ga0065715_10164788 3300005293 Bacteria 1594
5 Ga0065707_10195119 3300005295 Bacteria 1340
6 Ga0065707_10199066 3300005295 Bacteria 1320
7 Ga0070676_10001243 3300005328 Bacteria 12826
8 Ga0070690_100081694 3300005330 Bacteria 2115
9 Ga0070670_100001622 3300005331 Bacteria 18193
10 Ga0068869_100000916 3300005334 Bacteria 16992
11 Ga0068869_100014104 3300005334 Bacteria 5333
12 Ga0070680_100000611 3300005336 Bacteria 24734
13 Ga0070680_100010509 3300005336 Bacteria 7140
14 Ga0070680_100147324 3300005336 Bacteria 1976
15 Ga0070682_100000395 3300005337 Bacteria 29105
16 Ga0068868_100367599 3300005338 Bacteria 1235
17 Ga0070660_100000167 3300005339 Bacteria 43059
18 Ga0070689_100010360 3300005340 Bacteria 6647
19 Ga0070691_10014461 3300005341 Bacteria 3622
20 Ga0070687_100027924 3300005343 Bacteria 2731
21 Ga0070661_100000190 3300005344 Bacteria 50874
22 Ga0070692_10000116 3300005345 Bacteria 18580
23 Ga0070692_10059250 3300005345 Bacteria 2012
24 Ga0070668_100095203 3300005347 Bacteria 2352
25 Ga0070675_100127583 3300005354 Bacteria 2166
26 Ga0070673_100107323 3300005364 Bacteria 2309
27 Ga0070659_100001211 3300005366 Bacteria 18742
28 Ga0070703_10001794 3300005406 Bacteria 6360
29 Ga0070703_10003276 3300005406 Bacteria 4617
30 Ga0070701_10112090 3300005438 Bacteria 1525
31 Ga0070705_100000345 3300005440 Bacteria 27446
32 Ga0070705_100024014 3300005440 Bacteria 3283
33 Ga0070705_100044456 3300005440 Bacteria 2551
34 Ga0070705_100435415 3300005440 Bacteria 980
35 Ga0070700_100068273 3300005441 Bacteria 2260
36 Ga0070694_100001040 3300005444 Bacteria 15832
37 Ga0070694_100001543 3300005444 Bacteria 13539
38 Ga0070694_100019363 3300005444 Bacteria 4328
39 Ga0070694_100141800 3300005444 Bacteria 1746
40 Ga0070708_100002007 3300005445 Bacteria 15658
41 Ga0070708_100005807 3300005445 Bacteria 9798
42 Ga0070708_100044105 3300005445 Bacteria 3920
43 Ga0070708_100118840 3300005445 Bacteria 2436
44 Ga0070708_100161377 3300005445 Bacteria 2089
45 Ga0070708_100506715 3300005445 Bacteria 1138
46 Ga0070663_100001109 3300005455 Bacteria 14791
47 Ga0070662_100007298 3300005457 Bacteria 7161
48 Ga0070681_10002225 3300005458 Bacteria 17674
49 Ga0070681_10496823 3300005458 Unclassified 1133
50 Ga0068867_100000544 3300005459 Bacteria 24792
51 Ga0068867_100130588 3300005459 Bacteria 1952
52 Ga0070706_100021859 3300005467 Bacteria 5891
53 Ga0070706_100022083 3300005467 Bacteria 5860
54 Ga0070706_100059867 3300005467 Bacteria 3515
55 Ga0070706_100066375 3300005467 Bacteria 3337
56 Ga0070706_100142694 3300005467 Bacteria 2236
57 Ga0070707_100004378 3300005468 Bacteria 13222
58 Ga0070707_100010067 3300005468 Bacteria 8802
59 Ga0070707_100058475 3300005468 Bacteria 3697
60 Ga0070707_100079307 3300005468 Bacteria 3169
61 Ga0070707_100162866 3300005468 Bacteria 2173
62 Ga0070698_100004603 3300005471 Bacteria 15149
63 Ga0070698_100010736 3300005471 Bacteria 9748
64 Ga0070698_100011570 3300005471 Bacteria 9363
65 Ga0070698_100712629 3300005471 Bacteria 946
66 Ga0070699_100000858 3300005518 Bacteria 28228
67 Ga0070699_100003717 3300005518 Bacteria 13486
68 Ga0070699_100004306 3300005518 Bacteria 12582
69 Ga0070699_100040243 3300005518 Bacteria 4047
70 Ga0070699_100095450 3300005518 Bacteria 2603
71 Ga0070699_100132152 3300005518 Bacteria 2200
72 Ga0070699_100235342 3300005518 Bacteria 1634
73 Ga0070699_100674762 3300005518 Unclassified 944
74 Ga0070679_100003345 3300005530 Bacteria 14686
75 Ga0070684_100011210 3300005535 Bacteria 7137
76 Ga0070697_100000775 3300005536 Bacteria 23943
77 Ga0070697_100001063 3300005536 Bacteria 20764
78 Ga0070697_100049209 3300005536 Bacteria 3421
79 Ga0070697_100065961 3300005536 Bacteria 2959
80 Ga0070697_100082294 3300005536 Bacteria 2653
81 Ga0070697_100153332 3300005536 Bacteria 1943
82 Ga0070697_100236735 3300005536 Unclassified 1558
83 Ga0070697_100282469 3300005536 Bacteria 1424
84 Ga0068853_100000310 3300005539 Bacteria 34272
85 Ga0070695_100220386 3300005545 Bacteria 1366
86 Ga0070696_100001082 3300005546 Bacteria 17576
87 Ga0070696_100023946 3300005546 Bacteria 4149
88 Ga0070696_100051488 3300005546 Bacteria 2864
89 Ga0070696_100147101 3300005546 Bacteria 1727
90 Ga0070693_100000058 3300005547 Bacteria 43221
91 Ga0070693_100082261 3300005547 Bacteria 1922
92 Ga0070704_100000355 3300005549 Bacteria 20791
93 Ga0070704_100109646 3300005549 Bacteria 2098
94 Ga0070704_100112872 3300005549 Bacteria 2071
95 Ga0070704_100150593 3300005549 Bacteria 1829
96 Ga0070704_100373321 3300005549 Bacteria 1210
97 Ga0068855_100002540 3300005563 Bacteria 22481
98 Ga0070664_100009881 3300005564 Bacteria 7733
99 Ga0068857_100004036 3300005577 Bacteria 12358
100 Ga0068854_100005049 3300005578 Bacteria 8314
101 Ga0068856_100001786 3300005614 Bacteria 22477
102 Ga0070702_100279368 3300005615 Bacteria 1146
103 Ga0068859_100001779 3300005617 Bacteria 21926
104 Ga0068859_100886943 3300005617 Bacteria 977
105 Ga0068864_100001002 3300005618 Bacteria 23625
106 Ga0068861_100231924 3300005719 Bacteria 1566
107 Ga0068870_10000538 3300005840 Bacteria 14309
108 Ga0068863_100003230 3300005841 Bacteria 16139
109 Ga0068863_100016562 3300005841 Bacteria 7073
110 Ga0068858_100060854 3300005842 Bacteria 3490
111 Ga0068860_100009490 3300005843 Bacteria 9663
112 Ga0068860_100037632 3300005843 Bacteria 4631
113 Ga0068860_100274183 3300005843 Unclassified 1647
114 Ga0068860_100449021 3300005843 Bacteria 1282
115 Ga0068862_100010374 3300005844 Bacteria 7687
116 Ga0068862_100017270 3300005844 Bacteria 6006
117 Ga0081539_10000009 3300005985 Bacteria 509286
118 Ga0075432_10041434 3300006058 Bacteria 1609
119 Ga0070716_100032192 3300006173 Bacteria 2858
120 Ga0070716_100110163 3300006173 Bacteria 1705
121 Ga0070712_100002626 3300006175 Bacteria 11092
122 Ga0070712_100085184 3300006175 Bacteria 2300
123 Ga0075428_100000136 3300006844 Bacteria 64933
124 Ga0075428_100011921 3300006844 Bacteria 9670
125 Ga0075428_100031238 3300006844 Bacteria 5890
126 Ga0075428_100033421 3300006844 Bacteria 5680
127 Ga0075428_100041445 3300006844 Bacteria 5064
128 Ga0075428_100057815 3300006844 Bacteria 4245
129 Ga0075428_100188403 3300006844 Bacteria 2232
130 Ga0075428_100490205 3300006844 Bacteria 1315
131 Ga0075428_100617978 3300006844 Bacteria 1157
132 Ga0075428_100724917 3300006844 Unclassified 1059
133 Ga0075428_100744272 3300006844 Bacteria 1043
134 Ga0075430_100002583 3300006846 Bacteria 15106
135 Ga0075430_100004972 3300006846 Bacteria 11190
136 Ga0075430_100005542 3300006846 Bacteria 10659
137 Ga0075430_100027009 3300006846 Bacteria 4882
138 Ga0075430_100050509 3300006846 Bacteria 3507
139 Ga0075431_100000061 3300006847 Bacteria 61386
140 Ga0075431_100000122 3300006847 Bacteria 50972
141 Ga0075431_100001427 3300006847 Bacteria 21965
142 Ga0075431_100002112 3300006847 Bacteria 18989
143 Ga0075431_100008963 3300006847 Bacteria 10029
144 Ga0075431_100017393 3300006847 Bacteria 7306
145 Ga0075431_100147926 3300006847 Bacteria 2420
146 Ga0075431_100169475 3300006847 Bacteria 2244
147 Ga0075431_100272740 3300006847 Bacteria 1714
148 Ga0075431_100473642 3300006847 Unclassified 1246
149 Ga0075431_100489247 3300006847 Unclassified 1222
150 Ga0075433_10008471 3300006852 Bacteria 8208
151 Ga0075433_10022826 3300006852 Bacteria 5257
152 Ga0075433_10027440 3300006852 Bacteria 4830
153 Ga0075433_10037338 3300006852 Bacteria 4191
154 Ga0075433_10058058 3300006852 Bacteria 3383
155 Ga0075433_10122895 3300006852 Bacteria 2306
156 Ga0075433_10246185 3300006852 Bacteria 1587
157 Ga0075433_10260284 3300006852 Bacteria 1538
158 Ga0075433_10288553 3300006852 Bacteria 1453
159 Ga0075434_100005741 3300006871 Bacteria 11331
160 Ga0075434_100006636 3300006871 Bacteria 10617
161 Ga0075434_100025904 3300006871 Bacteria 5741
162 Ga0075434_100044085 3300006871 Bacteria 4425
163 Ga0075434_100051007 3300006871 Bacteria 4110
164 Ga0075434_100155378 3300006871 Bacteria 2307
165 Ga0075434_100167283 3300006871 Bacteria 2218
166 Ga0075434_100200940 3300006871 Bacteria 2013
167 Ga0075429_100000216 3300006880 Bacteria 38851
168 Ga0075429_100004810 3300006880 Bacteria 11626
169 Ga0075429_100008678 3300006880 Bacteria 8843
170 Ga0075429_100010466 3300006880 Bacteria 8025
171 Ga0075429_100018840 3300006880 Bacteria 5979
172 Ga0075429_100090772 3300006880 Bacteria 2664
173 Ga0075429_100124870 3300006880 Bacteria 2251
174 Ga0075429_100259724 3300006880 Bacteria 1520
175 Ga0068865_100441377 3300006881 Bacteria 1074
176 Ga0075436_100004858 3300006914 Bacteria 9234
177 Ga0075436_100023816 3300006914 Bacteria 4207
178 Ga0075436_100532851 3300006914 Bacteria 861
179 Ga0097620_100001779 3300006931 Bacteria 21926
180 Ga0097620_100886956 3300006931 Bacteria 977
181 Ga0075435_100009762 3300007076 Bacteria 6980
182 Ga0075435_100020095 3300007076 Bacteria 5108
183 Ga0075435_100027329 3300007076 Bacteria 4461
184 Ga0075435_100078609 3300007076 Bacteria 2705
185 Ga0075435_100106333 3300007076 Bacteria 2330
186 Ga0075435_100184581 3300007076 Bacteria 1764
187 Ga0099794_10000342 3300007265 Bacteria 15982
188 Ga0099794_10023421 3300007265 Bacteria 2824
189 Ga0099794_10057479 3300007265 Bacteria 1884
190 Ga0099794_10146506 3300007265 Bacteria 1197
191 Ga0111539_10000715 3300009094 Bacteria 43156
192 Ga0111539_10001057 3300009094 Bacteria 36241
193 Ga0111539_10215536 3300009094 Bacteria 2236
194 Ga0111539_10316364 3300009094 Bacteria 1817
195 Ga0114129_10001130 3300009147 Bacteria 35244
196 Ga0114129_10003331 3300009147 Bacteria 22579
197 Ga0114129_10006595 3300009147 Bacteria 16474
198 Ga0114129_10009961 3300009147 Bacteria 13546
199 Ga0114129_10018657 3300009147 Bacteria 9876
200 Ga0114129_10020002 3300009147 Bacteria 9528
201 Ga0114129_10032477 3300009147 Bacteria 7378
202 Ga0114129_10034554 3300009147 Bacteria 7142
203 Ga0114129_10038041 3300009147 Bacteria 6788
204 Ga0114129_10043833 3300009147 Bacteria 6295
205 Ga0114129_10070935 3300009147 Bacteria 4858
206 Ga0114129_10081643 3300009147 Bacteria 4494
207 Ga0114129_10169729 3300009147 Bacteria 2975
208 Ga0114129_10200272 3300009147 Bacteria 2705
209 Ga0114129_10229923 3300009147 Bacteria 2498
210 Ga0114129_10234244 3300009147 Unclassified 2471
211 Ga0114129_10400073 3300009147 Bacteria 1810
212 Ga0114129_10513433 3300009147 Unclassified 1563
213 Ga0105243_10028858 3300009148 Bacteria 4263
214 Ga0105243_10065319 3300009148 Bacteria 2922
215 Ga0105243_10097491 3300009148 Bacteria 2434
216 Ga0105243_10108584 3300009148 Bacteria 2316
217 Ga0105241_10000843 3300009174 Bacteria 23221
218 Ga0105241_10102106 3300009174 Bacteria 2281
219 Ga0105242_10011632 3300009176 Bacteria 6769
220 Ga0105242_10148285 3300009176 Bacteria 2043
221 Ga0105242_10493609 3300009176 Bacteria 1163
222 Ga0105248_10102370 3300009177 Bacteria 3228
223 Ga0105237_10135143 3300009545 Bacteria 2461
224 Ga0105249_10013586 3300009553 Bacteria 7194
225 Ga0105249_10511324 3300009553 Bacteria 1247
226 Ga0105246_10021720 3300011119 Bacteria 4134
227 Ga0157373_10000229 3300013100 Bacteria 45851
228 Ga0157371_10101846 3300013102 Bacteria 2037
229 Ga0157369_10024909 3300013105 Bacteria 6648
230 Ga0157372_10000144 3300013307 Bacteria 78166
231 Ga0157372_10084566 3300013307 Bacteria 3597
232 Ga0157375_10136698 3300013308 Bacteria 2575
233 Ga0163163_10041542 3300014325 Bacteria 4498
234 Ga0157380_10578948 3300014326 Bacteria 1107
235 Ga0157379_10120646 3300014968 Bacteria 2358
236 Ga0163161_10104337 3300017792 Bacteria 2113
237 Ga0206353_10559231 3300020082 Bacteria 2203
238 Ga0207653_10001997 3300025885 Bacteria 6516
239 Ga0207653_10066455 3300025885 Bacteria 1225
240 Ga0207710_10140830 3300025900 Bacteria 1164
241 Ga0207645_10000403 3300025907 Bacteria 35687
242 Ga0207643_10000315 3300025908 Bacteria 33469
243 Ga0207643_10064408 3300025908 Bacteria 2098
244 Ga0207684_10000142 3300025910 Bacteria 127367
245 Ga0207684_10000425 3300025910 Bacteria 56051
246 Ga0207684_10006981 3300025910 Bacteria 10214
247 Ga0207684_10014740 3300025910 Bacteria 6732
248 Ga0207684_10070771 3300025910 Bacteria 2964
249 Ga0207684_10440070 3300025910 Unclassified 1120
250 Ga0207684_10584727 3300025910 Bacteria 954
251 Ga0207654_10001271 3300025911 Bacteria 13437
252 Ga0207707_10000280 3300025912 Bacteria 54565
253 Ga0207695_10288549 3300025913 Bacteria 1533
254 Ga0207693_10004524 3300025915 Bacteria 11757
255 Ga0207660_10000076 3300025917 Bacteria 51418
256 Ga0207660_10011419 3300025917 Bacteria 5779
257 Ga0207662_10026799 3300025918 Bacteria 3326
258 Ga0207657_10000383 3300025919 Bacteria 46673
259 Ga0207649_10000454 3300025920 Bacteria 29523
260 Ga0207652_10003560 3300025921 Bacteria 12852
261 Ga0207646_10000645 3300025922 Bacteria 45262
262 Ga0207646_10000707 3300025922 Bacteria 43305
263 Ga0207646_10039369 3300025922 Bacteria 4255
264 Ga0207646_10075492 3300025922 Archaea 3012
265 Ga0207646_10132677 3300025922 Unclassified 2242
266 Ga0207646_10160178 3300025922 Bacteria 2031
267 Ga0207646_10301600 3300025922 Bacteria 1447
268 Ga0207681_10015798 3300025923 Bacteria 4713
269 Ga0207650_10004363 3300025925 Bacteria 9662
270 Ga0207690_10001025 3300025932 Bacteria 17884
271 Ga0207706_10025938 3300025933 Bacteria 5248
272 Ga0207706_10620079 3300025933 Bacteria 928
273 Ga0207709_10024774 3300025935 Bacteria 3430
274 Ga0207709_10034348 3300025935 Bacteria 2988
275 Ga0207709_10153408 3300025935 Bacteria 1598
276 Ga0207670_10046081 3300025936 Bacteria 2894
277 Ga0207665_10002820 3300025939 Bacteria 11651
278 Ga0207691_10042341 3300025940 Bacteria 4199
279 Ga0207689_10000127 3300025942 Bacteria 64217
280 Ga0207689_10010100 3300025942 Bacteria 8138
281 Ga0207679_10001763 3300025945 Bacteria 13478
282 Ga0207667_10002268 3300025949 Bacteria 24173
283 Ga0207712_10078349 3300025961 Bacteria 2398
284 Ga0207668_10071169 3300025972 Bacteria 2483
285 Ga0207640_10001946 3300025981 Bacteria 11119
286 Ga0207677_10386116 3300026023 Bacteria 1183
287 Ga0207639_10001450 3300026041 Bacteria 15974
288 Ga0207678_10004120 3300026067 Bacteria 13063
289 Ga0207708_10128359 3300026075 Bacteria 1980
290 Ga0207702_10001524 3300026078 Bacteria 22928
291 Ga0207641_10016696 3300026088 Bacteria 6012
292 Ga0207641_10474476 3300026088 Bacteria 1212
293 Ga0207648_10001136 3300026089 Bacteria 29916
294 Ga0207648_10070111 3300026089 Bacteria 3055
295 Ga0207674_10000720 3300026116 Bacteria 43278
296 Ga0207675_100004373 3300026118 Bacteria 13657
297 Ga0209973_1000986 3300027252 Bacteria 2349
298 Ga0209967_1003355 3300027364 Bacteria 2106
299 Ga0209981_1016745 3300027378 Bacteria 1032
300 Ga0209996_1002032 3300027395 Bacteria 2493
301 Ga0209968_1003111 3300027526 Bacteria 2488
302 Ga0209999_1000487 3300027543 Bacteria 6161
303 Ga0209983_1004973 3300027665 Bacteria 2777
304 Ga0209588_1011095 3300027671 Bacteria 2717
305 Ga0209588_1018747 3300027671 Bacteria 2155
306 Ga0209971_1000038 3300027682 Bacteria 44480
307 Ga0209966_1000239 3300027695 Bacteria 20394
308 Ga0209998_10000020 3300027717 Bacteria 77474
309 Ga0209974_10001454 3300027876 Bacteria 8587
310 Ga0207428_10000029 3300027907 Bacteria 241338
311 Ga0207428_10000631 3300027907 Bacteria 41443
312 Ga0207428_10044789 3300027907 Bacteria 3567
313 Ga0268265_10010312 3300028380 Bacteria 6309
314 Ga0268265_10016057 3300028380 Bacteria 5137
315 Ga0268265_10030142 3300028380 Bacteria 3903
316 Ga0268265_10578428 3300028380 Unclassified 1070
317 Ga0268264_10005902 3300028381 Bacteria 10364
318 Ga0268264_10647802 3300028381 Bacteria 1045
319 Ga0307408_100012239 3300031548 Bacteria 5680
320 Ga0307408_100038961 3300031548 Bacteria 3356
321 Ga0307405_10472227 3300031731 Unclassified 999
322 Ga0307410_10207330 3300031852 Bacteria 1500
323 Ga0307416_100024133 3300032002 Bacteria 4431
324 Ga0307416_100128296 3300032002 Bacteria 2277
325 Ga0307411_10263562 3300032005 Bacteria 1362
326 Ga0373950_0040403 3300034818 Bacteria 891
327 Ga0373938_0006365 3300034957 Bacteria 2038
328 Ga0373928_0064839 3300035084 Bacteria 891
329 Ga0373929_0012259 3300035085 Bacteria 1627
330 Ga0373940_0006303 3300035088 Bacteria 2625
331 Ga0373940_0011916 3300035088 Bacteria 2075
332 Ga0373949_0005907 3300035090 Bacteria 2717
333 Ga0373932_0014406 3300035112 Bacteria 1987
334 Ga0373962_0002861 3300035242 Bacteria 4133
335 Ga0373931_0067120 3300035691 Bacteria 1948
336 Ga0395899_0046197 3300037312 Bacteria 3244
337 Ga0395900_0054937 3300037418 Bacteria 4100
338 Ga0395900_0087613 3300037418 Bacteria 3200
339 Ga0395898_0010647 3300037466 Bacteria 9607
340 Ga0395905_0127716 3300037471 Bacteria 2391
341 Ga0395901_0039715 3300038443 Bacteria 4871
342 Ga0395901_0108518 3300038443 Bacteria 2914
343 Ga0439441_002479 3300042001 Bacteria 2607
344 Ga0439448_0000104 3300042005 Bacteria 15260
345 Ga0439455_0041507 3300042012 Bacteria 1179
346 Ga0439463_017683 3300042016 Bacteria 1770
347 Ga0450889_000567 3300042144 Bacteria 4120
348 Ga0439435_0045602 3300042436 Bacteria 1240
349 Ga0439459_0009988 3300042438 Bacteria 1647
350 Ga0439464_0012414 3300042439 Bacteria 2269
351 Ga0439460_0005304 3300042461 Bacteria 3159
352 Ga0439460_0011579 3300042461 Bacteria 2277
353 Ga0451577_0003386 3300042876 Bacteria 17836
354 Ga0451577_0015575 3300042876 Bacteria 7068
355 Ga0451577_0044910 3300042876 Bacteria 3954
356 Ga0451577_0131897 3300042876 Bacteria 2242
357 Ga0451577_0218703 3300042876 Bacteria 1722
358 Ga0453683_0010067 3300044673 Bacteria 6286
359 Ga0453683_0011487 3300044673 Bacteria 5834
360 Ga0453683_0015133 3300044673 Bacteria 5006
361 Ga0453683_0023061 3300044673 Bacteria 3967
362 Ga0453684_0629807 3300044712 Bacteria 1172
363 Ga0451576_0008215 3300045051 Bacteria 12282
364 Ga0451576_0024166 3300045051 Bacteria 6566
365 Ga0451576_0033418 3300045051 Bacteria 5467
366 Ga0451576_0034350 3300045051 Bacteria 5386
367 Ga0451576_0067059 3300045051 Bacteria 3735
368 Ga0451576_0082872 3300045051 Bacteria 3336
369 Ga0451576_0105446 3300045051 Bacteria 2932
370 Ga0451576_0155171 3300045051 Bacteria 2388
371 Ga0451576_0445414 3300045051 Bacteria 1359
372 Ga0451576_0789132 3300045051 Bacteria 997
373 Ga0495580_0048683 3300046472 Bacteria 2999
374 Ga0495642_0065294 3300046528 Bacteria 1515
375 Ga0495656_0006373 3300046615 Bacteria 4138
376 Ga0495636_0172931 3300047318 Bacteria 977
377 Ga0496111_0143017 3300048914 Bacteria 1773
378 Ga0496112_0110863 3300048915 Bacteria 2714
379 Ga0496113_0386010 3300048916 Bacteria 1124
380 Ga0501033_0039168 3300049570 Bacteria 3541
381 Ga0501033_0128878 3300049570 Bacteria 1834
382 Ga0501033_0203355 3300049570 Bacteria 1414
383 Ga0501033_0243152 3300049570 Bacteria 1277
384 Ga0501036_0108393 3300049572 Bacteria 2348
385 Ga0501036_0124086 3300049572 Bacteria 2181
386 Ga0501036_0165620 3300049572 Bacteria 1863
387 Ga0501036_0213075 3300049572 Bacteria 1623
388 Ga0501037_0251803 3300049573 Bacteria 1236
389 Ga0501038_0046926 3300049574 Bacteria 3744
390 Ga0501038_0084462 3300049574 Bacteria 2671
391 Ga0501038_0341857 3300049574 Bacteria 1167
392 Ga0501039_0012514 3300049575 Bacteria 6480
393 Ga0501040_0004097 3300049576 Bacteria 9477
394 Ga0501040_0047698 3300049576 Bacteria 2925
395 Ga0501040_0119395 3300049576 Bacteria 1849
396 Ga0501040_0138315 3300049576 Bacteria 1715
397 Ga0501041_0001371 3300049577 Bacteria 13454
398 Ga0501041_0014348 3300049577 Bacteria 4704
399 Ga0501041_0216539 3300049577 Bacteria 1201
400 Ga0501041_0217280 3300049577 Bacteria 1199
401 Ga0501042_0000578 3300049578 Bacteria 19366
402 Ga0501042_0092858 3300049578 Bacteria 2167
403 Ga0501042_0154330 3300049578 Bacteria 1656
404 Ga0501042_0190632 3300049578 Unclassified 1479
405 Ga0501042_0386458 3300049578 Bacteria 1014
406 Ga0501043_0202064 3300049579 Bacteria 1542
407 Ga0501046_0000300 3300049580 Bacteria 49836
408 Ga0501046_0014606 3300049580 Bacteria 6617
409 Ga0501047_0040037 3300049581 Bacteria 4532
410 Ga0501048_0009887 3300049582 Bacteria 7151
411 Ga0501048_0069274 3300049582 Bacteria 2492
412 Ga0501048_0307899 3300049582 Unclassified 1127
413 Ga0501048_0354345 3300049582 Bacteria 1047
414 Ga0501067_0036222 3300049583 Bacteria 2740
415 Ga0501068_0259652 3300049584 Unclassified 1108
416 Ga0501069_0029688 3300049585 Bacteria 3001
417 Ga0501071_0057641 3300049587 Bacteria 2808
418 Ga0501071_0091570 3300049587 Bacteria 2234
419 Ga0501071_0198392 3300049587 Bacteria 1507
420 Ga0501072_0002045 3300049588 Bacteria 15003
421 Ga0501072_0012209 3300049588 Bacteria 6565
422 Ga0501072_0013340 3300049588 Bacteria 6291
423 Ga0501072_0038119 3300049588 Bacteria 3772
424 Ga0501072_0049891 3300049588 Bacteria 3295
425 Ga0501072_0054332 3300049588 Bacteria 3155
426 Ga0501072_0064063 3300049588 Bacteria 2899
427 Ga0501072_0123708 3300049588 Bacteria 2061
428 Ga0501072_0163882 3300049588 Unclassified 1773
429 Ga0501072_0182269 3300049588 Bacteria 1675
430 Ga0501073_0342719 3300049589 Bacteria 1032
431 Ga0501074_0118975 3300049590 Bacteria 1889
432 Ga0501075_0014262 3300049591 Bacteria 5694
433 Ga0501075_0044653 3300049591 Bacteria 3325
434 Ga0501075_0047531 3300049591 Bacteria 3224
435 Ga0501075_0069752 3300049591 Bacteria 2656
436 Ga0501075_0142679 3300049591 Bacteria 1825
437 Ga0501075_0166222 3300049591 Unclassified 1683
438 Ga0501076_0000565 3300049592 Bacteria 23619
439 Ga0501076_0010185 3300049592 Bacteria 6967
440 Ga0501076_0027954 3300049592 Bacteria 4376
441 Ga0501076_0038611 3300049592 Bacteria 3749
442 Ga0501076_0087822 3300049592 Bacteria 2499
443 Ga0501076_0248584 3300049592 Bacteria 1455
444 Ga0501077_0008992 3300049593 Bacteria 6200
445 Ga0501077_0009802 3300049593 Bacteria 5959
446 Ga0501077_0009843 3300049593 Bacteria 5947
447 Ga0501077_0018668 3300049593 Bacteria 4386
448 Ga0501077_0048625 3300049593 Bacteria 2695
449 Ga0501077_0099774 3300049593 Bacteria 1840
450 Ga0501079_0004471 3300049741 Bacteria 10372
451 Ga0501079_0010326 3300049741 Bacteria 7094
452 Ga0501079_0031605 3300049741 Bacteria 4069
453 Ga0501079_0038382 3300049741 Bacteria 3693
454 Ga0501079_0049213 3300049741 Bacteria 3253
455 Ga0501079_0052676 3300049741 Bacteria 3140
456 Ga0501079_0090475 3300049741 Bacteria 2371
457 Ga0501079_0131404 3300049741 Bacteria 1948
458 Ga0501079_0425444 3300049741 Bacteria 1042
459 Ga0501080_0026911 3300049742 Bacteria 5348
460 Ga0501080_0298224 3300049742 Bacteria 1462
461 Ga0501081_0001802 3300049743 Bacteria 13281
462 Ga0501081_0011915 3300049743 Bacteria 5697
463 Ga0501081_0029077 3300049743 Bacteria 3732
464 Ga0501081_0040561 3300049743 Bacteria 3187
465 Ga0501081_0249758 3300049743 Unclassified 1295
466 Ga0501083_0382015 3300049744 Bacteria 916
467 Ga0501035_0317028 3300049822 Bacteria 1311
468 Ga0501045_0001644 3300049824 Bacteria 15009
469 Ga0501045_0055109 3300049824 Bacteria 2908
470 Ga0501045_0056127 3300049824 Bacteria 2880
471 Ga0501045_0061994 3300049824 Bacteria 2744
472 nmdc:mga05p37_1316_c1 3300050507 Bacteria 28895
473 nmdc:mga05p37_1819_c1 3300050507 Bacteria 24861
474 nmdc:mga05p37_232821_c1 3300050507 Bacteria 2218
475 nmdc:mga05p37_244914_c1 3300050507 Bacteria 1249
476 nmdc:mga05p37_25503_c1 3300050507 Bacteria 7190
477 nmdc:mga05p37_28140_c1 3300050507 Bacteria 6850
478 nmdc:mga05p37_30162_c1 3300050507 Bacteria 6616
479 nmdc:mga05p37_331016_c1 3300050507 Bacteria 1799
480 nmdc:mga05p37_346014_c1 3300050507 Bacteria 1752
481 nmdc:mga05p37_443_c1 3300050507 Bacteria 45028
482 nmdc:mga05p37_63473_c1 3300050507 Bacteria 4546
483 nmdc:mga05p37_6867_c1 3300050507 Bacteria 13417
484 nmdc:mga05p37_73670_c1 3300050507 Bacteria 4203
485 nmdc:mga05p37_99063_c1 3300050507 Bacteria 3591
486 nmdc:mga09592_16779_c1 3300050508 Bacteria 5994
487 nmdc:mga09592_29705_c1 3300050508 Bacteria 4545
488 nmdc:mga09592_5185_c1 3300050508 Bacteria 10591
489 nmdc:mga09592_6658_c1 3300050508 Bacteria 9410
490 nmdc:mga09592_8330_c1 3300050508 Bacteria 6162
491 nmdc:mga0qj67_17547_c1 3300050509 Bacteria 5444
492 nmdc:mga0qj67_387_c1 3300050509 Bacteria 30412
493 nmdc:mga0qj67_4529_c1 3300050509 Bacteria 10069
494 nmdc:mga0qj67_55314_c1 3300050509 Bacteria 3144
495 nmdc:mga06r32_1062_c1 3300050510 Bacteria 24771
496 nmdc:mga06r32_114124_c1 3300050510 Bacteria 2659
497 nmdc:mga06r32_2262_c1 3300050510 Bacteria 17215
498 nmdc:mga06r32_24736_c1 3300050510 Bacteria 5579
499 nmdc:mga06r32_2660_c1 3300050510 Bacteria 15972
500 nmdc:mga06r32_29520_c1 3300050510 Bacteria 5141
501 nmdc:mga06r32_319_c1 3300050510 Bacteria 40297
502 nmdc:mga06r32_350529_c1 3300050510 Bacteria 1461
503 nmdc:mga08y16_108688_c1 3300050511 Bacteria 2888
504 nmdc:mga08y16_12261_c1 3300050511 Bacteria 9008
505 nmdc:mga08y16_238966_c1 3300050511 Bacteria 1878
506 nmdc:mga08y16_66439_c1 3300050511 Bacteria 3764
507 nmdc:mga0n895_1185_c1 3300050512 Bacteria 19167
508 nmdc:mga0n895_127386_c1 3300050512 Bacteria 2570
509 nmdc:mga0n895_309647_c1 3300050512 Bacteria 1601
510 nmdc:mga0n895_397939_c1 3300050512 Unclassified 1393
511 nmdc:mga0n895_459807_c1 3300050512 Bacteria 1285
512 nmdc:mga0n895_56018_c1 3300050512 Bacteria 3882
513 nmdc:mga0n895_61708_c1 3300050512 Bacteria 3702
514 nmdc:mga0n895_991_c1 3300050512 Bacteria 20583
515 nmdc:mga0rr50_109695_c1 3300050513 Bacteria 2182
516 nmdc:mga0rr50_14642_c1 3300050513 Bacteria 5151
517 nmdc:mga0rr50_210747_c1 3300050513 Bacteria 1601
518 nmdc:mga0rr50_477972_c1 3300050513 Bacteria 1058
519 nmdc:mga0rr50_48575_c1 3300050513 Bacteria 3138
520 nmdc:mga0rr50_7254_c1 3300050513 Bacteria 6819
521 nmdc:mga08x19_226668_c1 3300050514 Bacteria 1285
522 nmdc:mga08x19_31729_c1 3300050514 Bacteria 3326
523 nmdc:mga08x19_3445_c1 3300050514 Bacteria 9433
524 nmdc:mga08x19_387122_c1 3300050514 Bacteria 980
525 nmdc:mga0a205_1017_c1 3300050515 Bacteria 23316
526 nmdc:mga0a205_162790_c1 3300050515 Bacteria 2127
527 nmdc:mga0a205_17213_c1 3300050515 Bacteria 6771
528 nmdc:mga0a205_200836_c1 3300050515 Bacteria 1884
529 nmdc:mga0a205_2405_c1 3300050515 Bacteria 16511
530 nmdc:mga0a205_329373_c1 3300050515 Bacteria 1397
531 nmdc:mga0a205_3331_c2 3300050515 Bacteria 10909
532 nmdc:mga0a205_411_c1 3300050515 Bacteria 32848
533 nmdc:mga0a205_7194_c2 3300050515 Bacteria 6939
534 nmdc:mga0a205_83311_c1 3300050515 Bacteria 3088
535 nmdc:mga0a205_88438_c1 3300050515 Bacteria 2994
536 Ga0501084_0011347 3300054114 Bacteria 7378
537 Ga0501084_0016207 3300054114 Bacteria 6188
538 Ga0501084_0016753 3300054114 Bacteria 6088
539 Ga0501084_0081890 3300054114 Bacteria 2708
540 Ga0501084_0094428 3300054114 Bacteria 2511
541 Ga0501084_0104128 3300054114 Bacteria 2383
542 Ga0501084_0145307 3300054114 Bacteria 1997
543 Ga0501084_0201336 3300054114 Bacteria 1680
544 Ga0501084_0358575 3300054114 Bacteria 1232
545 Ga0501084_0546127 3300054114 Bacteria 979
546 Ga0501082_0000498 3300060353 Bacteria 34785
547 Ga0501082_0022974 3300060353 Bacteria 5376
548 Ga0501082_0028089 3300060353 Bacteria 4847
549 Ga0501082_0056539 3300060353 Bacteria 3380
550 Ga0501082_0107114 3300060353 Bacteria 2418
551 Ga0530510_0003792 3300061734 Bacteria 10410
552 Ga0530510_0026390 3300061734 Bacteria 4157
553 Ga0530510_0057343 3300061734 Bacteria 2814
554 Ga0207706_10132619
555 JGI25406J46586_10020311
556 JGI26141J51220_1001257
557 Ga0065715_10164788
558 Ga0065707_10195119
559 Ga0065707_10199066
560 Ga0070676_10001243
561 Ga0070690_100081694
562 Ga0070670_100001622
563 Ga0068869_100000916
564 Ga0068869_100014104
565 Ga0070680_100000611
566 Ga0070680_100010509
567 Ga0070680_100147324
568 Ga0070682_100000395
569 Ga0068868_100367599
570 Ga0070660_100000167
571 Ga0070689_100010360
572 Ga0070691_10014461
573 Ga0070687_100027924
574 Ga0070661_100000190
575 Ga0070692_10000116
576 Ga0070692_10059250
577 Ga0070668_100095203
578 Ga0070675_100127583
579 Ga0070673_100107323
580 Ga0070659_100001211
581 Ga0070703_10001794
582 Ga0070703_10003276
583 Ga0070701_10112090
584 Ga0070705_100000345
585 Ga0070705_100024014
586 Ga0070705_100044456
587 Ga0070705_100435415
588 Ga0070700_100068273
589 Ga0070694_100001040
590 Ga0070694_100001543
591 Ga0070694_100019363
592 Ga0070694_100141800
593 Ga0070708_100002007
594 Ga0070708_100005807
595 Ga0070708_100044105
596 Ga0070708_100118840
597 Ga0070708_100161377
598 Ga0070708_100506715
599 Ga0070663_100001109
600 Ga0070662_100007298
601 Ga0070681_10002225
602 Ga0070681_10496823
603 Ga0068867_100000544
604 Ga0068867_100130588
605 Ga0070706_100021859
606 Ga0070706_100022083
607 Ga0070706_100059867
608 Ga0070706_100066375
609 Ga0070706_100142694
610 Ga0070707_100004378
611 Ga0070707_100010067
612 Ga0070707_100058475
613 Ga0070707_100079307
614 Ga0070707_100162866
615 Ga0070698_100004603
616 Ga0070698_100010736
617 Ga0070698_100011570
618 Ga0070698_100712629
619 Ga0070699_100000858
620 Ga0070699_100003717
621 Ga0070699_100004306
622 Ga0070699_100040243
623 Ga0070699_100095450
624 Ga0070699_100132152
625 Ga0070699_100235342
626 Ga0070699_100674762
627 Ga0070679_100003345
628 Ga0070684_100011210
629 Ga0070697_100000775
630 Ga0070697_100001063
631 Ga0070697_100049209
632 Ga0070697_100065961
633 Ga0070697_100082294
634 Ga0070697_100153332
635 Ga0070697_100236735
636 Ga0070697_100282469
637 Ga0068853_100000310
638 Ga0070695_100220386
639 Ga0070696_100001082
640 Ga0070696_100023946
641 Ga0070696_100051488
642 Ga0070696_100147101
643 Ga0070693_100000058
644 Ga0070693_100082261
645 Ga0070704_100000355
646 Ga0070704_100109646
647 Ga0070704_100112872
648 Ga0070704_100150593
649 Ga0070704_100373321
650 Ga0068855_100002540
651 Ga0070664_100009881
652 Ga0068857_100004036
653 Ga0068854_100005049
654 Ga0068856_100001786
655 Ga0070702_100279368
656 Ga0068859_100001779
657 Ga0068859_100886943
658 Ga0068864_100001002
659 Ga0068861_100231924
660 Ga0068870_10000538
661 Ga0068863_100003230
662 Ga0068863_100016562
663 Ga0068858_100060854
664 Ga0068860_100009490
665 Ga0068860_100037632
666 Ga0068860_100274183
667 Ga0068860_100449021
668 Ga0068862_100010374
669 Ga0068862_100017270
670 Ga0081539_10000009
671 Ga0075432_10041434
672 Ga0070716_100032192
673 Ga0070716_100110163
674 Ga0070712_100002626
675 Ga0070712_100085184
676 Ga0075428_100000136
677 Ga0075428_100011921
678 Ga0075428_100031238
679 Ga0075428_100033421
680 Ga0075428_100041445
681 Ga0075428_100057815
682 Ga0075428_100188403
683 Ga0075428_100490205
684 Ga0075428_100617978
685 Ga0075428_100724917
686 Ga0075428_100744272
687 Ga0075430_100002583
688 Ga0075430_100004972
689 Ga0075430_100005542
690 Ga0075430_100027009
691 Ga0075430_100050509
692 Ga0075431_100000061
693 Ga0075431_100000122
694 Ga0075431_100001427
695 Ga0075431_100002112
696 Ga0075431_100008963
697 Ga0075431_100017393
698 Ga0075431_100147926
699 Ga0075431_100169475
700 Ga0075431_100272740
701 Ga0075431_100473642
702 Ga0075431_100489247
703 Ga0075433_10008471
704 Ga0075433_10022826
705 Ga0075433_10027440
706 Ga0075433_10037338
707 Ga0075433_10058058
708 Ga0075433_10122895
709 Ga0075433_10246185
710 Ga0075433_10260284
711 Ga0075433_10288553
712 Ga0075434_100005741
713 Ga0075434_100006636
714 Ga0075434_100025904
715 Ga0075434_100044085
716 Ga0075434_100051007
717 Ga0075434_100155378
718 Ga0075434_100167283
719 Ga0075434_100200940
720 Ga0075429_100000216
721 Ga0075429_100004810
722 Ga0075429_100008678
723 Ga0075429_100010466
724 Ga0075429_100018840
725 Ga0075429_100090772
726 Ga0075429_100124870
727 Ga0075429_100259724
728 Ga0068865_100441377
729 Ga0075436_100004858
730 Ga0075436_100023816
731 Ga0075436_100532851
732 Ga0097620_100001779
733 Ga0097620_100886956
734 Ga0075435_100009762
735 Ga0075435_100020095
736 Ga0075435_100027329
737 Ga0075435_100078609
738 Ga0075435_100106333
739 Ga0075435_100184581
740 Ga0099794_10000342
741 Ga0099794_10023421
742 Ga0099794_10057479
743 Ga0099794_10146506
744 Ga0111539_10000715
745 Ga0111539_10001057
746 Ga0111539_10215536
747 Ga0111539_10316364
748 Ga0114129_10001130
749 Ga0114129_10003331
750 Ga0114129_10006595
751 Ga0114129_10009961
752 Ga0114129_10018657
753 Ga0114129_10020002
754 Ga0114129_10032477
755 Ga0114129_10034554
756 Ga0114129_10038041
757 Ga0114129_10043833
758 Ga0114129_10070935
759 Ga0114129_10081643
760 Ga0114129_10169729
761 Ga0114129_10200272
762 Ga0114129_10229923
763 Ga0114129_10234244
764 Ga0114129_10400073
765 Ga0114129_10513433
766 Ga0105243_10028858
767 Ga0105243_10065319
768 Ga0105243_10097491
769 Ga0105243_10108584
770 Ga0105241_10000843
771 Ga0105241_10102106
772 Ga0105242_10011632
773 Ga0105242_10148285
774 Ga0105242_10493609
775 Ga0105248_10102370
776 Ga0105237_10135143
777 Ga0105249_10013586
778 Ga0105249_10511324
779 Ga0105246_10021720
780 Ga0157373_10000229
781 Ga0157371_10101846
782 Ga0157369_10024909
783 Ga0157372_10000144
784 Ga0157372_10084566
785 Ga0157375_10136698
786 Ga0163163_10041542
787 Ga0157380_10578948
788 Ga0157379_10120646
789 Ga0163161_10104337
790 Ga0206353_10559231
791 Ga0207653_10001997
792 Ga0207653_10066455
793 Ga0207710_10140830
794 Ga0207645_10000403
795 Ga0207643_10000315
796 Ga0207643_10064408
797 Ga0207684_10000142
798 Ga0207684_10000425
799 Ga0207684_10006981
800 Ga0207684_10014740
801 Ga0207684_10070771
802 Ga0207684_10440070
803 Ga0207684_10584727
804 Ga0207654_10001271
805 Ga0207707_10000280
806 Ga0207695_10288549
807 Ga0207693_10004524
808 Ga0207660_10000076
809 Ga0207660_10011419
810 Ga0207662_10026799
811 Ga0207657_10000383
812 Ga0207649_10000454
813 Ga0207652_10003560
814 Ga0207646_10000645
815 Ga0207646_10000707
816 Ga0207646_10039369
817 Ga0207646_10075492
818 Ga0207646_10132677
819 Ga0207646_10160178
820 Ga0207646_10301600
821 Ga0207681_10015798
822 Ga0207650_10004363
823 Ga0207690_10001025
824 Ga0207706_10025938
825 Ga0207706_10620079
826 Ga0207709_10024774
827 Ga0207709_10034348
828 Ga0207709_10153408
829 Ga0207670_10046081
830 Ga0207665_10002820
831 Ga0207691_10042341
832 Ga0207689_10000127
833 Ga0207689_10010100
834 Ga0207679_10001763
835 Ga0207667_10002268
836 Ga0207712_10078349
837 Ga0207668_10071169
838 Ga0207640_10001946
839 Ga0207677_10386116
840 Ga0207639_10001450
841 Ga0207678_10004120
842 Ga0207708_10128359
843 Ga0207702_10001524
844 Ga0207641_10016696
845 Ga0207641_10474476
846 Ga0207648_10001136
847 Ga0207648_10070111
848 Ga0207674_10000720
849 Ga0207675_100004373
850 Ga0209973_1000986
851 Ga0209967_1003355
852 Ga0209981_1016745
853 Ga0209996_1002032
854 Ga0209968_1003111
855 Ga0209999_1000487
856 Ga0209983_1004973
857 Ga0209588_1011095
858 Ga0209588_1018747
859 Ga0209971_1000038
860 Ga0209966_1000239
861 Ga0209998_10000020
862 Ga0209974_10001454
863 Ga0207428_10000029
864 Ga0207428_10000631
865 Ga0207428_10044789
866 Ga0268265_10010312
867 Ga0268265_10016057
868 Ga0268265_10030142
869 Ga0268265_10578428
870 Ga0268264_10005902
871 Ga0268264_10647802
872 Ga0307408_100012239
873 Ga0307408_100038961
874 Ga0307405_10472227
875 Ga0307410_10207330
876 Ga0307416_100024133
877 Ga0307416_100128296
878 Ga0307411_10263562
879 Ga0373950_0040403
880 Ga0373938_0006365
881 Ga0373928_0064839
882 Ga0373929_0012259
883 Ga0373940_0006303
884 Ga0373940_0011916
885 Ga0373949_0005907
886 Ga0373932_0014406
887 Ga0373962_0002861
888 Ga0373931_0067120
889 Ga0395899_0046197
890 Ga0395900_0054937
891 Ga0395900_0087613
892 Ga0395898_0010647
893 Ga0395905_0127716
894 Ga0395901_0039715
895 Ga0395901_0108518
896 Ga0439441_002479
897 Ga0439448_0000104
898 Ga0439455_0041507
899 Ga0439463_017683
900 Ga0450889_000567
901 Ga0439435_0045602
902 Ga0439459_0009988
903 Ga0439464_0012414
904 Ga0439460_0005304
905 Ga0439460_0011579
906 Ga0451577_0003386
907 Ga0451577_0015575
908 Ga0451577_0044910
909 Ga0451577_0131897
910 Ga0451577_0218703
911 Ga0453683_0010067
912 Ga0453683_0011487
913 Ga0453683_0015133
914 Ga0453683_0023061
915 Ga0453684_0629807
916 Ga0451576_0008215
917 Ga0451576_0024166
918 Ga0451576_0033418
919 Ga0451576_0034350
920 Ga0451576_0067059
921 Ga0451576_0082872
922 Ga0451576_0105446
923 Ga0451576_0155171
924 Ga0451576_0445414
925 Ga0451576_0789132
926 Ga0495580_0048683
927 Ga0495642_0065294
928 Ga0495656_0006373
929 Ga0495636_0172931
930 Ga0496111_0143017
931 Ga0496112_0110863
932 Ga0496113_0386010
933 Ga0501033_0039168
934 Ga0501033_0128878
935 Ga0501033_0203355
936 Ga0501033_0243152
937 Ga0501036_0108393
938 Ga0501036_0124086
939 Ga0501036_0165620
940 Ga0501036_0213075
941 Ga0501037_0251803
942 Ga0501038_0046926
943 Ga0501038_0084462
944 Ga0501038_0341857
945 Ga0501039_0012514
946 Ga0501040_0004097
947 Ga0501040_0047698
948 Ga0501040_0119395
949 Ga0501040_0138315
950 Ga0501041_0001371
951 Ga0501041_0014348
952 Ga0501041_0216539
953 Ga0501041_0217280
954 Ga0501042_0000578
955 Ga0501042_0092858
956 Ga0501042_0154330
957 Ga0501042_0190632
958 Ga0501042_0386458
959 Ga0501043_0202064
960 Ga0501046_0000300
961 Ga0501046_0014606
962 Ga0501047_0040037
963 Ga0501048_0009887
964 Ga0501048_0069274
965 Ga0501048_0307899
966 Ga0501048_0354345
967 Ga0501067_0036222
968 Ga0501068_0259652
969 Ga0501069_0029688
970 Ga0501071_0057641
971 Ga0501071_0091570
972 Ga0501071_0198392
973 Ga0501072_0002045
974 Ga0501072_0012209
975 Ga0501072_0013340
976 Ga0501072_0038119
977 Ga0501072_0049891
978 Ga0501072_0054332
979 Ga0501072_0064063
980 Ga0501072_0123708
981 Ga0501072_0163882
982 Ga0501072_0182269
983 Ga0501073_0342719
984 Ga0501074_0118975
985 Ga0501075_0014262
986 Ga0501075_0044653
987 Ga0501075_0047531
988 Ga0501075_0069752
989 Ga0501075_0142679
990 Ga0501075_0166222
991 Ga0501076_0000565
992 Ga0501076_0010185
993 Ga0501076_0027954
994 Ga0501076_0038611
995 Ga0501076_0087822
996 Ga0501076_0248584
997 Ga0501077_0008992
998 Ga0501077_0009802
999 Ga0501077_0009843
1000 Ga0501077_0018668
1001 Ga0501077_0048625
1002 Ga0501077_0099774
1003 Ga0501079_0004471
1004 Ga0501079_0010326
1005 Ga0501079_0031605
1006 Ga0501079_0038382
1007 Ga0501079_0049213
1008 Ga0501079_0052676
1009 Ga0501079_0090475
1010 Ga0501079_0131404
1011 Ga0501079_0425444
1012 Ga0501080_0026911
1013 Ga0501080_0298224
1014 Ga0501081_0001802
1015 Ga0501081_0011915
1016 Ga0501081_0029077
1017 Ga0501081_0040561
1018 Ga0501081_0249758
1019 Ga0501083_0382015
1020 Ga0501035_0317028
1021 Ga0501045_0001644
1022 Ga0501045_0055109
1023 Ga0501045_0056127
1024 Ga0501045_0061994
1025 nmdc:mga05p37_1316_c1
1026 nmdc:mga05p37_1819_c1
1027 nmdc:mga05p37_232821_c1
1028 nmdc:mga05p37_244914_c1
1029 nmdc:mga05p37_25503_c1
1030 nmdc:mga05p37_28140_c1
1031 nmdc:mga05p37_30162_c1
1032 nmdc:mga05p37_331016_c1
1033 nmdc:mga05p37_346014_c1
1034 nmdc:mga05p37_443_c1
1035 nmdc:mga05p37_63473_c1
1036 nmdc:mga05p37_6867_c1
1037 nmdc:mga05p37_73670_c1
1038 nmdc:mga05p37_99063_c1
1039 nmdc:mga09592_16779_c1
1040 nmdc:mga09592_29705_c1
1041 nmdc:mga09592_5185_c1
1042 nmdc:mga09592_6658_c1
1043 nmdc:mga09592_8330_c1
1044 nmdc:mga0qj67_17547_c1
1045 nmdc:mga0qj67_387_c1
1046 nmdc:mga0qj67_4529_c1
1047 nmdc:mga0qj67_55314_c1
1048 nmdc:mga06r32_1062_c1
1049 nmdc:mga06r32_114124_c1
1050 nmdc:mga06r32_2262_c1
1051 nmdc:mga06r32_24736_c1
1052 nmdc:mga06r32_2660_c1
1053 nmdc:mga06r32_29520_c1
1054 nmdc:mga06r32_319_c1
1055 nmdc:mga06r32_350529_c1
1056 nmdc:mga08y16_108688_c1
1057 nmdc:mga08y16_12261_c1
1058 nmdc:mga08y16_238966_c1
1059 nmdc:mga08y16_66439_c1
1060 nmdc:mga0n895_1185_c1
1061 nmdc:mga0n895_127386_c1
1062 nmdc:mga0n895_309647_c1
1063 nmdc:mga0n895_397939_c1
1064 nmdc:mga0n895_459807_c1
1065 nmdc:mga0n895_56018_c1
1066 nmdc:mga0n895_61708_c1
1067 nmdc:mga0n895_991_c1
1068 nmdc:mga0rr50_109695_c1
1069 nmdc:mga0rr50_14642_c1
1070 nmdc:mga0rr50_210747_c1
1071 nmdc:mga0rr50_477972_c1
1072 nmdc:mga0rr50_48575_c1
1073 nmdc:mga0rr50_7254_c1
1074 nmdc:mga08x19_226668_c1
1075 nmdc:mga08x19_31729_c1
1076 nmdc:mga08x19_3445_c1
1077 nmdc:mga08x19_387122_c1
1078 nmdc:mga0a205_1017_c1
1079 nmdc:mga0a205_162790_c1
1080 nmdc:mga0a205_17213_c1
1081 nmdc:mga0a205_200836_c1
1082 nmdc:mga0a205_2405_c1
1083 nmdc:mga0a205_329373_c1
1084 nmdc:mga0a205_3331_c2
1085 nmdc:mga0a205_411_c1
1086 nmdc:mga0a205_7194_c2
1087 nmdc:mga0a205_83311_c1
1088 nmdc:mga0a205_88438_c1
1089 Ga0501084_0011347
1090 Ga0501084_0016207
1091 Ga0501084_0016753
1092 Ga0501084_0081890
1093 Ga0501084_0094428
1094 Ga0501084_0104128
1095 Ga0501084_0145307
1096 Ga0501084_0201336
1097 Ga0501084_0358575
1098 Ga0501084_0546127
1099 Ga0501082_0000498
1100 Ga0501082_0022974
1101 Ga0501082_0028089
1102 Ga0501082_0056539
1103 Ga0501082_0107114
1104 Ga0530510_0003792
1105 Ga0530510_0026390
1106 Ga0530510_0057343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

28

248

0.79

PF12146

Hydrolase_4

Serine aminopeptidase, S33

29

248

0.7

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

30

250

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.9257 7 123
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9252 7 123
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9238 6 123
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.9234 6 123
6u2m-assembly2.cif.gz_C crystal structure of a halotag-based calcium indicator, halocamp v2, bound to jf635 0.923 6 123
ID Description Score Start End Superfamily
af_Q8IL54_9_192_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8692 6 123 3.40.50.1820
af_Q54CU1_1_267_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8629 18 118 3.40.50.1820
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8593 29 124 3.40.50.1820
af_A0A1D6M0A7_18_159_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8572 6 111 3.40.50.1820
3kxpG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.853 6 271 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W1LDM9-F1-model_v4 Alpha/beta fold hydrolase 0.9635 6 119 GO:0016787
AF-A0A2V7DFB5-F1-model_v4 Alpha/beta hydrolase 0.9586 6 91 GO:0016020
GO:0046464
GO:0047372
AF-A0A822HXX4-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9477 2 121
AF-A0A2E3DU38-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9408 1 123 GO:0016020
AF-B3S481-F1-model_v4 AB hydrolase-1 domain-containing protein 0.93 7 123 GO:0004301
GO:0016787

Map