F462838
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 268 | 553 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100255921|Ga0068856_1002559211 |
| Length | 140 |
| Sequence | MMAIRRNQRIGLSFPDCYWYICVSHIWRPNLSNAEFKKGSAEMLVLSVLEARDRHGYDICKRIEQLSGGELVFNVATFYPLLYKLEERGLIQGRWLEKAGERRRRFYKITAQGRKALLQHRLAFDKFVAAVAQVLGGENA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 187 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 188 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 189 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 190 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 191 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 192 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 193 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 222 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 224 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 225 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 226 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 232 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 233 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 236 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 237 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 242 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 244 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 245 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 246 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 247 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 250 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 252 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 253 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.59 |
| Nodule | 0 |
| Rhizoplane | 1.27 |
| Rhizosphere | 89.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10151282 | 3300005293 | Bacteria | 1726 |
| 2 | Ga0065715_10232421 | 3300005293 | Bacteria | 1206 |
| 3 | Ga0065715_10630225 | 3300005293 | Unclassified | 690 |
| 4 | Ga0065707_10165770 | 3300005295 | Bacteria | 1524 |
| 5 | Ga0065707_10705893 | 3300005295 | Unclassified | 637 |
| 6 | Ga0070658_10020369 | 3300005327 | Bacteria | 5315 |
| 7 | Ga0070676_10010438 | 3300005328 | Bacteria | 5039 |
| 8 | Ga0070676_10796337 | 3300005328 | Bacteria | 697 |
| 9 | Ga0070676_11359398 | 3300005328 | Unclassified | 544 |
| 10 | Ga0070683_100073495 | 3300005329 | Bacteria | 3192 |
| 11 | Ga0070690_100499047 | 3300005330 | Bacteria | 910 |
| 12 | Ga0070677_10254781 | 3300005333 | Bacteria | 873 |
| 13 | Ga0068869_100048654 | 3300005334 | Bacteria | 3067 |
| 14 | Ga0070666_10038610 | 3300005335 | Unclassified | 3178 |
| 15 | Ga0070680_100249954 | 3300005336 | Bacteria | 1499 |
| 16 | Ga0068868_100167660 | 3300005338 | Unclassified | 1817 |
| 17 | Ga0068868_100372524 | 3300005338 | Bacteria | 1227 |
| 18 | Ga0070689_101043340 | 3300005340 | Bacteria | 729 |
| 19 | Ga0070661_100051858 | 3300005344 | Bacteria | 3003 |
| 20 | Ga0070692_10261133 | 3300005345 | Unclassified | 1041 |
| 21 | Ga0070668_100467430 | 3300005347 | Bacteria | 1087 |
| 22 | Ga0070669_100590529 | 3300005353 | Bacteria | 929 |
| 23 | Ga0070669_101545734 | 3300005353 | Unclassified | 577 |
| 24 | Ga0070675_100736020 | 3300005354 | Bacteria | 899 |
| 25 | Ga0070675_101607068 | 3300005354 | Bacteria | 600 |
| 26 | Ga0070673_100006695 | 3300005364 | Bacteria | 7512 |
| 27 | Ga0070673_101395383 | 3300005364 | Unclassified | 659 |
| 28 | Ga0070659_100856854 | 3300005366 | Unclassified | 792 |
| 29 | Ga0070659_101963839 | 3300005366 | Unclassified | 525 |
| 30 | Ga0070667_100469446 | 3300005367 | Unclassified | 1151 |
| 31 | Ga0070703_10410395 | 3300005406 | Bacteria | 592 |
| 32 | Ga0070713_100757986 | 3300005436 | Bacteria | 929 |
| 33 | Ga0070701_10820936 | 3300005438 | Bacteria | 636 |
| 34 | Ga0070701_10970857 | 3300005438 | Viruses | 591 |
| 35 | Ga0070705_100637545 | 3300005440 | Bacteria | 829 |
| 36 | Ga0070700_100020782 | 3300005441 | Bacteria | 3810 |
| 37 | Ga0070700_100074985 | 3300005441 | Bacteria | 2169 |
| 38 | Ga0070694_100331651 | 3300005444 | Bacteria | 1174 |
| 39 | Ga0070694_100522607 | 3300005444 | Bacteria | 947 |
| 40 | Ga0070694_100942818 | 3300005444 | Bacteria | 714 |
| 41 | Ga0070694_101214466 | 3300005444 | Unclassified | 632 |
| 42 | Ga0070708_100362632 | 3300005445 | Bacteria | 1366 |
| 43 | Ga0070663_101962102 | 3300005455 | Unclassified | 526 |
| 44 | Ga0070678_100088911 | 3300005456 | Bacteria | 2363 |
| 45 | Ga0070678_101826811 | 3300005456 | Unclassified | 573 |
| 46 | Ga0070662_100487610 | 3300005457 | Bacteria | 1027 |
| 47 | Ga0068867_100772678 | 3300005459 | Bacteria | 854 |
| 48 | Ga0068867_101610825 | 3300005459 | Bacteria | 607 |
| 49 | Ga0070707_100209053 | 3300005468 | Unclassified | 1902 |
| 50 | Ga0070707_100460933 | 3300005468 | Unclassified | 1232 |
| 51 | Ga0070707_101487047 | 3300005468 | Unclassified | 644 |
| 52 | Ga0070698_100608922 | 3300005471 | Bacteria | 1033 |
| 53 | Ga0070698_100959436 | 3300005471 | Bacteria | 802 |
| 54 | Ga0070698_101131489 | 3300005471 | Unclassified | 732 |
| 55 | Ga0070698_101794582 | 3300005471 | Bacteria | 566 |
| 56 | Ga0070699_100097650 | 3300005518 | Bacteria | 2573 |
| 57 | Ga0070699_101940781 | 3300005518 | Bacteria | 538 |
| 58 | Ga0070684_100096776 | 3300005535 | Bacteria | 2632 |
| 59 | Ga0070684_100436752 | 3300005535 | Unclassified | 1209 |
| 60 | Ga0068853_101717479 | 3300005539 | Unclassified | 608 |
| 61 | Ga0070696_100262728 | 3300005546 | Bacteria | 1309 |
| 62 | Ga0070696_100712813 | 3300005546 | Bacteria | 819 |
| 63 | Ga0070696_100826919 | 3300005546 | Unclassified | 764 |
| 64 | Ga0070665_100008991 | 3300005548 | Bacteria | 10116 |
| 65 | Ga0070704_100073781 | 3300005549 | Bacteria | 2487 |
| 66 | Ga0070704_100475495 | 3300005549 | Unclassified | 1080 |
| 67 | Ga0070704_100534186 | 3300005549 | Bacteria | 1023 |
| 68 | Ga0068855_100671224 | 3300005563 | Bacteria | 1111 |
| 69 | Ga0070664_100163808 | 3300005564 | Bacteria | 1969 |
| 70 | Ga0070664_100769870 | 3300005564 | Bacteria | 899 |
| 71 | Ga0068857_100038806 | 3300005577 | Bacteria | 4216 |
| 72 | Ga0068854_100061421 | 3300005578 | Bacteria | 2722 |
| 73 | Ga0068854_100065880 | 3300005578 | Bacteria | 2634 |
| 74 | Ga0068856_100020395 | 3300005614 | Bacteria | 6437 |
| 75 | Ga0068856_100255921 | 3300005614 | Unclassified | 1766 |
| 76 | Ga0070702_101345737 | 3300005615 | Bacteria | 582 |
| 77 | Ga0068859_100011477 | 3300005617 | Bacteria | 8908 |
| 78 | Ga0068864_101277140 | 3300005618 | Bacteria | 734 |
| 79 | Ga0068866_10198013 | 3300005718 | Bacteria | 1198 |
| 80 | Ga0068866_10393216 | 3300005718 | Unclassified | 892 |
| 81 | Ga0068861_101209967 | 3300005719 | Bacteria | 731 |
| 82 | Ga0068861_102334252 | 3300005719 | Unclassified | 537 |
| 83 | Ga0068861_102505919 | 3300005719 | Bacteria | 519 |
| 84 | Ga0068870_10357633 | 3300005840 | Bacteria | 939 |
| 85 | Ga0068863_100045716 | 3300005841 | Bacteria | 4155 |
| 86 | Ga0068858_100009368 | 3300005842 | Bacteria | 9344 |
| 87 | Ga0068858_100050631 | 3300005842 | Bacteria | 3844 |
| 88 | Ga0068860_100783576 | 3300005843 | Bacteria | 966 |
| 89 | Ga0068860_101617690 | 3300005843 | Bacteria | 670 |
| 90 | Ga0068860_101620985 | 3300005843 | Unclassified | 669 |
| 91 | Ga0068862_101315235 | 3300005844 | Unclassified | 724 |
| 92 | Ga0068862_101620612 | 3300005844 | Bacteria | 654 |
| 93 | Ga0068862_101848890 | 3300005844 | Unclassified | 613 |
| 94 | Ga0070717_11199345 | 3300006028 | Unclassified | 691 |
| 95 | Ga0075365_10024998 | 3300006038 | Bacteria | 3775 |
| 96 | Ga0075368_10009062 | 3300006042 | Bacteria | 3572 |
| 97 | Ga0075368_10010609 | 3300006042 | Bacteria | 3334 |
| 98 | Ga0075364_10003177 | 3300006051 | Bacteria | 9304 |
| 99 | Ga0075364_10050416 | 3300006051 | Bacteria | 2717 |
| 100 | Ga0075364_10090918 | 3300006051 | Bacteria | 2025 |
| 101 | Ga0075364_10111917 | 3300006051 | Bacteria | 1823 |
| 102 | Ga0075364_10220068 | 3300006051 | Bacteria | 1288 |
| 103 | Ga0075364_10664849 | 3300006051 | Bacteria | 711 |
| 104 | Ga0075362_10012413 | 3300006177 | Bacteria | 3384 |
| 105 | Ga0075367_10009888 | 3300006178 | Bacteria | 4995 |
| 106 | Ga0075367_10096443 | 3300006178 | Bacteria | 1804 |
| 107 | Ga0075367_10097431 | 3300006178 | Bacteria | 1794 |
| 108 | Ga0075366_10002880 | 3300006195 | Bacteria | 8926 |
| 109 | Ga0075366_10008557 | 3300006195 | Bacteria | 5693 |
| 110 | Ga0075366_10106137 | 3300006195 | Bacteria | 1688 |
| 111 | Ga0075366_10171506 | 3300006195 | Unclassified | 1316 |
| 112 | Ga0097621_100019736 | 3300006237 | Bacteria | 5182 |
| 113 | Ga0097621_100137861 | 3300006237 | Unclassified | 2083 |
| 114 | Ga0097621_102033566 | 3300006237 | Bacteria | 549 |
| 115 | Ga0075370_10000584 | 3300006353 | Bacteria | 14059 |
| 116 | Ga0075370_10001862 | 3300006353 | Bacteria | 9456 |
| 117 | Ga0068871_100023787 | 3300006358 | Bacteria | 4743 |
| 118 | Ga0068871_100613099 | 3300006358 | Bacteria | 990 |
| 119 | Ga0075428_100001990 | 3300006844 | Bacteria | 22025 |
| 120 | Ga0075428_100005939 | 3300006844 | Bacteria | 13568 |
| 121 | Ga0075428_100041386 | 3300006844 | Bacteria | 5068 |
| 122 | Ga0075428_100072908 | 3300006844 | Bacteria | 3750 |
| 123 | Ga0075428_100085251 | 3300006844 | Bacteria | 3445 |
| 124 | Ga0075430_100004736 | 3300006846 | Bacteria | 11445 |
| 125 | Ga0075430_100007248 | 3300006846 | Bacteria | 9366 |
| 126 | Ga0075430_100016154 | 3300006846 | Bacteria | 6358 |
| 127 | Ga0075430_100330961 | 3300006846 | Unclassified | 1258 |
| 128 | Ga0075431_100003585 | 3300006847 | Bacteria | 15045 |
| 129 | Ga0075431_100075641 | 3300006847 | Unclassified | 3475 |
| 130 | Ga0075431_100086786 | 3300006847 | Bacteria | 3229 |
| 131 | Ga0075431_100102179 | 3300006847 | Unclassified | 2958 |
| 132 | Ga0075431_100241461 | 3300006847 | Bacteria | 1838 |
| 133 | Ga0075431_100295093 | 3300006847 | Bacteria | 1639 |
| 134 | Ga0075431_100383577 | 3300006847 | Bacteria | 1409 |
| 135 | Ga0075431_100643328 | 3300006847 | Bacteria | 1041 |
| 136 | Ga0075431_100994110 | 3300006847 | Bacteria | 806 |
| 137 | Ga0075433_10000075 | 3300006852 | Bacteria | 44503 |
| 138 | Ga0075433_10001854 | 3300006852 | Bacteria | 15883 |
| 139 | Ga0075433_10007792 | 3300006852 | Bacteria | 8513 |
| 140 | Ga0075433_10041922 | 3300006852 | Bacteria | 3968 |
| 141 | Ga0075433_10050580 | 3300006852 | Bacteria | 3618 |
| 142 | Ga0075433_10177771 | 3300006852 | Bacteria | 1893 |
| 143 | Ga0075433_11848346 | 3300006852 | Unclassified | 519 |
| 144 | Ga0075434_100001073 | 3300006871 | Bacteria | 22364 |
| 145 | Ga0075434_100003008 | 3300006871 | Bacteria | 14991 |
| 146 | Ga0075434_100045713 | 3300006871 | Unclassified | 4344 |
| 147 | Ga0075434_100211738 | 3300006871 | Bacteria | 1958 |
| 148 | Ga0075434_100331057 | 3300006871 | Bacteria | 1543 |
| 149 | Ga0075434_100389666 | 3300006871 | Bacteria | 1414 |
| 150 | Ga0075434_100953867 | 3300006871 | Bacteria | 872 |
| 151 | Ga0075434_101731702 | 3300006871 | Bacteria | 632 |
| 152 | Ga0075429_100001556 | 3300006880 | Bacteria | 18839 |
| 153 | Ga0075429_100002803 | 3300006880 | Bacteria | 14753 |
| 154 | Ga0075429_100013365 | 3300006880 | Bacteria | 7119 |
| 155 | Ga0075429_100138033 | 3300006880 | Bacteria | 2134 |
| 156 | Ga0075429_100226790 | 3300006880 | Bacteria | 1636 |
| 157 | Ga0075429_100442247 | 3300006880 | Unclassified | 1139 |
| 158 | Ga0075429_100481982 | 3300006880 | Unclassified | 1087 |
| 159 | Ga0075429_100722294 | 3300006880 | Bacteria | 873 |
| 160 | Ga0075429_100815970 | 3300006880 | Unclassified | 817 |
| 161 | Ga0075429_101080970 | 3300006880 | Bacteria | 701 |
| 162 | Ga0068865_100017194 | 3300006881 | Bacteria | 4647 |
| 163 | Ga0068865_100023269 | 3300006881 | Unclassified | 4055 |
| 164 | Ga0068865_101051974 | 3300006881 | Bacteria | 715 |
| 165 | Ga0068865_101179003 | 3300006881 | Bacteria | 677 |
| 166 | Ga0068865_101709769 | 3300006881 | Unclassified | 567 |
| 167 | Ga0097620_100011477 | 3300006931 | Bacteria | 8908 |
| 168 | Ga0097620_101383341 | 3300006931 | Bacteria | 776 |
| 169 | Ga0075435_100006592 | 3300007076 | Bacteria | 8220 |
| 170 | Ga0075435_100021078 | 3300007076 | Bacteria | 5007 |
| 171 | Ga0075435_100136780 | 3300007076 | Bacteria | 2053 |
| 172 | Ga0075435_100143993 | 3300007076 | Bacteria | 2001 |
| 173 | Ga0099795_10012572 | 3300007788 | Bacteria | 2571 |
| 174 | Ga0105240_10139630 | 3300009093 | Bacteria | 2898 |
| 175 | Ga0105240_10545653 | 3300009093 | Bacteria | 1283 |
| 176 | Ga0105240_10625872 | 3300009093 | Bacteria | 1182 |
| 177 | Ga0111539_10001047 | 3300009094 | Bacteria | 36383 |
| 178 | Ga0111539_10010457 | 3300009094 | Bacteria | 11679 |
| 179 | Ga0111539_10014457 | 3300009094 | Bacteria | 9850 |
| 180 | Ga0111539_10015839 | 3300009094 | Bacteria | 9366 |
| 181 | Ga0111539_10293640 | 3300009094 | Bacteria | 1891 |
| 182 | Ga0111539_10317063 | 3300009094 | Unclassified | 1814 |
| 183 | Ga0111539_10329138 | 3300009094 | Bacteria | 1778 |
| 184 | Ga0111539_11037614 | 3300009094 | Bacteria | 953 |
| 185 | Ga0111539_11379368 | 3300009094 | Bacteria | 818 |
| 186 | Ga0111539_12237828 | 3300009094 | Bacteria | 634 |
| 187 | Ga0105245_10010723 | 3300009098 | Bacteria | 7973 |
| 188 | Ga0105245_10062864 | 3300009098 | Bacteria | 3351 |
| 189 | Ga0105247_10756680 | 3300009101 | Bacteria | 737 |
| 190 | Ga0105247_10776826 | 3300009101 | Unclassified | 728 |
| 191 | Ga0114129_10016308 | 3300009147 | Bacteria | 10575 |
| 192 | Ga0114129_10024373 | 3300009147 | Bacteria | 8574 |
| 193 | Ga0114129_10100856 | 3300009147 | Bacteria | 3994 |
| 194 | Ga0114129_10156357 | 3300009147 | Bacteria | 3117 |
| 195 | Ga0114129_10158775 | 3300009147 | Bacteria | 3091 |
| 196 | Ga0114129_10546738 | 3300009147 | Bacteria | 1506 |
| 197 | Ga0114129_10571324 | 3300009147 | Bacteria | 1468 |
| 198 | Ga0114129_11113868 | 3300009147 | Bacteria | 988 |
| 199 | Ga0114129_11891608 | 3300009147 | Bacteria | 724 |
| 200 | Ga0114129_12305103 | 3300009147 | Bacteria | 646 |
| 201 | Ga0114129_12335930 | 3300009147 | Unclassified | 641 |
| 202 | Ga0114129_12505328 | 3300009147 | Unclassified | 617 |
| 203 | Ga0114129_12651737 | 3300009147 | Bacteria | 598 |
| 204 | Ga0105241_10115131 | 3300009174 | Bacteria | 2158 |
| 205 | Ga0105241_11114628 | 3300009174 | Bacteria | 744 |
| 206 | Ga0105241_11728746 | 3300009174 | Unclassified | 608 |
| 207 | Ga0105242_10001476 | 3300009176 | Bacteria | 18511 |
| 208 | Ga0105242_10006429 | 3300009176 | Bacteria | 9050 |
| 209 | Ga0105242_11224551 | 3300009176 | Unclassified | 771 |
| 210 | Ga0105248_10062130 | 3300009177 | Bacteria | 4195 |
| 211 | Ga0105248_10199998 | 3300009177 | Bacteria | 2251 |
| 212 | Ga0105237_10205086 | 3300009545 | Unclassified | 1972 |
| 213 | Ga0105238_10706823 | 3300009551 | Bacteria | 1020 |
| 214 | Ga0105249_10364865 | 3300009553 | Unclassified | 1466 |
| 215 | Ga0105249_10926315 | 3300009553 | Bacteria | 939 |
| 216 | Ga0105249_10969792 | 3300009553 | Unclassified | 918 |
| 217 | Ga0105249_11440606 | 3300009553 | Bacteria | 761 |
| 218 | Ga0105249_12388355 | 3300009553 | Bacteria | 601 |
| 219 | Ga0105249_12957273 | 3300009553 | Bacteria | 545 |
| 220 | Ga0105239_10014649 | 3300010375 | Bacteria | 8694 |
| 221 | Ga0105239_10076579 | 3300010375 | Unclassified | 3679 |
| 222 | Ga0105246_10958619 | 3300011119 | Bacteria | 771 |
| 223 | Ga0105246_12358726 | 3300011119 | Unclassified | 521 |
| 224 | Ga0157373_10627238 | 3300013100 | Unclassified | 784 |
| 225 | Ga0157373_10634659 | 3300013100 | Unclassified | 779 |
| 226 | Ga0157371_10664414 | 3300013102 | Unclassified | 778 |
| 227 | Ga0157370_10274287 | 3300013104 | Unclassified | 1558 |
| 228 | Ga0157369_10091776 | 3300013105 | Bacteria | 3242 |
| 229 | Ga0157374_10005661 | 3300013296 | Bacteria | 10535 |
| 230 | Ga0157374_12533198 | 3300013296 | Unclassified | 540 |
| 231 | Ga0157378_11074373 | 3300013297 | Unclassified | 841 |
| 232 | Ga0157378_12026094 | 3300013297 | Unclassified | 626 |
| 233 | Ga0163162_10000933 | 3300013306 | Bacteria | 27147 |
| 234 | Ga0163162_11248235 | 3300013306 | Bacteria | 844 |
| 235 | Ga0163162_11259090 | 3300013306 | Bacteria | 840 |
| 236 | Ga0157372_10014264 | 3300013307 | Bacteria | 8495 |
| 237 | Ga0157372_10627916 | 3300013307 | Unclassified | 1252 |
| 238 | Ga0157375_10240923 | 3300013308 | Bacteria | 1968 |
| 239 | Ga0157375_11280173 | 3300013308 | Bacteria | 862 |
| 240 | Ga0157375_11658099 | 3300013308 | Bacteria | 757 |
| 241 | Ga0163163_10100505 | 3300014325 | Bacteria | 2914 |
| 242 | Ga0157380_10065661 | 3300014326 | Bacteria | 2917 |
| 243 | Ga0157380_10512722 | 3300014326 | Bacteria | 1168 |
| 244 | Ga0157380_10674492 | 3300014326 | Bacteria | 1035 |
| 245 | Ga0157380_11768576 | 3300014326 | Unclassified | 677 |
| 246 | Ga0157380_11801166 | 3300014326 | Unclassified | 671 |
| 247 | Ga0157379_10069302 | 3300014968 | Bacteria | 3154 |
| 248 | Ga0157379_10900005 | 3300014968 | Unclassified | 839 |
| 249 | Ga0157376_10013058 | 3300014969 | Bacteria | 6186 |
| 250 | Ga0157376_10018124 | 3300014969 | Bacteria | 5388 |
| 251 | Ga0157376_10333801 | 3300014969 | Bacteria | 1445 |
| 252 | Ga0157376_11935462 | 3300014969 | Unclassified | 627 |
| 253 | Ga0163161_11796965 | 3300017792 | Bacteria | 545 |
| 254 | Ga0213876_10000053 | 3300021384 | Bacteria | 142404 |
| 255 | Ga0207697_10035707 | 3300025315 | Bacteria | 2035 |
| 256 | Ga0207656_10106994 | 3300025321 | Bacteria | 1288 |
| 257 | Ga0207656_10525879 | 3300025321 | Bacteria | 601 |
| 258 | Ga0207653_10052013 | 3300025885 | Bacteria | 1365 |
| 259 | Ga0207642_10061054 | 3300025899 | Bacteria | 1751 |
| 260 | Ga0207710_10571313 | 3300025900 | Bacteria | 590 |
| 261 | Ga0207688_10327112 | 3300025901 | Bacteria | 941 |
| 262 | Ga0207645_10002686 | 3300025907 | Bacteria | 13855 |
| 263 | Ga0207645_10028377 | 3300025907 | Bacteria | 3613 |
| 264 | Ga0207643_10095353 | 3300025908 | Bacteria | 1739 |
| 265 | Ga0207705_10777818 | 3300025909 | Unclassified | 743 |
| 266 | Ga0207660_10125627 | 3300025917 | Bacteria | 1948 |
| 267 | Ga0207660_10376498 | 3300025917 | Unclassified | 1141 |
| 268 | Ga0207649_10914596 | 3300025920 | Unclassified | 688 |
| 269 | Ga0207646_10190973 | 3300025922 | Bacteria | 1850 |
| 270 | Ga0207646_10913294 | 3300025922 | Unclassified | 778 |
| 271 | Ga0207681_10735644 | 3300025923 | Unclassified | 822 |
| 272 | Ga0207681_11097476 | 3300025923 | Bacteria | 668 |
| 273 | Ga0207694_10094527 | 3300025924 | Bacteria | 2362 |
| 274 | Ga0207650_11031841 | 3300025925 | Unclassified | 700 |
| 275 | Ga0207659_10794375 | 3300025926 | Bacteria | 813 |
| 276 | Ga0207687_10339657 | 3300025927 | Unclassified | 1221 |
| 277 | Ga0207700_11626567 | 3300025928 | Unclassified | 571 |
| 278 | Ga0207664_10010849 | 3300025929 | Bacteria | 6450 |
| 279 | Ga0207686_10013034 | 3300025934 | Bacteria | 4590 |
| 280 | Ga0207686_10022214 | 3300025934 | Bacteria | 3652 |
| 281 | Ga0207670_10280288 | 3300025936 | Bacteria | 1299 |
| 282 | Ga0207704_11161618 | 3300025938 | Bacteria | 657 |
| 283 | Ga0207691_11761127 | 3300025940 | Bacteria | 500 |
| 284 | Ga0207711_10085168 | 3300025941 | Bacteria | 2769 |
| 285 | Ga0207711_10284138 | 3300025941 | Bacteria | 1524 |
| 286 | Ga0207689_10061406 | 3300025942 | Bacteria | 3090 |
| 287 | Ga0207661_10138902 | 3300025944 | Bacteria | 2089 |
| 288 | Ga0207679_11961588 | 3300025945 | Unclassified | 533 |
| 289 | Ga0207651_10097693 | 3300025960 | Bacteria | 2169 |
| 290 | Ga0207712_10117347 | 3300025961 | Unclassified | 2007 |
| 291 | Ga0207712_11668079 | 3300025961 | Unclassified | 571 |
| 292 | Ga0207640_10174465 | 3300025981 | Bacteria | 1605 |
| 293 | Ga0207640_10320337 | 3300025981 | Bacteria | 1234 |
| 294 | Ga0207640_10378364 | 3300025981 | Bacteria | 1146 |
| 295 | Ga0207658_10056651 | 3300025986 | Bacteria | 2910 |
| 296 | Ga0207677_10402889 | 3300026023 | Unclassified | 1161 |
| 297 | Ga0207703_10007478 | 3300026035 | Bacteria | 8677 |
| 298 | Ga0207703_10258113 | 3300026035 | Bacteria | 1574 |
| 299 | Ga0207639_11906563 | 3300026041 | Unclassified | 555 |
| 300 | Ga0207678_10689097 | 3300026067 | Unclassified | 899 |
| 301 | Ga0207678_10767941 | 3300026067 | Bacteria | 850 |
| 302 | Ga0207708_10008686 | 3300026075 | Bacteria | 7519 |
| 303 | Ga0207708_10126935 | 3300026075 | Bacteria | 1992 |
| 304 | Ga0207708_10590789 | 3300026075 | Bacteria | 940 |
| 305 | Ga0207702_10115261 | 3300026078 | Bacteria | 2396 |
| 306 | Ga0207702_10725794 | 3300026078 | Bacteria | 980 |
| 307 | Ga0207641_10031579 | 3300026088 | Bacteria | 4394 |
| 308 | Ga0207648_10340484 | 3300026089 | Unclassified | 1350 |
| 309 | Ga0207648_10828888 | 3300026089 | Bacteria | 862 |
| 310 | Ga0207648_11730532 | 3300026089 | Unclassified | 587 |
| 311 | Ga0207674_10032463 | 3300026116 | Bacteria | 5476 |
| 312 | Ga0207674_10788652 | 3300026116 | Bacteria | 917 |
| 313 | Ga0207675_100046521 | 3300026118 | Bacteria | 4054 |
| 314 | Ga0207675_101066693 | 3300026118 | Bacteria | 827 |
| 315 | Ga0207675_101317855 | 3300026118 | Bacteria | 742 |
| 316 | Ga0207683_10237410 | 3300026121 | Bacteria | 1663 |
| 317 | Ga0207683_10319994 | 3300026121 | Bacteria | 1421 |
| 318 | Ga0207683_10394158 | 3300026121 | Bacteria | 1273 |
| 319 | Ga0207698_11115995 | 3300026142 | Unclassified | 802 |
| 320 | Ga0209813_10102893 | 3300027866 | Bacteria | 974 |
| 321 | Ga0209974_10057876 | 3300027876 | Bacteria | 1310 |
| 322 | Ga0209974_10284681 | 3300027876 | Unclassified | 629 |
| 323 | Ga0207428_10000904 | 3300027907 | Bacteria | 33138 |
| 324 | Ga0207428_10003846 | 3300027907 | Bacteria | 14398 |
| 325 | Ga0207428_10118424 | 3300027907 | Bacteria | 2032 |
| 326 | Ga0207428_11286282 | 3300027907 | Bacteria | 507 |
| 327 | Ga0268266_10002004 | 3300028379 | Bacteria | 22766 |
| 328 | Ga0268265_10424029 | 3300028380 | Unclassified | 1236 |
| 329 | Ga0268265_12098367 | 3300028380 | Unclassified | 572 |
| 330 | Ga0268264_10067935 | 3300028381 | Bacteria | 3010 |
| 331 | Ga0316182_1222324 | 3300030745 | Unclassified | 743 |
| 332 | Ga0307408_100052122 | 3300031548 | Bacteria | 2950 |
| 333 | Ga0307408_100134895 | 3300031548 | Bacteria | 1930 |
| 334 | Ga0307408_100142490 | 3300031548 | Unclassified | 1883 |
| 335 | Ga0307408_100673499 | 3300031548 | Unclassified | 927 |
| 336 | Ga0307408_100755788 | 3300031548 | Bacteria | 879 |
| 337 | Ga0307405_10014948 | 3300031731 | Bacteria | 4190 |
| 338 | Ga0307405_11958852 | 3300031731 | Unclassified | 524 |
| 339 | Ga0307413_10606670 | 3300031824 | Bacteria | 897 |
| 340 | Ga0307413_10766796 | 3300031824 | Bacteria | 808 |
| 341 | Ga0307413_12183972 | 3300031824 | Bacteria | 502 |
| 342 | Ga0307410_10094545 | 3300031852 | Bacteria | 2129 |
| 343 | Ga0307410_10775155 | 3300031852 | Bacteria | 814 |
| 344 | Ga0307406_10049455 | 3300031901 | Unclassified | 2661 |
| 345 | Ga0307406_10369507 | 3300031901 | Bacteria | 1127 |
| 346 | Ga0307406_10448163 | 3300031901 | Bacteria | 1035 |
| 347 | Ga0307407_10231710 | 3300031903 | Bacteria | 1255 |
| 348 | Ga0307407_10925742 | 3300031903 | Bacteria | 670 |
| 349 | Ga0307412_10078618 | 3300031911 | Bacteria | 2273 |
| 350 | Ga0307412_10297746 | 3300031911 | Bacteria | 1273 |
| 351 | Ga0307409_100129841 | 3300031995 | Bacteria | 2151 |
| 352 | Ga0307409_100774382 | 3300031995 | Unclassified | 965 |
| 353 | Ga0307416_100041330 | 3300032002 | Unclassified | 3590 |
| 354 | Ga0307416_100062930 | 3300032002 | Bacteria | 3036 |
| 355 | Ga0307416_101121341 | 3300032002 | Unclassified | 891 |
| 356 | Ga0307416_101698402 | 3300032002 | Bacteria | 736 |
| 357 | Ga0307416_101929339 | 3300032002 | Bacteria | 694 |
| 358 | Ga0307414_11576511 | 3300032004 | Bacteria | 612 |
| 359 | Ga0307414_11906378 | 3300032004 | Unclassified | 555 |
| 360 | Ga0307411_10092342 | 3300032005 | Bacteria | 2117 |
| 361 | Ga0307411_10106571 | 3300032005 | Unclassified | 1995 |
| 362 | Ga0307411_10162993 | 3300032005 | Bacteria | 1673 |
| 363 | Ga0307411_10723264 | 3300032005 | Bacteria | 869 |
| 364 | Ga0307415_100237956 | 3300032126 | Unclassified | 1471 |
| 365 | Ga0307415_101462089 | 3300032126 | Bacteria | 653 |
| 366 | Ga0373932_0034808 | 3300035112 | Bacteria | 1421 |
| 367 | Ga0373936_0020695 | 3300035113 | Bacteria | 2557 |
| 368 | Ga0373941_0422047 | 3300035115 | Bacteria | 555 |
| 369 | Ga0373945_0156684 | 3300035116 | Bacteria | 926 |
| 370 | Ga0373943_0739234 | 3300035170 | Unclassified | 584 |
| 371 | Ga0373946_0245351 | 3300035171 | Unclassified | 872 |
| 372 | Ga0373942_0287225 | 3300035207 | Bacteria | 568 |
| 373 | Ga0373962_0136844 | 3300035242 | Bacteria | 793 |
| 374 | Ga0373924_0030931 | 3300035410 | Bacteria | 2149 |
| 375 | Ga0373935_1023615 | 3300035692 | Unclassified | 614 |
| 376 | Ga0373947_0229925 | 3300035725 | Bacteria | 1221 |
| 377 | Ga0373947_0842714 | 3300035725 | Unclassified | 626 |
| 378 | Ga0373937_0047362 | 3300036401 | Unclassified | 3934 |
| 379 | Ga0373937_0444920 | 3300036401 | Bacteria | 1230 |
| 380 | Ga0373937_0693139 | 3300036401 | Bacteria | 965 |
| 381 | Ga0373925_0129584 | 3300037068 | Bacteria | 1965 |
| 382 | Ga0395900_0984318 | 3300037418 | Bacteria | 764 |
| 383 | Ga0395898_0342751 | 3300037466 | Bacteria | 1425 |
| 384 | Ga0436364_1049779 | 3300037853 | Bacteria | 1467 |
| 385 | Ga0436364_1068981 | 3300037853 | Unclassified | 3017 |
| 386 | Ga0436364_1203962 | 3300037853 | Unclassified | 864 |
| 387 | Ga0395901_0902145 | 3300038443 | Bacteria | 866 |
| 388 | Ga0400489_61415 | 3300039093 | Unclassified | 1313 |
| 389 | Ga0436365_0873465 | 3300039437 | Bacteria | 246686 |
| 390 | Ga0436365_1795675 | 3300039437 | Plasmid | 3883 |
| 391 | Ga0436360_0056218 | 3300039438 | Bacteria | 1803 |
| 392 | Ga0436360_0660040 | 3300039438 | Unclassified | 682 |
| 393 | Ga0436362_1256871 | 3300039453 | Unclassified | 642 |
| 394 | Ga0439443_018675 | 3300042003 | Bacteria | 1075 |
| 395 | Ga0439443_034099 | 3300042003 | Bacteria | 849 |
| 396 | Ga0439450_040495 | 3300042008 | Unclassified | 1080 |
| 397 | Ga0439450_111941 | 3300042008 | Bacteria | 698 |
| 398 | Ga0439462_0042339 | 3300042015 | Bacteria | 1217 |
| 399 | Ga0439434_0204462 | 3300042435 | Unclassified | 667 |
| 400 | Ga0439464_0083702 | 3300042439 | Bacteria | 955 |
| 401 | Ga0439460_0098821 | 3300042461 | Unclassified | 935 |
| 402 | Ga0439440_0244864 | 3300042993 | Unclassified | 544 |
| 403 | Ga0453683_0918045 | 3300044673 | Bacteria | 579 |
| 404 | Ga0466963_0592569 | 3300044694 | Bacteria | 783 |
| 405 | Ga0466960_0858120 | 3300044901 | Bacteria | 552 |
| 406 | Ga0451576_0467492 | 3300045051 | Bacteria | 1324 |
| 407 | Ga0451576_0620043 | 3300045051 | Unclassified | 1137 |
| 408 | Ga0466958_0954940 | 3300045836 | Unclassified | 559 |
| 409 | Ga0495592_0671455 | 3300046454 | Bacteria | 626 |
| 410 | Ga0495590_0430792 | 3300046457 | Bacteria | 508 |
| 411 | Ga0495629_1079024 | 3300046459 | Unclassified | 520 |
| 412 | Ga0495629_1128430 | 3300046459 | Unclassified | 506 |
| 413 | Ga0495639_0570007 | 3300046475 | Unclassified | 581 |
| 414 | Ga0495594_0147648 | 3300046499 | Unclassified | 1335 |
| 415 | Ga0495630_0867683 | 3300046517 | Bacteria | 688 |
| 416 | Ga0495630_0889087 | 3300046517 | Unclassified | 679 |
| 417 | Ga0495630_1148312 | 3300046517 | Unclassified | 588 |
| 418 | Ga0495640_0459733 | 3300046533 | Unclassified | 777 |
| 419 | Ga0495621_0036241 | 3300046539 | Bacteria | 1711 |
| 420 | Ga0495634_0417538 | 3300046642 | Unclassified | 795 |
| 421 | Ga0495635_0302816 | 3300046663 | Unclassified | 1072 |
| 422 | Ga0495647_0115600 | 3300046681 | Unclassified | 1124 |
| 423 | Ga0495658_0081509 | 3300046683 | Bacteria | 1900 |
| 424 | Ga0495613_0639625 | 3300046689 | Unclassified | 705 |
| 425 | Ga0495674_0595842 | 3300047319 | Unclassified | 876 |
| 426 | Ga0495674_1218672 | 3300047319 | Bacteria | 568 |
| 427 | Ga0495677_0135095 | 3300047445 | Bacteria | 945 |
| 428 | Ga0495684_0627528 | 3300047471 | Bacteria | 722 |
| 429 | Ga0495614_0477483 | 3300048089 | Unclassified | 592 |
| 430 | Ga0496104_0133485 | 3300048907 | Unclassified | 2385 |
| 431 | Ga0496106_0368116 | 3300048909 | Unclassified | 1155 |
| 432 | Ga0496108_0840795 | 3300048911 | Bacteria | 790 |
| 433 | Ga0496109_1603205 | 3300048912 | Bacteria | 585 |
| 434 | Ga0496110_0795469 | 3300048913 | Bacteria | 850 |
| 435 | Ga0496114_0079875 | 3300048917 | Bacteria | 2762 |
| 436 | Ga0496114_0232402 | 3300048917 | Bacteria | 1620 |
| 437 | Ga0496126_0155949 | 3300048929 | Bacteria | 1954 |
| 438 | Ga0501291_031015 | 3300049514 | Bacteria | 901 |
| 439 | Ga0501291_063948 | 3300049514 | Bacteria | 699 |
| 440 | Ga0501292_024526 | 3300049515 | Unclassified | 990 |
| 441 | Ga0501292_054832 | 3300049515 | Bacteria | 713 |
| 442 | Ga0501300_026510 | 3300049523 | Bacteria | 851 |
| 443 | Ga0501302_025968 | 3300049525 | Unclassified | 533 |
| 444 | Ga0501036_1197660 | 3300049572 | Unclassified | 619 |
| 445 | Ga0501068_0242977 | 3300049584 | Bacteria | 1146 |
| 446 | Ga0501071_1145359 | 3300049587 | Bacteria | 601 |
| 447 | Ga0501073_0245990 | 3300049589 | Bacteria | 1235 |
| 448 | Ga0501073_1082736 | 3300049589 | Unclassified | 551 |
| 449 | Ga0501076_0298800 | 3300049592 | Bacteria | 1320 |
| 450 | Ga0501076_1058914 | 3300049592 | Bacteria | 668 |
| 451 | Ga0501209_159522 | 3300049656 | Bacteria | 682 |
| 452 | Ga0501216_193146 | 3300049660 | Bacteria | 501 |
| 453 | Ga0501233_199511 | 3300049668 | Bacteria | 582 |
| 454 | Ga0501235_162348 | 3300049669 | Unclassified | 585 |
| 455 | Ga0501243_054745 | 3300049675 | Bacteria | 727 |
| 456 | Ga0501249_203110 | 3300049679 | Bacteria | 521 |
| 457 | Ga0501261_099648 | 3300049690 | Bacteria | 551 |
| 458 | Ga0501079_0986604 | 3300049741 | Bacteria | 663 |
| 459 | Ga0501080_0140294 | 3300049742 | Bacteria | 2235 |
| 460 | Ga0501081_0197949 | 3300049743 | Unclassified | 1457 |
| 461 | Ga0501264_031214 | 3300049761 | Unclassified | 614 |
| 462 | Ga0501271_012620 | 3300049768 | Unclassified | 917 |
| 463 | Ga0501279_032980 | 3300049775 | Bacteria | 773 |
| 464 | Ga0501282_046777 | 3300049778 | Bacteria | 527 |
| 465 | Ga0501283_125780 | 3300049779 | Unclassified | 517 |
| 466 | Ga0501212_043153 | 3300049851 | Bacteria | 750 |
| 467 | nmdc:mga03683_19891_c1 | 3300050489 | Bacteria | 2569 |
| 468 | nmdc:mga03n38_902415_c1 | 3300050490 | Bacteria | 519 |
| 469 | nmdc:mga00v17_19857_c1 | 3300050491 | Bacteria | 3842 |
| 470 | nmdc:mga00v17_199779_c1 | 3300050491 | Bacteria | 1292 |
| 471 | nmdc:mga00v17_22070_c1 | 3300050491 | Bacteria | 3668 |
| 472 | nmdc:mga00v17_47829_c1 | 3300050491 | Bacteria | 2591 |
| 473 | nmdc:mga00v17_712512_c1 | 3300050491 | Bacteria | 643 |
| 474 | nmdc:mga00v17_981998_c1 | 3300050491 | Unclassified | 532 |
| 475 | nmdc:mga0yw44_30560_c1 | 3300050492 | Bacteria | 3123 |
| 476 | nmdc:mga0k408_107679_c1 | 3300050493 | Bacteria | 1646 |
| 477 | nmdc:mga0k408_1798_c1 | 3300050493 | Bacteria | 11496 |
| 478 | nmdc:mga0k408_61717_c1 | 3300050493 | Bacteria | 2179 |
| 479 | nmdc:mga0k408_63436_c1 | 3300050493 | Bacteria | 2149 |
| 480 | nmdc:mga06z11_342078_c1 | 3300050494 | Bacteria | 895 |
| 481 | nmdc:mga06z11_345615_c1 | 3300050494 | Bacteria | 890 |
| 482 | nmdc:mga06z11_7398_c1 | 3300050494 | Bacteria | 4514 |
| 483 | nmdc:mga06z11_87703_c2 | 3300050494 | Bacteria | 1389 |
| 484 | nmdc:mga04h51_66895_c1 | 3300050495 | Bacteria | 1246 |
| 485 | nmdc:mga07m45_1478_c1 | 3300050496 | Bacteria | 10792 |
| 486 | nmdc:mga07m45_327341_c1 | 3300050496 | Bacteria | 891 |
| 487 | nmdc:mga07m45_8178_c1 | 3300050496 | Bacteria | 5367 |
| 488 | nmdc:mga05p37_1286827_c1 | 3300050507 | Unclassified | 747 |
| 489 | nmdc:mga05p37_17344_c1 | 3300050507 | Bacteria | 8685 |
| 490 | nmdc:mga05p37_1859999_c1 | 3300050507 | Unclassified | 577 |
| 491 | nmdc:mga05p37_288056_c1 | 3300050507 | Bacteria | 1956 |
| 492 | nmdc:mga05p37_545_c1 | 3300050507 | Bacteria | 41442 |
| 493 | nmdc:mga09592_102477_c1 | 3300050508 | Bacteria | 2452 |
| 494 | nmdc:mga09592_25730_c1 | 3300050508 | Bacteria | 4872 |
| 495 | nmdc:mga09592_32073_c1 | 3300050508 | Bacteria | 4379 |
| 496 | nmdc:mga09592_417444_c1 | 3300050508 | Bacteria | 1159 |
| 497 | nmdc:mga09592_427704_c1 | 3300050508 | Bacteria | 1143 |
| 498 | nmdc:mga09592_472484_c1 | 3300050508 | Bacteria | 1081 |
| 499 | nmdc:mga09592_659298_c1 | 3300050508 | Unclassified | 893 |
| 500 | nmdc:mga09592_71987_c1 | 3300050508 | Unclassified | 2935 |
| 501 | nmdc:mga09592_912617_c1 | 3300050508 | Bacteria | 738 |
| 502 | nmdc:mga09592_92548_c1 | 3300050508 | Bacteria | 2584 |
| 503 | nmdc:mga0qj67_106013_c1 | 3300050509 | Bacteria | 2268 |
| 504 | nmdc:mga0qj67_10926_c1 | 3300050509 | Bacteria | 6794 |
| 505 | nmdc:mga0qj67_126155_c1 | 3300050509 | Bacteria | 2071 |
| 506 | nmdc:mga0qj67_16027_c1 | 3300050509 | Bacteria | 5676 |
| 507 | nmdc:mga0qj67_49284_c1 | 3300050509 | Bacteria | 3329 |
| 508 | nmdc:mga0qj67_583607_c1 | 3300050509 | Unclassified | 895 |
| 509 | nmdc:mga0qj67_623556_c1 | 3300050509 | Bacteria | 861 |
| 510 | nmdc:mga0qj67_725592_c1 | 3300050509 | Unclassified | 789 |
| 511 | nmdc:mga06r32_1155659_c1 | 3300050510 | Unclassified | 722 |
| 512 | nmdc:mga06r32_1242158_c1 | 3300050510 | Bacteria | 690 |
| 513 | nmdc:mga06r32_1430286_c1 | 3300050510 | Unclassified | 633 |
| 514 | nmdc:mga06r32_213964_c1 | 3300050510 | Bacteria | 1915 |
| 515 | nmdc:mga06r32_5060_c1 | 3300050510 | Bacteria | 11874 |
| 516 | nmdc:mga06r32_539600_c1 | 3300050510 | Bacteria | 1141 |
| 517 | nmdc:mga06r32_690401_c1 | 3300050510 | Bacteria | 987 |
| 518 | nmdc:mga06r32_7050_c1 | 3300050510 | Bacteria | 10109 |
| 519 | nmdc:mga06r32_71221_c1 | 3300050510 | Bacteria | 3364 |
| 520 | nmdc:mga06r32_884481_c1 | 3300050510 | Bacteria | 850 |
| 521 | nmdc:mga06r32_98200_c1 | 3300050510 | Bacteria | 2871 |
| 522 | nmdc:mga08y16_12333_c1 | 3300050511 | Bacteria | 8988 |
| 523 | nmdc:mga08y16_1362564_c1 | 3300050511 | Unclassified | 674 |
| 524 | nmdc:mga08y16_148167_c1 | 3300050511 | Bacteria | 2439 |
| 525 | nmdc:mga08y16_193917_c1 | 3300050511 | Unclassified | 2106 |
| 526 | nmdc:mga08y16_222306_c1 | 3300050511 | Unclassified | 1955 |
| 527 | nmdc:mga08y16_248683_c1 | 3300050511 | Unclassified | 1837 |
| 528 | nmdc:mga08y16_52673_c1 | 3300050511 | Bacteria | 4258 |
| 529 | nmdc:mga08y16_56728_c1 | 3300050511 | Unclassified | 4093 |
| 530 | nmdc:mga08y16_657243_c1 | 3300050511 | Bacteria | 1052 |
| 531 | nmdc:mga0n895_1061531_c1 | 3300050512 | Bacteria | 789 |
| 532 | nmdc:mga0n895_140267_c1 | 3300050512 | Bacteria | 2445 |
| 533 | nmdc:mga0n895_218723_c1 | 3300050512 | Bacteria | 1934 |
| 534 | nmdc:mga0n895_3905_c1 | 3300050512 | Bacteria | 12112 |
| 535 | nmdc:mga0n895_391044_c1 | 3300050512 | Bacteria | 1407 |
| 536 | nmdc:mga0n895_61609_c1 | 3300050512 | Bacteria | 3705 |
| 537 | nmdc:mga0n895_89560_c1 | 3300050512 | Unclassified | 3078 |
| 538 | nmdc:mga0rr50_144255_c1 | 3300050513 | Bacteria | 1918 |
| 539 | nmdc:mga0rr50_14435_c1 | 3300050513 | Bacteria | 5182 |
| 540 | nmdc:mga0rr50_875278_c1 | 3300050513 | Bacteria | 766 |
| 541 | nmdc:mga08x19_344235_c1 | 3300050514 | Bacteria | 1040 |
| 542 | nmdc:mga0a205_12238_c1 | 3300050515 | Bacteria | 7933 |
| 543 | nmdc:mga0a205_123625_c1 | 3300050515 | Unclassified | 2487 |
| 544 | nmdc:mga0a205_168123_c1 | 3300050515 | Bacteria | 2088 |
| 545 | nmdc:mga0a205_2111_c1 | 3300050515 | Bacteria | 17434 |
| 546 | nmdc:mga0a205_7948_c1 | 3300050515 | Bacteria | 9632 |
| 547 | nmdc:mga0a205_8259_c1 | 3300050515 | Bacteria | 9463 |
| 548 | nmdc:mga0a205_8985_c1 | 3300050515 | Bacteria | 9106 |
| 549 | Ga0495619_0570196 | 3300053085 | Unclassified | 776 |
| 550 | Ga0500641_0008417 | 3300053096 | Bacteria | 3681 |
| 551 | Ga0501084_1840976 | 3300054114 | Unclassified | 505 |
| 552 | Ga0590071_056443 | 3300059421 | Bacteria | 956 |
| 553 | Ga0530510_0277912 | 3300061734 | Bacteria | 1250 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100499047 | Ga0070690_1004990472 | 105 |
| 2 | 3300005335 | Ga0070666_10038610 | Ga0070666_100386104 | 105 |
| 3 | 3300005367 | Ga0070667_100469446 | Ga0070667_1004694462 | 105 |
| 4 | 3300005459 | Ga0068867_100772678 | Ga0068867_1007726782 | 105 |
| 5 | 3300005535 | Ga0070684_100436752 | Ga0070684_1004367521 | 105 |
| 6 | 3300011119 | Ga0105246_12358726 | Ga0105246_123587261 | 105 |
| 7 | 3300050508 | nmdc:mga09592_92548_c1 | nmdc:mga09592_92548_c1_1626_1943 | 105 |
| 8 | 3300050509 | nmdc:mga0qj67_725592_c1 | nmdc:mga0qj67_725592_c1_212_529 | 105 |
| 9 | 3300050510 | nmdc:mga06r32_213964_c1 | nmdc:mga06r32_213964_c1_648_965 | 105 |
| 10 | 3300005406 | Ga0070703_10410395 | Ga0070703_104103952 | 106 |
| 11 | 3300050509 | nmdc:mga0qj67_49284_c1 | nmdc:mga0qj67_49284_c1_1998_2345 | 108 |
| 12 | 3300006847 | Ga0075431_100075641 | Ga0075431_1000756412 | 109 |
| 13 | 3300006880 | Ga0075429_100442247 | Ga0075429_1004422472 | 109 |
| 14 | 3300013296 | Ga0157374_12533198 | Ga0157374_125331981 | 109 |
| 15 | 3300042003 | Ga0439443_034099 | Ga0439443_034099_44_373 | 109 |
| 16 | 3300050508 | nmdc:mga09592_659298_c1 | nmdc:mga09592_659298_c1_292_630 | 109 |
| 17 | 3300050509 | nmdc:mga0qj67_623556_c1 | nmdc:mga0qj67_623556_c1_347_676 | 109 |
| 18 | 3300050515 | nmdc:mga0a205_168123_c1 | nmdc:mga0a205_168123_c1_985_1320 | 109 |
| 19 | 3300053096 | Ga0500641_0008417 | Ga0500641_0008417_441_779 | 109 |
| 20 | 3300005293 | Ga0065715_10151282 | Ga0065715_101512822 | 110 |
| 21 | 3300005293 | Ga0065715_10232421 | Ga0065715_102324212 | 110 |
| 22 | 3300005293 | Ga0065715_10630225 | Ga0065715_106302251 | 110 |
| 23 | 3300005295 | Ga0065707_10165770 | Ga0065707_101657703 | 110 |
| 24 | 3300005295 | Ga0065707_10705893 | Ga0065707_107058931 | 110 |
| 25 | 3300005327 | Ga0070658_10020369 | Ga0070658_100203694 | 110 |
| 26 | 3300005328 | Ga0070676_10010438 | Ga0070676_100104383 | 110 |
| 27 | 3300005328 | Ga0070676_10796337 | Ga0070676_107963371 | 110 |
| 28 | 3300005328 | Ga0070676_11359398 | Ga0070676_113593981 | 110 |
| 29 | 3300005329 | Ga0070683_100073495 | Ga0070683_1000734952 | 110 |
| 30 | 3300005333 | Ga0070677_10254781 | Ga0070677_102547812 | 110 |
| 31 | 3300005334 | Ga0068869_100048654 | Ga0068869_1000486542 | 110 |
| 32 | 3300005336 | Ga0070680_100249954 | Ga0070680_1002499541 | 110 |
| 33 | 3300005338 | Ga0068868_100167660 | Ga0068868_1001676601 | 110 |
| 34 | 3300005338 | Ga0068868_100372524 | Ga0068868_1003725242 | 110 |
| 35 | 3300005340 | Ga0070689_101043340 | Ga0070689_1010433402 | 110 |
| 36 | 3300005344 | Ga0070661_100051858 | Ga0070661_1000518582 | 110 |
| 37 | 3300005345 | Ga0070692_10261133 | Ga0070692_102611332 | 110 |
| 38 | 3300005347 | Ga0070668_100467430 | Ga0070668_1004674301 | 110 |
| 39 | 3300005353 | Ga0070669_100590529 | Ga0070669_1005905292 | 110 |
| 40 | 3300005353 | Ga0070669_101545734 | Ga0070669_1015457341 | 110 |
| 41 | 3300005354 | Ga0070675_100736020 | Ga0070675_1007360201 | 110 |
| 42 | 3300005354 | Ga0070675_101607068 | Ga0070675_1016070681 | 110 |
| 43 | 3300005364 | Ga0070673_100006695 | Ga0070673_1000066955 | 110 |
| 44 | 3300005364 | Ga0070673_101395383 | Ga0070673_1013953831 | 110 |
| 45 | 3300005366 | Ga0070659_100856854 | Ga0070659_1008568542 | 110 |
| 46 | 3300005366 | Ga0070659_101963839 | Ga0070659_1019638391 | 110 |
| 47 | 3300005436 | Ga0070713_100757986 | Ga0070713_1007579861 | 110 |
| 48 | 3300005438 | Ga0070701_10820936 | Ga0070701_108209361 | 110 |
| 49 | 3300005438 | Ga0070701_10970857 | Ga0070701_109708572 | 110 |
| 50 | 3300005440 | Ga0070705_100637545 | Ga0070705_1006375452 | 110 |
| 51 | 3300005441 | Ga0070700_100020782 | Ga0070700_1000207822 | 110 |
| 52 | 3300005441 | Ga0070700_100074985 | Ga0070700_1000749852 | 110 |
| 53 | 3300005444 | Ga0070694_100331651 | Ga0070694_1003316511 | 110 |
| 54 | 3300005444 | Ga0070694_100522607 | Ga0070694_1005226072 | 110 |
| 55 | 3300005444 | Ga0070694_100942818 | Ga0070694_1009428182 | 110 |
| 56 | 3300005444 | Ga0070694_101214466 | Ga0070694_1012144662 | 110 |
| 57 | 3300005445 | Ga0070708_100362632 | Ga0070708_1003626322 | 110 |
| 58 | 3300005455 | Ga0070663_101962102 | Ga0070663_1019621021 | 110 |
| 59 | 3300005456 | Ga0070678_100088911 | Ga0070678_1000889113 | 110 |
| 60 | 3300005456 | Ga0070678_101826811 | Ga0070678_1018268112 | 110 |
| 61 | 3300005457 | Ga0070662_100487610 | Ga0070662_1004876102 | 110 |
| 62 | 3300005459 | Ga0068867_101610825 | Ga0068867_1016108251 | 110 |
| 63 | 3300005468 | Ga0070707_100209053 | Ga0070707_1002090531 | 110 |
| 64 | 3300005468 | Ga0070707_100460933 | Ga0070707_1004609331 | 110 |
| 65 | 3300005468 | Ga0070707_101487047 | Ga0070707_1014870471 | 110 |
| 66 | 3300005471 | Ga0070698_100608922 | Ga0070698_1006089222 | 110 |
| 67 | 3300005471 | Ga0070698_100959436 | Ga0070698_1009594361 | 110 |
| 68 | 3300005471 | Ga0070698_101131489 | Ga0070698_1011314892 | 110 |
| 69 | 3300005471 | Ga0070698_101794582 | Ga0070698_1017945821 | 110 |
| 70 | 3300005518 | Ga0070699_100097650 | Ga0070699_1000976502 | 110 |
| 71 | 3300005518 | Ga0070699_101940781 | Ga0070699_1019407812 | 110 |
| 72 | 3300005535 | Ga0070684_100096776 | Ga0070684_1000967765 | 110 |
| 73 | 3300005539 | Ga0068853_101717479 | Ga0068853_1017174792 | 110 |
| 74 | 3300005546 | Ga0070696_100262728 | Ga0070696_1002627282 | 110 |
| 75 | 3300005546 | Ga0070696_100712813 | Ga0070696_1007128132 | 110 |
| 76 | 3300005546 | Ga0070696_100826919 | Ga0070696_1008269191 | 110 |
| 77 | 3300005548 | Ga0070665_100008991 | Ga0070665_1000089915 | 110 |
| 78 | 3300005549 | Ga0070704_100073781 | Ga0070704_1000737814 | 110 |
| 79 | 3300005549 | Ga0070704_100475495 | Ga0070704_1004754951 | 110 |
| 80 | 3300005549 | Ga0070704_100534186 | Ga0070704_1005341862 | 110 |
| 81 | 3300005563 | Ga0068855_100671224 | Ga0068855_1006712242 | 110 |
| 82 | 3300005564 | Ga0070664_100163808 | Ga0070664_1001638082 | 110 |
| 83 | 3300005564 | Ga0070664_100769870 | Ga0070664_1007698701 | 110 |
| 84 | 3300005577 | Ga0068857_100038806 | Ga0068857_1000388065 | 110 |
| 85 | 3300005578 | Ga0068854_100061421 | Ga0068854_1000614212 | 110 |
| 86 | 3300005578 | Ga0068854_100065880 | Ga0068854_1000658802 | 110 |
| 87 | 3300005614 | Ga0068856_100020395 | Ga0068856_1000203956 | 110 |
| 88 | 3300005614 | Ga0068856_100255921 | Ga0068856_1002559211 | 110 |
| 89 | 3300005615 | Ga0070702_101345737 | Ga0070702_1013457371 | 110 |
| 90 | 3300005617 | Ga0068859_100011477 | Ga0068859_1000114776 | 110 |
| 91 | 3300005618 | Ga0068864_101277140 | Ga0068864_1012771402 | 110 |
| 92 | 3300005718 | Ga0068866_10198013 | Ga0068866_101980132 | 110 |
| 93 | 3300005718 | Ga0068866_10393216 | Ga0068866_103932162 | 110 |
| 94 | 3300005719 | Ga0068861_101209967 | Ga0068861_1012099671 | 110 |
| 95 | 3300005719 | Ga0068861_102334252 | Ga0068861_1023342521 | 110 |
| 96 | 3300005719 | Ga0068861_102505919 | Ga0068861_1025059191 | 110 |
| 97 | 3300005840 | Ga0068870_10357633 | Ga0068870_103576332 | 110 |
| 98 | 3300005841 | Ga0068863_100045716 | Ga0068863_1000457162 | 110 |
| 99 | 3300005842 | Ga0068858_100009368 | Ga0068858_1000093683 | 110 |
| 100 | 3300005842 | Ga0068858_100050631 | Ga0068858_1000506313 | 110 |
| 101 | 3300005843 | Ga0068860_100783576 | Ga0068860_1007835762 | 110 |
| 102 | 3300005843 | Ga0068860_101617690 | Ga0068860_1016176901 | 110 |
| 103 | 3300005843 | Ga0068860_101620985 | Ga0068860_1016209851 | 110 |
| 104 | 3300005844 | Ga0068862_101315235 | Ga0068862_1013152352 | 110 |
| 105 | 3300005844 | Ga0068862_101620612 | Ga0068862_1016206121 | 110 |
| 106 | 3300005844 | Ga0068862_101848890 | Ga0068862_1018488902 | 110 |
| 107 | 3300006028 | Ga0070717_11199345 | Ga0070717_111993452 | 110 |
| 108 | 3300006038 | Ga0075365_10024998 | Ga0075365_100249982 | 110 |
| 109 | 3300006042 | Ga0075368_10009062 | Ga0075368_100090622 | 110 |
| 110 | 3300006042 | Ga0075368_10010609 | Ga0075368_100106092 | 110 |
| 111 | 3300006051 | Ga0075364_10003177 | Ga0075364_100031773 | 110 |
| 112 | 3300006051 | Ga0075364_10050416 | Ga0075364_100504162 | 110 |
| 113 | 3300006051 | Ga0075364_10090918 | Ga0075364_100909182 | 110 |
| 114 | 3300006051 | Ga0075364_10111917 | Ga0075364_101119172 | 110 |
| 115 | 3300006051 | Ga0075364_10220068 | Ga0075364_102200681 | 110 |
| 116 | 3300006051 | Ga0075364_10664849 | Ga0075364_106648492 | 110 |
| 117 | 3300006177 | Ga0075362_10012413 | Ga0075362_100124132 | 110 |
| 118 | 3300006178 | Ga0075367_10009888 | Ga0075367_100098883 | 110 |
| 119 | 3300006178 | Ga0075367_10096443 | Ga0075367_100964432 | 110 |
| 120 | 3300006178 | Ga0075367_10097431 | Ga0075367_100974312 | 110 |
| 121 | 3300006195 | Ga0075366_10002880 | Ga0075366_100028802 | 110 |
| 122 | 3300006195 | Ga0075366_10008557 | Ga0075366_100085573 | 110 |
| 123 | 3300006195 | Ga0075366_10106137 | Ga0075366_101061372 | 110 |
| 124 | 3300006195 | Ga0075366_10171506 | Ga0075366_101715062 | 110 |
| 125 | 3300006237 | Ga0097621_100019736 | Ga0097621_1000197365 | 110 |
| 126 | 3300006237 | Ga0097621_100137861 | Ga0097621_1001378612 | 110 |
| 127 | 3300006237 | Ga0097621_102033566 | Ga0097621_1020335662 | 110 |
| 128 | 3300006353 | Ga0075370_10000584 | Ga0075370_100005843 | 110 |
| 129 | 3300006353 | Ga0075370_10001862 | Ga0075370_100018625 | 110 |
| 130 | 3300006358 | Ga0068871_100023787 | Ga0068871_1000237874 | 110 |
| 131 | 3300006358 | Ga0068871_100613099 | Ga0068871_1006130992 | 110 |
| 132 | 3300006844 | Ga0075428_100001990 | Ga0075428_1000019908 | 110 |
| 133 | 3300006844 | Ga0075428_100005939 | Ga0075428_1000059398 | 110 |
| 134 | 3300006844 | Ga0075428_100041386 | Ga0075428_1000413864 | 110 |
| 135 | 3300006844 | Ga0075428_100072908 | Ga0075428_1000729084 | 110 |
| 136 | 3300006844 | Ga0075428_100085251 | Ga0075428_1000852512 | 110 |
| 137 | 3300006846 | Ga0075430_100004736 | Ga0075430_10000473612 | 110 |
| 138 | 3300006846 | Ga0075430_100007248 | Ga0075430_1000072485 | 110 |
| 139 | 3300006846 | Ga0075430_100016154 | Ga0075430_1000161544 | 110 |
| 140 | 3300006846 | Ga0075430_100330961 | Ga0075430_1003309611 | 110 |
| 141 | 3300006847 | Ga0075431_100003585 | Ga0075431_10000358511 | 110 |
| 142 | 3300006847 | Ga0075431_100086786 | Ga0075431_1000867862 | 110 |
| 143 | 3300006847 | Ga0075431_100102179 | Ga0075431_1001021792 | 110 |
| 144 | 3300006847 | Ga0075431_100241461 | Ga0075431_1002414612 | 110 |
| 145 | 3300006847 | Ga0075431_100295093 | Ga0075431_1002950931 | 110 |
| 146 | 3300006847 | Ga0075431_100383577 | Ga0075431_1003835773 | 110 |
| 147 | 3300006847 | Ga0075431_100643328 | Ga0075431_1006433282 | 110 |
| 148 | 3300006847 | Ga0075431_100994110 | Ga0075431_1009941102 | 110 |
| 149 | 3300006852 | Ga0075433_10000075 | Ga0075433_100000759 | 110 |
| 150 | 3300006852 | Ga0075433_10001854 | Ga0075433_100018548 | 110 |
| 151 | 3300006852 | Ga0075433_10007792 | Ga0075433_100077922 | 110 |
| 152 | 3300006852 | Ga0075433_10041922 | Ga0075433_100419222 | 110 |
| 153 | 3300006852 | Ga0075433_10050580 | Ga0075433_100505802 | 110 |
| 154 | 3300006852 | Ga0075433_10177771 | Ga0075433_101777712 | 110 |
| 155 | 3300006852 | Ga0075433_11848346 | Ga0075433_118483461 | 110 |
| 156 | 3300006871 | Ga0075434_100001073 | Ga0075434_1000010737 | 110 |
| 157 | 3300006871 | Ga0075434_100003008 | Ga0075434_1000030086 | 110 |
| 158 | 3300006871 | Ga0075434_100045713 | Ga0075434_1000457133 | 110 |
| 159 | 3300006871 | Ga0075434_100211738 | Ga0075434_1002117382 | 110 |
| 160 | 3300006871 | Ga0075434_100331057 | Ga0075434_1003310572 | 110 |
| 161 | 3300006871 | Ga0075434_100389666 | Ga0075434_1003896662 | 110 |
| 162 | 3300006871 | Ga0075434_100953867 | Ga0075434_1009538672 | 110 |
| 163 | 3300006871 | Ga0075434_101731702 | Ga0075434_1017317022 | 110 |
| 164 | 3300006880 | Ga0075429_100001556 | Ga0075429_1000015566 | 110 |
| 165 | 3300006880 | Ga0075429_100002803 | Ga0075429_1000028035 | 110 |
| 166 | 3300006880 | Ga0075429_100013365 | Ga0075429_1000133653 | 110 |
| 167 | 3300006880 | Ga0075429_100138033 | Ga0075429_1001380332 | 110 |
| 168 | 3300006880 | Ga0075429_100226790 | Ga0075429_1002267902 | 110 |
| 169 | 3300006880 | Ga0075429_100481982 | Ga0075429_1004819822 | 110 |
| 170 | 3300006880 | Ga0075429_100722294 | Ga0075429_1007222942 | 110 |
| 171 | 3300006880 | Ga0075429_100815970 | Ga0075429_1008159702 | 110 |
| 172 | 3300006880 | Ga0075429_101080970 | Ga0075429_1010809701 | 110 |
| 173 | 3300006881 | Ga0068865_100017194 | Ga0068865_1000171942 | 110 |
| 174 | 3300006881 | Ga0068865_100023269 | Ga0068865_1000232691 | 110 |
| 175 | 3300006881 | Ga0068865_101051974 | Ga0068865_1010519742 | 110 |
| 176 | 3300006881 | Ga0068865_101179003 | Ga0068865_1011790032 | 110 |
| 177 | 3300006881 | Ga0068865_101709769 | Ga0068865_1017097692 | 110 |
| 178 | 3300006931 | Ga0097620_100011477 | Ga0097620_1000114776 | 110 |
| 179 | 3300006931 | Ga0097620_101383341 | Ga0097620_1013833412 | 110 |
| 180 | 3300007076 | Ga0075435_100006592 | Ga0075435_1000065927 | 110 |
| 181 | 3300007076 | Ga0075435_100021078 | Ga0075435_1000210782 | 110 |
| 182 | 3300007076 | Ga0075435_100136780 | Ga0075435_1001367802 | 110 |
| 183 | 3300007076 | Ga0075435_100143993 | Ga0075435_1001439932 | 110 |
| 184 | 3300007788 | Ga0099795_10012572 | Ga0099795_100125722 | 110 |
| 185 | 3300009093 | Ga0105240_10139630 | Ga0105240_101396302 | 110 |
| 186 | 3300009093 | Ga0105240_10545653 | Ga0105240_105456532 | 110 |
| 187 | 3300009093 | Ga0105240_10625872 | Ga0105240_106258722 | 110 |
| 188 | 3300009094 | Ga0111539_10001047 | Ga0111539_100010479 | 110 |
| 189 | 3300009094 | Ga0111539_10010457 | Ga0111539_1001045710 | 110 |
| 190 | 3300009094 | Ga0111539_10014457 | Ga0111539_100144575 | 110 |
| 191 | 3300009094 | Ga0111539_10015839 | Ga0111539_100158392 | 110 |
| 192 | 3300009094 | Ga0111539_10293640 | Ga0111539_102936402 | 110 |
| 193 | 3300009094 | Ga0111539_10317063 | Ga0111539_103170632 | 110 |
| 194 | 3300009094 | Ga0111539_10329138 | Ga0111539_103291382 | 110 |
| 195 | 3300009094 | Ga0111539_11037614 | Ga0111539_110376141 | 110 |
| 196 | 3300009094 | Ga0111539_11379368 | Ga0111539_113793682 | 110 |
| 197 | 3300009094 | Ga0111539_12237828 | Ga0111539_122378281 | 110 |
| 198 | 3300009098 | Ga0105245_10010723 | Ga0105245_100107233 | 110 |
| 199 | 3300009098 | Ga0105245_10062864 | Ga0105245_100628642 | 110 |
| 200 | 3300009101 | Ga0105247_10756680 | Ga0105247_107566802 | 110 |
| 201 | 3300009101 | Ga0105247_10776826 | Ga0105247_107768262 | 110 |
| 202 | 3300009147 | Ga0114129_10016308 | Ga0114129_100163087 | 110 |
| 203 | 3300009147 | Ga0114129_10024373 | Ga0114129_1002437310 | 110 |
| 204 | 3300009147 | Ga0114129_10100856 | Ga0114129_101008563 | 110 |
| 205 | 3300009147 | Ga0114129_10156357 | Ga0114129_101563572 | 110 |
| 206 | 3300009147 | Ga0114129_10158775 | Ga0114129_101587752 | 110 |
| 207 | 3300009147 | Ga0114129_10546738 | Ga0114129_105467381 | 110 |
| 208 | 3300009147 | Ga0114129_10571324 | Ga0114129_105713241 | 110 |
| 209 | 3300009147 | Ga0114129_11113868 | Ga0114129_111138681 | 110 |
| 210 | 3300009147 | Ga0114129_11891608 | Ga0114129_118916082 | 110 |
| 211 | 3300009147 | Ga0114129_12305103 | Ga0114129_123051031 | 110 |
| 212 | 3300009147 | Ga0114129_12335930 | Ga0114129_123359301 | 110 |
| 213 | 3300009147 | Ga0114129_12505328 | Ga0114129_125053281 | 110 |
| 214 | 3300009147 | Ga0114129_12651737 | Ga0114129_126517371 | 110 |
| 215 | 3300009174 | Ga0105241_10115131 | Ga0105241_101151312 | 110 |
| 216 | 3300009174 | Ga0105241_11114628 | Ga0105241_111146282 | 110 |
| 217 | 3300009174 | Ga0105241_11728746 | Ga0105241_117287461 | 110 |
| 218 | 3300009176 | Ga0105242_10001476 | Ga0105242_100014764 | 110 |
| 219 | 3300009176 | Ga0105242_10006429 | Ga0105242_100064296 | 110 |
| 220 | 3300009176 | Ga0105242_11224551 | Ga0105242_112245511 | 110 |
| 221 | 3300009177 | Ga0105248_10062130 | Ga0105248_100621302 | 110 |
| 222 | 3300009177 | Ga0105248_10199998 | Ga0105248_101999982 | 110 |
| 223 | 3300009545 | Ga0105237_10205086 | Ga0105237_102050862 | 110 |
| 224 | 3300009551 | Ga0105238_10706823 | Ga0105238_107068232 | 110 |
| 225 | 3300009553 | Ga0105249_10364865 | Ga0105249_103648653 | 110 |
| 226 | 3300009553 | Ga0105249_10926315 | Ga0105249_109263152 | 110 |
| 227 | 3300009553 | Ga0105249_10969792 | Ga0105249_109697922 | 110 |
| 228 | 3300009553 | Ga0105249_11440606 | Ga0105249_114406061 | 110 |
| 229 | 3300009553 | Ga0105249_12388355 | Ga0105249_123883552 | 110 |
| 230 | 3300009553 | Ga0105249_12957273 | Ga0105249_129572731 | 110 |
| 231 | 3300010375 | Ga0105239_10014649 | Ga0105239_100146492 | 110 |
| 232 | 3300010375 | Ga0105239_10076579 | Ga0105239_100765794 | 110 |
| 233 | 3300011119 | Ga0105246_10958619 | Ga0105246_109586192 | 110 |
| 234 | 3300013100 | Ga0157373_10627238 | Ga0157373_106272381 | 110 |
| 235 | 3300013100 | Ga0157373_10634659 | Ga0157373_106346592 | 110 |
| 236 | 3300013102 | Ga0157371_10664414 | Ga0157371_106644141 | 110 |
| 237 | 3300013104 | Ga0157370_10274287 | Ga0157370_102742872 | 110 |
| 238 | 3300013105 | Ga0157369_10091776 | Ga0157369_100917763 | 110 |
| 239 | 3300013296 | Ga0157374_10005661 | Ga0157374_100056618 | 110 |
| 240 | 3300013297 | Ga0157378_11074373 | Ga0157378_110743732 | 110 |
| 241 | 3300013297 | Ga0157378_12026094 | Ga0157378_120260942 | 110 |
| 242 | 3300013306 | Ga0163162_10000933 | Ga0163162_100009338 | 110 |
| 243 | 3300013306 | Ga0163162_11248235 | Ga0163162_112482352 | 110 |
| 244 | 3300013306 | Ga0163162_11259090 | Ga0163162_112590902 | 110 |
| 245 | 3300013307 | Ga0157372_10014264 | Ga0157372_100142642 | 110 |
| 246 | 3300013307 | Ga0157372_10627916 | Ga0157372_106279163 | 110 |
| 247 | 3300013308 | Ga0157375_10240923 | Ga0157375_102409231 | 110 |
| 248 | 3300013308 | Ga0157375_11280173 | Ga0157375_112801732 | 110 |
| 249 | 3300013308 | Ga0157375_11658099 | Ga0157375_116580991 | 110 |
| 250 | 3300014325 | Ga0163163_10100505 | Ga0163163_101005052 | 110 |
| 251 | 3300014326 | Ga0157380_10065661 | Ga0157380_100656613 | 110 |
| 252 | 3300014326 | Ga0157380_10512722 | Ga0157380_105127222 | 110 |
| 253 | 3300014326 | Ga0157380_10674492 | Ga0157380_106744922 | 110 |
| 254 | 3300014326 | Ga0157380_11768576 | Ga0157380_117685761 | 110 |
| 255 | 3300014326 | Ga0157380_11801166 | Ga0157380_118011662 | 110 |
| 256 | 3300014968 | Ga0157379_10069302 | Ga0157379_100693022 | 110 |
| 257 | 3300014968 | Ga0157379_10900005 | Ga0157379_109000051 | 110 |
| 258 | 3300014969 | Ga0157376_10013058 | Ga0157376_100130585 | 110 |
| 259 | 3300014969 | Ga0157376_10018124 | Ga0157376_100181242 | 110 |
| 260 | 3300014969 | Ga0157376_10333801 | Ga0157376_103338011 | 110 |
| 261 | 3300014969 | Ga0157376_11935462 | Ga0157376_119354621 | 110 |
| 262 | 3300017792 | Ga0163161_11796965 | Ga0163161_117969651 | 110 |
| 263 | 3300021384 | Ga0213876_10000053 | Ga0213876_100000539 | 110 |
| 264 | 3300025315 | Ga0207697_10035707 | Ga0207697_100357072 | 110 |
| 265 | 3300025321 | Ga0207656_10106994 | Ga0207656_101069941 | 110 |
| 266 | 3300025321 | Ga0207656_10525879 | Ga0207656_105258792 | 110 |
| 267 | 3300025885 | Ga0207653_10052013 | Ga0207653_100520132 | 110 |
| 268 | 3300025899 | Ga0207642_10061054 | Ga0207642_100610542 | 110 |
| 269 | 3300025900 | Ga0207710_10571313 | Ga0207710_105713132 | 110 |
| 270 | 3300025901 | Ga0207688_10327112 | Ga0207688_103271122 | 110 |
| 271 | 3300025907 | Ga0207645_10002686 | Ga0207645_100026869 | 110 |
| 272 | 3300025907 | Ga0207645_10028377 | Ga0207645_100283774 | 110 |
| 273 | 3300025908 | Ga0207643_10095353 | Ga0207643_100953532 | 110 |
| 274 | 3300025909 | Ga0207705_10777818 | Ga0207705_107778181 | 110 |
| 275 | 3300025917 | Ga0207660_10125627 | Ga0207660_101256272 | 110 |
| 276 | 3300025917 | Ga0207660_10376498 | Ga0207660_103764982 | 110 |
| 277 | 3300025920 | Ga0207649_10914596 | Ga0207649_109145961 | 110 |
| 278 | 3300025922 | Ga0207646_10190973 | Ga0207646_101909733 | 110 |
| 279 | 3300025922 | Ga0207646_10913294 | Ga0207646_109132942 | 110 |
| 280 | 3300025923 | Ga0207681_10735644 | Ga0207681_107356442 | 110 |
| 281 | 3300025923 | Ga0207681_11097476 | Ga0207681_110974762 | 110 |
| 282 | 3300025924 | Ga0207694_10094527 | Ga0207694_100945272 | 110 |
| 283 | 3300025925 | Ga0207650_11031841 | Ga0207650_110318412 | 110 |
| 284 | 3300025926 | Ga0207659_10794375 | Ga0207659_107943752 | 110 |
| 285 | 3300025927 | Ga0207687_10339657 | Ga0207687_103396572 | 110 |
| 286 | 3300025928 | Ga0207700_11626567 | Ga0207700_116265671 | 110 |
| 287 | 3300025929 | Ga0207664_10010849 | Ga0207664_100108494 | 110 |
| 288 | 3300025934 | Ga0207686_10013034 | Ga0207686_100130342 | 110 |
| 289 | 3300025934 | Ga0207686_10022214 | Ga0207686_100222143 | 110 |
| 290 | 3300025936 | Ga0207670_10280288 | Ga0207670_102802883 | 110 |
| 291 | 3300025938 | Ga0207704_11161618 | Ga0207704_111616181 | 110 |
| 292 | 3300025940 | Ga0207691_11761127 | Ga0207691_117611272 | 110 |
| 293 | 3300025941 | Ga0207711_10085168 | Ga0207711_100851684 | 110 |
| 294 | 3300025941 | Ga0207711_10284138 | Ga0207711_102841381 | 110 |
| 295 | 3300025942 | Ga0207689_10061406 | Ga0207689_100614062 | 110 |
| 296 | 3300025944 | Ga0207661_10138902 | Ga0207661_101389022 | 110 |
| 297 | 3300025945 | Ga0207679_11961588 | Ga0207679_119615881 | 110 |
| 298 | 3300025960 | Ga0207651_10097693 | Ga0207651_100976931 | 110 |
| 299 | 3300025961 | Ga0207712_10117347 | Ga0207712_101173473 | 110 |
| 300 | 3300025961 | Ga0207712_11668079 | Ga0207712_116680792 | 110 |
| 301 | 3300025981 | Ga0207640_10174465 | Ga0207640_101744652 | 110 |
| 302 | 3300025981 | Ga0207640_10320337 | Ga0207640_103203372 | 110 |
| 303 | 3300025981 | Ga0207640_10378364 | Ga0207640_103783642 | 110 |
| 304 | 3300025986 | Ga0207658_10056651 | Ga0207658_100566512 | 110 |
| 305 | 3300026023 | Ga0207677_10402889 | Ga0207677_104028891 | 110 |
| 306 | 3300026035 | Ga0207703_10007478 | Ga0207703_100074785 | 110 |
| 307 | 3300026035 | Ga0207703_10258113 | Ga0207703_102581131 | 110 |
| 308 | 3300026041 | Ga0207639_11906563 | Ga0207639_119065632 | 110 |
| 309 | 3300026067 | Ga0207678_10689097 | Ga0207678_106890973 | 110 |
| 310 | 3300026067 | Ga0207678_10767941 | Ga0207678_107679411 | 110 |
| 311 | 3300026075 | Ga0207708_10008686 | Ga0207708_100086862 | 110 |
| 312 | 3300026075 | Ga0207708_10126935 | Ga0207708_101269352 | 110 |
| 313 | 3300026075 | Ga0207708_10590789 | Ga0207708_105907892 | 110 |
| 314 | 3300026078 | Ga0207702_10115261 | Ga0207702_101152612 | 110 |
| 315 | 3300026078 | Ga0207702_10725794 | Ga0207702_107257942 | 110 |
| 316 | 3300026088 | Ga0207641_10031579 | Ga0207641_100315792 | 110 |
| 317 | 3300026089 | Ga0207648_10340484 | Ga0207648_103404842 | 110 |
| 318 | 3300026089 | Ga0207648_10828888 | Ga0207648_108288883 | 110 |
| 319 | 3300026089 | Ga0207648_11730532 | Ga0207648_117305322 | 110 |
| 320 | 3300026116 | Ga0207674_10032463 | Ga0207674_100324632 | 110 |
| 321 | 3300026116 | Ga0207674_10788652 | Ga0207674_107886522 | 110 |
| 322 | 3300026118 | Ga0207675_100046521 | Ga0207675_1000465213 | 110 |
| 323 | 3300026118 | Ga0207675_101066693 | Ga0207675_1010666931 | 110 |
| 324 | 3300026118 | Ga0207675_101317855 | Ga0207675_1013178552 | 110 |
| 325 | 3300026121 | Ga0207683_10237410 | Ga0207683_102374102 | 110 |
| 326 | 3300026121 | Ga0207683_10319994 | Ga0207683_103199942 | 110 |
| 327 | 3300026121 | Ga0207683_10394158 | Ga0207683_103941582 | 110 |
| 328 | 3300026142 | Ga0207698_11115995 | Ga0207698_111159952 | 110 |
| 329 | 3300027866 | Ga0209813_10102893 | Ga0209813_101028932 | 110 |
| 330 | 3300027876 | Ga0209974_10057876 | Ga0209974_100578762 | 110 |
| 331 | 3300027876 | Ga0209974_10284681 | Ga0209974_102846811 | 110 |
| 332 | 3300027907 | Ga0207428_10000904 | Ga0207428_1000090418 | 110 |
| 333 | 3300027907 | Ga0207428_10003846 | Ga0207428_100038462 | 110 |
| 334 | 3300027907 | Ga0207428_10118424 | Ga0207428_101184242 | 110 |
| 335 | 3300027907 | Ga0207428_11286282 | Ga0207428_112862822 | 110 |
| 336 | 3300028379 | Ga0268266_10002004 | Ga0268266_100020049 | 110 |
| 337 | 3300028380 | Ga0268265_10424029 | Ga0268265_104240291 | 110 |
| 338 | 3300028380 | Ga0268265_12098367 | Ga0268265_120983672 | 110 |
| 339 | 3300028381 | Ga0268264_10067935 | Ga0268264_100679352 | 110 |
| 340 | 3300030745 | Ga0316182_1222324 | Ga0316182_12223242 | 110 |
| 341 | 3300031548 | Ga0307408_100052122 | Ga0307408_1000521222 | 110 |
| 342 | 3300031548 | Ga0307408_100134895 | Ga0307408_1001348951 | 110 |
| 343 | 3300031548 | Ga0307408_100142490 | Ga0307408_1001424902 | 110 |
| 344 | 3300031548 | Ga0307408_100673499 | Ga0307408_1006734992 | 110 |
| 345 | 3300031548 | Ga0307408_100755788 | Ga0307408_1007557882 | 110 |
| 346 | 3300031731 | Ga0307405_10014948 | Ga0307405_100149483 | 110 |
| 347 | 3300031731 | Ga0307405_11958852 | Ga0307405_119588521 | 110 |
| 348 | 3300031824 | Ga0307413_10606670 | Ga0307413_106066702 | 110 |
| 349 | 3300031824 | Ga0307413_10766796 | Ga0307413_107667961 | 110 |
| 350 | 3300031824 | Ga0307413_12183972 | Ga0307413_121839721 | 110 |
| 351 | 3300031852 | Ga0307410_10094545 | Ga0307410_100945452 | 110 |
| 352 | 3300031852 | Ga0307410_10775155 | Ga0307410_107751552 | 110 |
| 353 | 3300031901 | Ga0307406_10049455 | Ga0307406_100494552 | 110 |
| 354 | 3300031901 | Ga0307406_10369507 | Ga0307406_103695072 | 110 |
| 355 | 3300031901 | Ga0307406_10448163 | Ga0307406_104481632 | 110 |
| 356 | 3300031903 | Ga0307407_10231710 | Ga0307407_102317103 | 110 |
| 357 | 3300031903 | Ga0307407_10925742 | Ga0307407_109257421 | 110 |
| 358 | 3300031911 | Ga0307412_10078618 | Ga0307412_100786182 | 110 |
| 359 | 3300031911 | Ga0307412_10297746 | Ga0307412_102977462 | 110 |
| 360 | 3300031995 | Ga0307409_100129841 | Ga0307409_1001298412 | 110 |
| 361 | 3300031995 | Ga0307409_100774382 | Ga0307409_1007743822 | 110 |
| 362 | 3300032002 | Ga0307416_100041330 | Ga0307416_1000413302 | 110 |
| 363 | 3300032002 | Ga0307416_100062930 | Ga0307416_1000629301 | 110 |
| 364 | 3300032002 | Ga0307416_101121341 | Ga0307416_1011213411 | 110 |
| 365 | 3300032002 | Ga0307416_101698402 | Ga0307416_1016984022 | 110 |
| 366 | 3300032002 | Ga0307416_101929339 | Ga0307416_1019293391 | 110 |
| 367 | 3300032004 | Ga0307414_11576511 | Ga0307414_115765111 | 110 |
| 368 | 3300032004 | Ga0307414_11906378 | Ga0307414_119063781 | 110 |
| 369 | 3300032005 | Ga0307411_10092342 | Ga0307411_100923422 | 110 |
| 370 | 3300032005 | Ga0307411_10106571 | Ga0307411_101065712 | 110 |
| 371 | 3300032005 | Ga0307411_10162993 | Ga0307411_101629932 | 110 |
| 372 | 3300032005 | Ga0307411_10723264 | Ga0307411_107232641 | 110 |
| 373 | 3300032126 | Ga0307415_100237956 | Ga0307415_1002379562 | 110 |
| 374 | 3300032126 | Ga0307415_101462089 | Ga0307415_1014620892 | 110 |
| 375 | 3300035112 | Ga0373932_0034808 | Ga0373932_0034808_943_1275 | 110 |
| 376 | 3300035113 | Ga0373936_0020695 | Ga0373936_0020695_40_390 | 110 |
| 377 | 3300035115 | Ga0373941_0422047 | Ga0373941_0422047_29_382 | 110 |
| 378 | 3300035116 | Ga0373945_0156684 | Ga0373945_0156684_545_895 | 110 |
| 379 | 3300035170 | Ga0373943_0739234 | Ga0373943_0739234_129_461 | 110 |
| 380 | 3300035171 | Ga0373946_0245351 | Ga0373946_0245351_418_750 | 110 |
| 381 | 3300035207 | Ga0373942_0287225 | Ga0373942_0287225_179_511 | 110 |
| 382 | 3300035242 | Ga0373962_0136844 | Ga0373962_0136844_159_512 | 110 |
| 383 | 3300035410 | Ga0373924_0030931 | Ga0373924_0030931_151_495 | 110 |
| 384 | 3300035692 | Ga0373935_1023615 | Ga0373935_1023615_178_510 | 110 |
| 385 | 3300035725 | Ga0373947_0229925 | Ga0373947_0229925_862_1194 | 110 |
| 386 | 3300035725 | Ga0373947_0842714 | Ga0373947_0842714_239_589 | 110 |
| 387 | 3300036401 | Ga0373937_0047362 | Ga0373937_0047362_443_787 | 110 |
| 388 | 3300036401 | Ga0373937_0444920 | Ga0373937_0444920_184_516 | 110 |
| 389 | 3300036401 | Ga0373937_0693139 | Ga0373937_0693139_306_638 | 110 |
| 390 | 3300037068 | Ga0373925_0129584 | Ga0373925_0129584_917_1267 | 110 |
| 391 | 3300037418 | Ga0395900_0984318 | Ga0395900_0984318_193_543 | 110 |
| 392 | 3300037466 | Ga0395898_0342751 | Ga0395898_0342751_868_1218 | 110 |
| 393 | 3300037853 | Ga0436364_1049779 | Ga0436364_1049779_575_919 | 110 |
| 394 | 3300037853 | Ga0436364_1068981 | Ga0436364_1068981_1303_1647 | 110 |
| 395 | 3300037853 | Ga0436364_1203962 | Ga0436364_1203962_324_668 | 110 |
| 396 | 3300038443 | Ga0395901_0902145 | Ga0395901_0902145_481_834 | 110 |
| 397 | 3300039093 | Ga0400489_61415 | Ga0400489_61415_235_582 | 110 |
| 398 | 3300039437 | Ga0436365_0873465 | Ga0436365_0873465_116591_116950 | 110 |
| 399 | 3300039437 | Ga0436365_1795675 | Ga0436365_1795675_2651_2995 | 110 |
| 400 | 3300039438 | Ga0436360_0056218 | Ga0436360_0056218_478_831 | 110 |
| 401 | 3300039438 | Ga0436360_0660040 | Ga0436360_0660040_81_425 | 110 |
| 402 | 3300039453 | Ga0436362_1256871 | Ga0436362_1256871_63_407 | 110 |
| 403 | 3300042003 | Ga0439443_018675 | Ga0439443_018675_299_643 | 110 |
| 404 | 3300042008 | Ga0439450_040495 | Ga0439450_040495_107_460 | 110 |
| 405 | 3300042008 | Ga0439450_111941 | Ga0439450_111941_176_508 | 110 |
| 406 | 3300042015 | Ga0439462_0042339 | Ga0439462_0042339_805_1155 | 110 |
| 407 | 3300042435 | Ga0439434_0204462 | Ga0439434_0204462_246_599 | 110 |
| 408 | 3300042439 | Ga0439464_0083702 | Ga0439464_0083702_436_768 | 110 |
| 409 | 3300042461 | Ga0439460_0098821 | Ga0439460_0098821_28_381 | 110 |
| 410 | 3300042993 | Ga0439440_0244864 | Ga0439440_0244864_152_505 | 110 |
| 411 | 3300044673 | Ga0453683_0918045 | Ga0453683_0918045_147_491 | 110 |
| 412 | 3300044694 | Ga0466963_0592569 | Ga0466963_0592569_330_680 | 110 |
| 413 | 3300044901 | Ga0466960_0858120 | Ga0466960_0858120_104_463 | 110 |
| 414 | 3300045051 | Ga0451576_0467492 | Ga0451576_0467492_178_531 | 110 |
| 415 | 3300045051 | Ga0451576_0620043 | Ga0451576_0620043_611_964 | 110 |
| 416 | 3300045836 | Ga0466958_0954940 | Ga0466958_0954940_63_410 | 110 |
| 417 | 3300046454 | Ga0495592_0671455 | Ga0495592_0671455_201_533 | 110 |
| 418 | 3300046457 | Ga0495590_0430792 | Ga0495590_0430792_89_442 | 110 |
| 419 | 3300046459 | Ga0495629_1079024 | Ga0495629_1079024_32_364 | 110 |
| 420 | 3300046459 | Ga0495629_1128430 | Ga0495629_1128430_14_346 | 110 |
| 421 | 3300046475 | Ga0495639_0570007 | Ga0495639_0570007_177_509 | 110 |
| 422 | 3300046499 | Ga0495594_0147648 | Ga0495594_0147648_247_579 | 110 |
| 423 | 3300046517 | Ga0495630_0867683 | Ga0495630_0867683_320_652 | 110 |
| 424 | 3300046517 | Ga0495630_0889087 | Ga0495630_0889087_70_402 | 110 |
| 425 | 3300046517 | Ga0495630_1148312 | Ga0495630_1148312_27_371 | 110 |
| 426 | 3300046533 | Ga0495640_0459733 | Ga0495640_0459733_151_495 | 110 |
| 427 | 3300046539 | Ga0495621_0036241 | Ga0495621_0036241_1183_1527 | 110 |
| 428 | 3300046642 | Ga0495634_0417538 | Ga0495634_0417538_44_397 | 110 |
| 429 | 3300046663 | Ga0495635_0302816 | Ga0495635_0302816_20_352 | 110 |
| 430 | 3300046681 | Ga0495647_0115600 | Ga0495647_0115600_235_567 | 110 |
| 431 | 3300046683 | Ga0495658_0081509 | Ga0495658_0081509_1232_1564 | 110 |
| 432 | 3300046689 | Ga0495613_0639625 | Ga0495613_0639625_307_639 | 110 |
| 433 | 3300047319 | Ga0495674_0595842 | Ga0495674_0595842_511_843 | 110 |
| 434 | 3300047319 | Ga0495674_1218672 | Ga0495674_1218672_122_454 | 110 |
| 435 | 3300047445 | Ga0495677_0135095 | Ga0495677_0135095_313_657 | 110 |
| 436 | 3300047471 | Ga0495684_0627528 | Ga0495684_0627528_237_569 | 110 |
| 437 | 3300048089 | Ga0495614_0477483 | Ga0495614_0477483_41_373 | 110 |
| 438 | 3300048907 | Ga0496104_0133485 | Ga0496104_0133485_838_1191 | 110 |
| 439 | 3300048909 | Ga0496106_0368116 | Ga0496106_0368116_760_1113 | 110 |
| 440 | 3300048911 | Ga0496108_0840795 | Ga0496108_0840795_227_571 | 110 |
| 441 | 3300048912 | Ga0496109_1603205 | Ga0496109_1603205_199_552 | 110 |
| 442 | 3300048913 | Ga0496110_0795469 | Ga0496110_0795469_430_783 | 110 |
| 443 | 3300048917 | Ga0496114_0079875 | Ga0496114_0079875_2420_2752 | 110 |
| 444 | 3300048917 | Ga0496114_0232402 | Ga0496114_0232402_108_461 | 110 |
| 445 | 3300048929 | Ga0496126_0155949 | Ga0496126_0155949_515_859 | 110 |
| 446 | 3300049514 | Ga0501291_031015 | Ga0501291_031015_213_566 | 110 |
| 447 | 3300049514 | Ga0501291_063948 | Ga0501291_063948_178_531 | 110 |
| 448 | 3300049515 | Ga0501292_024526 | Ga0501292_024526_549_902 | 110 |
| 449 | 3300049515 | Ga0501292_054832 | Ga0501292_054832_189_542 | 110 |
| 450 | 3300049523 | Ga0501300_026510 | Ga0501300_026510_410_763 | 110 |
| 451 | 3300049525 | Ga0501302_025968 | Ga0501302_025968_59_412 | 110 |
| 452 | 3300049572 | Ga0501036_1197660 | Ga0501036_1197660_113_466 | 110 |
| 453 | 3300049584 | Ga0501068_0242977 | Ga0501068_0242977_783_1133 | 110 |
| 454 | 3300049587 | Ga0501071_1145359 | Ga0501071_1145359_92_436 | 110 |
| 455 | 3300049589 | Ga0501073_0245990 | Ga0501073_0245990_431_784 | 110 |
| 456 | 3300049589 | Ga0501073_1082736 | Ga0501073_1082736_70_423 | 110 |
| 457 | 3300049592 | Ga0501076_0298800 | Ga0501076_0298800_247_600 | 110 |
| 458 | 3300049592 | Ga0501076_1058914 | Ga0501076_1058914_116_448 | 110 |
| 459 | 3300049656 | Ga0501209_159522 | Ga0501209_159522_174_527 | 110 |
| 460 | 3300049660 | Ga0501216_193146 | Ga0501216_193146_97_456 | 110 |
| 461 | 3300049668 | Ga0501233_199511 | Ga0501233_199511_156_509 | 110 |
| 462 | 3300049669 | Ga0501235_162348 | Ga0501235_162348_142_495 | 110 |
| 463 | 3300049675 | Ga0501243_054745 | Ga0501243_054745_285_638 | 110 |
| 464 | 3300049679 | Ga0501249_203110 | Ga0501249_203110_54_398 | 110 |
| 465 | 3300049690 | Ga0501261_099648 | Ga0501261_099648_111_470 | 110 |
| 466 | 3300049741 | Ga0501079_0986604 | Ga0501079_0986604_125_478 | 110 |
| 467 | 3300049742 | Ga0501080_0140294 | Ga0501080_0140294_1116_1469 | 110 |
| 468 | 3300049743 | Ga0501081_0197949 | Ga0501081_0197949_516_848 | 110 |
| 469 | 3300049761 | Ga0501264_031214 | Ga0501264_031214_101_433 | 110 |
| 470 | 3300049768 | Ga0501271_012620 | Ga0501271_012620_455_808 | 110 |
| 471 | 3300049775 | Ga0501279_032980 | Ga0501279_032980_40_393 | 110 |
| 472 | 3300049778 | Ga0501282_046777 | Ga0501282_046777_18_368 | 110 |
| 473 | 3300049779 | Ga0501283_125780 | Ga0501283_125780_21_374 | 110 |
| 474 | 3300049851 | Ga0501212_043153 | Ga0501212_043153_25_357 | 110 |
| 475 | 3300050489 | nmdc:mga03683_19891_c1 | nmdc:mga03683_19891_c1_683_1036 | 110 |
| 476 | 3300050490 | nmdc:mga03n38_902415_c1 | nmdc:mga03n38_902415_c1_79_411 | 110 |
| 477 | 3300050491 | nmdc:mga00v17_19857_c1 | nmdc:mga00v17_19857_c1_1956_2309 | 110 |
| 478 | 3300050491 | nmdc:mga00v17_199779_c1 | nmdc:mga00v17_199779_c1_936_1280 | 110 |
| 479 | 3300050491 | nmdc:mga00v17_22070_c1 | nmdc:mga00v17_22070_c1_2208_2561 | 110 |
| 480 | 3300050491 | nmdc:mga00v17_47829_c1 | nmdc:mga00v17_47829_c1_2138_2491 | 110 |
| 481 | 3300050491 | nmdc:mga00v17_712512_c1 | nmdc:mga00v17_712512_c1_174_527 | 110 |
| 482 | 3300050491 | nmdc:mga00v17_981998_c1 | nmdc:mga00v17_981998_c1_23_376 | 110 |
| 483 | 3300050492 | nmdc:mga0yw44_30560_c1 | nmdc:mga0yw44_30560_c1_1237_1590 | 110 |
| 484 | 3300050493 | nmdc:mga0k408_107679_c1 | nmdc:mga0k408_107679_c1_852_1184 | 110 |
| 485 | 3300050493 | nmdc:mga0k408_1798_c1 | nmdc:mga0k408_1798_c1_9361_9714 | 110 |
| 486 | 3300050493 | nmdc:mga0k408_61717_c1 | nmdc:mga0k408_61717_c1_1277_1630 | 110 |
| 487 | 3300050493 | nmdc:mga0k408_63436_c1 | nmdc:mga0k408_63436_c1_738_1091 | 110 |
| 488 | 3300050494 | nmdc:mga06z11_342078_c1 | nmdc:mga06z11_342078_c1_518_871 | 110 |
| 489 | 3300050494 | nmdc:mga06z11_345615_c1 | nmdc:mga06z11_345615_c1_71_424 | 110 |
| 490 | 3300050494 | nmdc:mga06z11_7398_c1 | nmdc:mga06z11_7398_c1_1213_1566 | 110 |
| 491 | 3300050494 | nmdc:mga06z11_87703_c2 | nmdc:mga06z11_87703_c2_913_1266 | 110 |
| 492 | 3300050495 | nmdc:mga04h51_66895_c1 | nmdc:mga04h51_66895_c1_302_655 | 110 |
| 493 | 3300050496 | nmdc:mga07m45_1478_c1 | nmdc:mga07m45_1478_c1_4977_5330 | 110 |
| 494 | 3300050496 | nmdc:mga07m45_327341_c1 | nmdc:mga07m45_327341_c1_492_845 | 110 |
| 495 | 3300050496 | nmdc:mga07m45_8178_c1 | nmdc:mga07m45_8178_c1_1619_1972 | 110 |
| 496 | 3300050507 | nmdc:mga05p37_1286827_c1 | nmdc:mga05p37_1286827_c1_203_556 | 110 |
| 497 | 3300050507 | nmdc:mga05p37_17344_c1 | nmdc:mga05p37_17344_c1_1716_2048 | 110 |
| 498 | 3300050507 | nmdc:mga05p37_1859999_c1 | nmdc:mga05p37_1859999_c1_101_445 | 110 |
| 499 | 3300050507 | nmdc:mga05p37_288056_c1 | nmdc:mga05p37_288056_c1_10_342 | 110 |
| 500 | 3300050507 | nmdc:mga05p37_545_c1 | nmdc:mga05p37_545_c1_34268_34621 | 110 |
| 501 | 3300050508 | nmdc:mga09592_102477_c1 | nmdc:mga09592_102477_c1_350_694 | 110 |
| 502 | 3300050508 | nmdc:mga09592_25730_c1 | nmdc:mga09592_25730_c1_2885_3238 | 110 |
| 503 | 3300050508 | nmdc:mga09592_32073_c1 | nmdc:mga09592_32073_c1_3410_3763 | 110 |
| 504 | 3300050508 | nmdc:mga09592_417444_c1 | nmdc:mga09592_417444_c1_253_585 | 110 |
| 505 | 3300050508 | nmdc:mga09592_427704_c1 | nmdc:mga09592_427704_c1_697_1050 | 110 |
| 506 | 3300050508 | nmdc:mga09592_472484_c1 | nmdc:mga09592_472484_c1_291_629 | 110 |
| 507 | 3300050508 | nmdc:mga09592_71987_c1 | nmdc:mga09592_71987_c1_1601_1954 | 110 |
| 508 | 3300050508 | nmdc:mga09592_912617_c1 | nmdc:mga09592_912617_c1_164_517 | 110 |
| 509 | 3300050509 | nmdc:mga0qj67_106013_c1 | nmdc:mga0qj67_106013_c1_870_1223 | 110 |
| 510 | 3300050509 | nmdc:mga0qj67_10926_c1 | nmdc:mga0qj67_10926_c1_770_1123 | 110 |
| 511 | 3300050509 | nmdc:mga0qj67_126155_c1 | nmdc:mga0qj67_126155_c1_816_1148 | 110 |
| 512 | 3300050509 | nmdc:mga0qj67_16027_c1 | nmdc:mga0qj67_16027_c1_3436_3789 | 110 |
| 513 | 3300050509 | nmdc:mga0qj67_583607_c1 | nmdc:mga0qj67_583607_c1_279_617 | 110 |
| 514 | 3300050510 | nmdc:mga06r32_1155659_c1 | nmdc:mga06r32_1155659_c1_174_506 | 110 |
| 515 | 3300050510 | nmdc:mga06r32_1242158_c1 | nmdc:mga06r32_1242158_c1_172_525 | 110 |
| 516 | 3300050510 | nmdc:mga06r32_1430286_c1 | nmdc:mga06r32_1430286_c1_45_383 | 110 |
| 517 | 3300050510 | nmdc:mga06r32_5060_c1 | nmdc:mga06r32_5060_c1_3627_3980 | 110 |
| 518 | 3300050510 | nmdc:mga06r32_539600_c1 | nmdc:mga06r32_539600_c1_385_738 | 110 |
| 519 | 3300050510 | nmdc:mga06r32_690401_c1 | nmdc:mga06r32_690401_c1_360_713 | 110 |
| 520 | 3300050510 | nmdc:mga06r32_7050_c1 | nmdc:mga06r32_7050_c1_3757_4110 | 110 |
| 521 | 3300050510 | nmdc:mga06r32_71221_c1 | nmdc:mga06r32_71221_c1_2239_2592 | 110 |
| 522 | 3300050510 | nmdc:mga06r32_884481_c1 | nmdc:mga06r32_884481_c1_171_524 | 110 |
| 523 | 3300050510 | nmdc:mga06r32_98200_c1 | nmdc:mga06r32_98200_c1_2444_2794 | 110 |
| 524 | 3300050511 | nmdc:mga08y16_12333_c1 | nmdc:mga08y16_12333_c1_2636_2989 | 110 |
| 525 | 3300050511 | nmdc:mga08y16_1362564_c1 | nmdc:mga08y16_1362564_c1_259_591 | 110 |
| 526 | 3300050511 | nmdc:mga08y16_148167_c1 | nmdc:mga08y16_148167_c1_886_1218 | 110 |
| 527 | 3300050511 | nmdc:mga08y16_193917_c1 | nmdc:mga08y16_193917_c1_1441_1773 | 110 |
| 528 | 3300050511 | nmdc:mga08y16_222306_c1 | nmdc:mga08y16_222306_c1_992_1345 | 110 |
| 529 | 3300050511 | nmdc:mga08y16_248683_c1 | nmdc:mga08y16_248683_c1_372_704 | 110 |
| 530 | 3300050511 | nmdc:mga08y16_52673_c1 | nmdc:mga08y16_52673_c1_3081_3425 | 110 |
| 531 | 3300050511 | nmdc:mga08y16_56728_c1 | nmdc:mga08y16_56728_c1_607_939 | 110 |
| 532 | 3300050511 | nmdc:mga08y16_657243_c1 | nmdc:mga08y16_657243_c1_182_514 | 110 |
| 533 | 3300050512 | nmdc:mga0n895_1061531_c1 | nmdc:mga0n895_1061531_c1_290_634 | 110 |
| 534 | 3300050512 | nmdc:mga0n895_140267_c1 | nmdc:mga0n895_140267_c1_1914_2267 | 110 |
| 535 | 3300050512 | nmdc:mga0n895_218723_c1 | nmdc:mga0n895_218723_c1_814_1146 | 110 |
| 536 | 3300050512 | nmdc:mga0n895_3905_c1 | nmdc:mga0n895_3905_c1_7110_7463 | 110 |
| 537 | 3300050512 | nmdc:mga0n895_391044_c1 | nmdc:mga0n895_391044_c1_960_1310 | 110 |
| 538 | 3300050512 | nmdc:mga0n895_61609_c1 | nmdc:mga0n895_61609_c1_3165_3521 | 110 |
| 539 | 3300050512 | nmdc:mga0n895_89560_c1 | nmdc:mga0n895_89560_c1_95_448 | 110 |
| 540 | 3300050513 | nmdc:mga0rr50_144255_c1 | nmdc:mga0rr50_144255_c1_937_1269 | 110 |
| 541 | 3300050513 | nmdc:mga0rr50_14435_c1 | nmdc:mga0rr50_14435_c1_1225_1581 | 110 |
| 542 | 3300050513 | nmdc:mga0rr50_875278_c1 | nmdc:mga0rr50_875278_c1_182_532 | 110 |
| 543 | 3300050514 | nmdc:mga08x19_344235_c1 | nmdc:mga08x19_344235_c1_278_628 | 110 |
| 544 | 3300050515 | nmdc:mga0a205_12238_c1 | nmdc:mga0a205_12238_c1_722_1054 | 110 |
| 545 | 3300050515 | nmdc:mga0a205_123625_c1 | nmdc:mga0a205_123625_c1_750_1103 | 110 |
| 546 | 3300050515 | nmdc:mga0a205_2111_c1 | nmdc:mga0a205_2111_c1_4982_5335 | 110 |
| 547 | 3300050515 | nmdc:mga0a205_7948_c1 | nmdc:mga0a205_7948_c1_1179_1511 | 110 |
| 548 | 3300050515 | nmdc:mga0a205_8259_c1 | nmdc:mga0a205_8259_c1_1536_1892 | 110 |
| 549 | 3300050515 | nmdc:mga0a205_8985_c1 | nmdc:mga0a205_8985_c1_6088_6441 | 110 |
| 550 | 3300053085 | Ga0495619_0570196 | Ga0495619_0570196_164_496 | 110 |
| 551 | 3300054114 | Ga0501084_1840976 | Ga0501084_1840976_120_473 | 110 |
| 552 | 3300059421 | Ga0590071_056443 | Ga0590071_056443_308_652 | 110 |
| 553 | 3300061734 | Ga0530510_0277912 | Ga0530510_0277912_673_1005 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9237 | 5 | 102 |
| 5x11-assembly1.cif.gz_A | crystal structure of bacillus subtilis padr in complex with operator dna | 0.9158 | 10 | 89 |
| 5x11-assembly3.cif.gz_D | crystal structure of bacillus subtilis padr in complex with operator dna | 0.9144 | 10 | 89 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9105 | 5 | 102 |
| 2co5-assembly1.cif.gz_A | f93 from stiv, a winged-helix dna-binding protein | 0.906 | 13 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5x11A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9158 | 10 | 89 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9105 | 5 | 102 | 1.10.10.10 |
| 2co5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.906 | 13 | 98 | 1.10.10.10 |
| 5dymA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8941 | 12 | 105 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8934 | 15 | 80 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534KDG9-F1-model_v4 | PadR family transcriptional regulator | 0.9806 | 8 | 104 |
|
| AF-D0LFT7-F1-model_v4 | Transcriptional regulator, PadR-like family | 0.976 | 12 | 106 |
|
| AF-A0A7W1QDS0-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9705 | 7 | 106 |
|
| AF-A0A7V9BJQ0-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9703 | 1 | 81 |
|
| AF-A0A843T8Z1-F1-model_v4 | PadR family transcriptional regulator | 0.9695 | 7 | 110 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar