F462838

General Info

Members Datasets Scaffolds Average Seq Length
553 268 553 114

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100255921|Ga0068856_1002559211
Length 140
Sequence MMAIRRNQRIGLSFPDCYWYICVSHIWRPNLSNAEFKKGSAEMLVLSVLEARDRHGYDICKRIEQLSGGELVFNVATFYPLLYKLEERGLIQGRWLEKAGERRRRFYKITAQGRKALLQHRLAFDKFVAAVAQVLGGENA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
223 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
224 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
225 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
232 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
233 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
242 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
243 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
244 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
245 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
246 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 0
Rhizoplane 1.27
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10151282 3300005293 Bacteria 1726
2 Ga0065715_10232421 3300005293 Bacteria 1206
3 Ga0065715_10630225 3300005293 Unclassified 690
4 Ga0065707_10165770 3300005295 Bacteria 1524
5 Ga0065707_10705893 3300005295 Unclassified 637
6 Ga0070658_10020369 3300005327 Bacteria 5315
7 Ga0070676_10010438 3300005328 Bacteria 5039
8 Ga0070676_10796337 3300005328 Bacteria 697
9 Ga0070676_11359398 3300005328 Unclassified 544
10 Ga0070683_100073495 3300005329 Bacteria 3192
11 Ga0070690_100499047 3300005330 Bacteria 910
12 Ga0070677_10254781 3300005333 Bacteria 873
13 Ga0068869_100048654 3300005334 Bacteria 3067
14 Ga0070666_10038610 3300005335 Unclassified 3178
15 Ga0070680_100249954 3300005336 Bacteria 1499
16 Ga0068868_100167660 3300005338 Unclassified 1817
17 Ga0068868_100372524 3300005338 Bacteria 1227
18 Ga0070689_101043340 3300005340 Bacteria 729
19 Ga0070661_100051858 3300005344 Bacteria 3003
20 Ga0070692_10261133 3300005345 Unclassified 1041
21 Ga0070668_100467430 3300005347 Bacteria 1087
22 Ga0070669_100590529 3300005353 Bacteria 929
23 Ga0070669_101545734 3300005353 Unclassified 577
24 Ga0070675_100736020 3300005354 Bacteria 899
25 Ga0070675_101607068 3300005354 Bacteria 600
26 Ga0070673_100006695 3300005364 Bacteria 7512
27 Ga0070673_101395383 3300005364 Unclassified 659
28 Ga0070659_100856854 3300005366 Unclassified 792
29 Ga0070659_101963839 3300005366 Unclassified 525
30 Ga0070667_100469446 3300005367 Unclassified 1151
31 Ga0070703_10410395 3300005406 Bacteria 592
32 Ga0070713_100757986 3300005436 Bacteria 929
33 Ga0070701_10820936 3300005438 Bacteria 636
34 Ga0070701_10970857 3300005438 Viruses 591
35 Ga0070705_100637545 3300005440 Bacteria 829
36 Ga0070700_100020782 3300005441 Bacteria 3810
37 Ga0070700_100074985 3300005441 Bacteria 2169
38 Ga0070694_100331651 3300005444 Bacteria 1174
39 Ga0070694_100522607 3300005444 Bacteria 947
40 Ga0070694_100942818 3300005444 Bacteria 714
41 Ga0070694_101214466 3300005444 Unclassified 632
42 Ga0070708_100362632 3300005445 Bacteria 1366
43 Ga0070663_101962102 3300005455 Unclassified 526
44 Ga0070678_100088911 3300005456 Bacteria 2363
45 Ga0070678_101826811 3300005456 Unclassified 573
46 Ga0070662_100487610 3300005457 Bacteria 1027
47 Ga0068867_100772678 3300005459 Bacteria 854
48 Ga0068867_101610825 3300005459 Bacteria 607
49 Ga0070707_100209053 3300005468 Unclassified 1902
50 Ga0070707_100460933 3300005468 Unclassified 1232
51 Ga0070707_101487047 3300005468 Unclassified 644
52 Ga0070698_100608922 3300005471 Bacteria 1033
53 Ga0070698_100959436 3300005471 Bacteria 802
54 Ga0070698_101131489 3300005471 Unclassified 732
55 Ga0070698_101794582 3300005471 Bacteria 566
56 Ga0070699_100097650 3300005518 Bacteria 2573
57 Ga0070699_101940781 3300005518 Bacteria 538
58 Ga0070684_100096776 3300005535 Bacteria 2632
59 Ga0070684_100436752 3300005535 Unclassified 1209
60 Ga0068853_101717479 3300005539 Unclassified 608
61 Ga0070696_100262728 3300005546 Bacteria 1309
62 Ga0070696_100712813 3300005546 Bacteria 819
63 Ga0070696_100826919 3300005546 Unclassified 764
64 Ga0070665_100008991 3300005548 Bacteria 10116
65 Ga0070704_100073781 3300005549 Bacteria 2487
66 Ga0070704_100475495 3300005549 Unclassified 1080
67 Ga0070704_100534186 3300005549 Bacteria 1023
68 Ga0068855_100671224 3300005563 Bacteria 1111
69 Ga0070664_100163808 3300005564 Bacteria 1969
70 Ga0070664_100769870 3300005564 Bacteria 899
71 Ga0068857_100038806 3300005577 Bacteria 4216
72 Ga0068854_100061421 3300005578 Bacteria 2722
73 Ga0068854_100065880 3300005578 Bacteria 2634
74 Ga0068856_100020395 3300005614 Bacteria 6437
75 Ga0068856_100255921 3300005614 Unclassified 1766
76 Ga0070702_101345737 3300005615 Bacteria 582
77 Ga0068859_100011477 3300005617 Bacteria 8908
78 Ga0068864_101277140 3300005618 Bacteria 734
79 Ga0068866_10198013 3300005718 Bacteria 1198
80 Ga0068866_10393216 3300005718 Unclassified 892
81 Ga0068861_101209967 3300005719 Bacteria 731
82 Ga0068861_102334252 3300005719 Unclassified 537
83 Ga0068861_102505919 3300005719 Bacteria 519
84 Ga0068870_10357633 3300005840 Bacteria 939
85 Ga0068863_100045716 3300005841 Bacteria 4155
86 Ga0068858_100009368 3300005842 Bacteria 9344
87 Ga0068858_100050631 3300005842 Bacteria 3844
88 Ga0068860_100783576 3300005843 Bacteria 966
89 Ga0068860_101617690 3300005843 Bacteria 670
90 Ga0068860_101620985 3300005843 Unclassified 669
91 Ga0068862_101315235 3300005844 Unclassified 724
92 Ga0068862_101620612 3300005844 Bacteria 654
93 Ga0068862_101848890 3300005844 Unclassified 613
94 Ga0070717_11199345 3300006028 Unclassified 691
95 Ga0075365_10024998 3300006038 Bacteria 3775
96 Ga0075368_10009062 3300006042 Bacteria 3572
97 Ga0075368_10010609 3300006042 Bacteria 3334
98 Ga0075364_10003177 3300006051 Bacteria 9304
99 Ga0075364_10050416 3300006051 Bacteria 2717
100 Ga0075364_10090918 3300006051 Bacteria 2025
101 Ga0075364_10111917 3300006051 Bacteria 1823
102 Ga0075364_10220068 3300006051 Bacteria 1288
103 Ga0075364_10664849 3300006051 Bacteria 711
104 Ga0075362_10012413 3300006177 Bacteria 3384
105 Ga0075367_10009888 3300006178 Bacteria 4995
106 Ga0075367_10096443 3300006178 Bacteria 1804
107 Ga0075367_10097431 3300006178 Bacteria 1794
108 Ga0075366_10002880 3300006195 Bacteria 8926
109 Ga0075366_10008557 3300006195 Bacteria 5693
110 Ga0075366_10106137 3300006195 Bacteria 1688
111 Ga0075366_10171506 3300006195 Unclassified 1316
112 Ga0097621_100019736 3300006237 Bacteria 5182
113 Ga0097621_100137861 3300006237 Unclassified 2083
114 Ga0097621_102033566 3300006237 Bacteria 549
115 Ga0075370_10000584 3300006353 Bacteria 14059
116 Ga0075370_10001862 3300006353 Bacteria 9456
117 Ga0068871_100023787 3300006358 Bacteria 4743
118 Ga0068871_100613099 3300006358 Bacteria 990
119 Ga0075428_100001990 3300006844 Bacteria 22025
120 Ga0075428_100005939 3300006844 Bacteria 13568
121 Ga0075428_100041386 3300006844 Bacteria 5068
122 Ga0075428_100072908 3300006844 Bacteria 3750
123 Ga0075428_100085251 3300006844 Bacteria 3445
124 Ga0075430_100004736 3300006846 Bacteria 11445
125 Ga0075430_100007248 3300006846 Bacteria 9366
126 Ga0075430_100016154 3300006846 Bacteria 6358
127 Ga0075430_100330961 3300006846 Unclassified 1258
128 Ga0075431_100003585 3300006847 Bacteria 15045
129 Ga0075431_100075641 3300006847 Unclassified 3475
130 Ga0075431_100086786 3300006847 Bacteria 3229
131 Ga0075431_100102179 3300006847 Unclassified 2958
132 Ga0075431_100241461 3300006847 Bacteria 1838
133 Ga0075431_100295093 3300006847 Bacteria 1639
134 Ga0075431_100383577 3300006847 Bacteria 1409
135 Ga0075431_100643328 3300006847 Bacteria 1041
136 Ga0075431_100994110 3300006847 Bacteria 806
137 Ga0075433_10000075 3300006852 Bacteria 44503
138 Ga0075433_10001854 3300006852 Bacteria 15883
139 Ga0075433_10007792 3300006852 Bacteria 8513
140 Ga0075433_10041922 3300006852 Bacteria 3968
141 Ga0075433_10050580 3300006852 Bacteria 3618
142 Ga0075433_10177771 3300006852 Bacteria 1893
143 Ga0075433_11848346 3300006852 Unclassified 519
144 Ga0075434_100001073 3300006871 Bacteria 22364
145 Ga0075434_100003008 3300006871 Bacteria 14991
146 Ga0075434_100045713 3300006871 Unclassified 4344
147 Ga0075434_100211738 3300006871 Bacteria 1958
148 Ga0075434_100331057 3300006871 Bacteria 1543
149 Ga0075434_100389666 3300006871 Bacteria 1414
150 Ga0075434_100953867 3300006871 Bacteria 872
151 Ga0075434_101731702 3300006871 Bacteria 632
152 Ga0075429_100001556 3300006880 Bacteria 18839
153 Ga0075429_100002803 3300006880 Bacteria 14753
154 Ga0075429_100013365 3300006880 Bacteria 7119
155 Ga0075429_100138033 3300006880 Bacteria 2134
156 Ga0075429_100226790 3300006880 Bacteria 1636
157 Ga0075429_100442247 3300006880 Unclassified 1139
158 Ga0075429_100481982 3300006880 Unclassified 1087
159 Ga0075429_100722294 3300006880 Bacteria 873
160 Ga0075429_100815970 3300006880 Unclassified 817
161 Ga0075429_101080970 3300006880 Bacteria 701
162 Ga0068865_100017194 3300006881 Bacteria 4647
163 Ga0068865_100023269 3300006881 Unclassified 4055
164 Ga0068865_101051974 3300006881 Bacteria 715
165 Ga0068865_101179003 3300006881 Bacteria 677
166 Ga0068865_101709769 3300006881 Unclassified 567
167 Ga0097620_100011477 3300006931 Bacteria 8908
168 Ga0097620_101383341 3300006931 Bacteria 776
169 Ga0075435_100006592 3300007076 Bacteria 8220
170 Ga0075435_100021078 3300007076 Bacteria 5007
171 Ga0075435_100136780 3300007076 Bacteria 2053
172 Ga0075435_100143993 3300007076 Bacteria 2001
173 Ga0099795_10012572 3300007788 Bacteria 2571
174 Ga0105240_10139630 3300009093 Bacteria 2898
175 Ga0105240_10545653 3300009093 Bacteria 1283
176 Ga0105240_10625872 3300009093 Bacteria 1182
177 Ga0111539_10001047 3300009094 Bacteria 36383
178 Ga0111539_10010457 3300009094 Bacteria 11679
179 Ga0111539_10014457 3300009094 Bacteria 9850
180 Ga0111539_10015839 3300009094 Bacteria 9366
181 Ga0111539_10293640 3300009094 Bacteria 1891
182 Ga0111539_10317063 3300009094 Unclassified 1814
183 Ga0111539_10329138 3300009094 Bacteria 1778
184 Ga0111539_11037614 3300009094 Bacteria 953
185 Ga0111539_11379368 3300009094 Bacteria 818
186 Ga0111539_12237828 3300009094 Bacteria 634
187 Ga0105245_10010723 3300009098 Bacteria 7973
188 Ga0105245_10062864 3300009098 Bacteria 3351
189 Ga0105247_10756680 3300009101 Bacteria 737
190 Ga0105247_10776826 3300009101 Unclassified 728
191 Ga0114129_10016308 3300009147 Bacteria 10575
192 Ga0114129_10024373 3300009147 Bacteria 8574
193 Ga0114129_10100856 3300009147 Bacteria 3994
194 Ga0114129_10156357 3300009147 Bacteria 3117
195 Ga0114129_10158775 3300009147 Bacteria 3091
196 Ga0114129_10546738 3300009147 Bacteria 1506
197 Ga0114129_10571324 3300009147 Bacteria 1468
198 Ga0114129_11113868 3300009147 Bacteria 988
199 Ga0114129_11891608 3300009147 Bacteria 724
200 Ga0114129_12305103 3300009147 Bacteria 646
201 Ga0114129_12335930 3300009147 Unclassified 641
202 Ga0114129_12505328 3300009147 Unclassified 617
203 Ga0114129_12651737 3300009147 Bacteria 598
204 Ga0105241_10115131 3300009174 Bacteria 2158
205 Ga0105241_11114628 3300009174 Bacteria 744
206 Ga0105241_11728746 3300009174 Unclassified 608
207 Ga0105242_10001476 3300009176 Bacteria 18511
208 Ga0105242_10006429 3300009176 Bacteria 9050
209 Ga0105242_11224551 3300009176 Unclassified 771
210 Ga0105248_10062130 3300009177 Bacteria 4195
211 Ga0105248_10199998 3300009177 Bacteria 2251
212 Ga0105237_10205086 3300009545 Unclassified 1972
213 Ga0105238_10706823 3300009551 Bacteria 1020
214 Ga0105249_10364865 3300009553 Unclassified 1466
215 Ga0105249_10926315 3300009553 Bacteria 939
216 Ga0105249_10969792 3300009553 Unclassified 918
217 Ga0105249_11440606 3300009553 Bacteria 761
218 Ga0105249_12388355 3300009553 Bacteria 601
219 Ga0105249_12957273 3300009553 Bacteria 545
220 Ga0105239_10014649 3300010375 Bacteria 8694
221 Ga0105239_10076579 3300010375 Unclassified 3679
222 Ga0105246_10958619 3300011119 Bacteria 771
223 Ga0105246_12358726 3300011119 Unclassified 521
224 Ga0157373_10627238 3300013100 Unclassified 784
225 Ga0157373_10634659 3300013100 Unclassified 779
226 Ga0157371_10664414 3300013102 Unclassified 778
227 Ga0157370_10274287 3300013104 Unclassified 1558
228 Ga0157369_10091776 3300013105 Bacteria 3242
229 Ga0157374_10005661 3300013296 Bacteria 10535
230 Ga0157374_12533198 3300013296 Unclassified 540
231 Ga0157378_11074373 3300013297 Unclassified 841
232 Ga0157378_12026094 3300013297 Unclassified 626
233 Ga0163162_10000933 3300013306 Bacteria 27147
234 Ga0163162_11248235 3300013306 Bacteria 844
235 Ga0163162_11259090 3300013306 Bacteria 840
236 Ga0157372_10014264 3300013307 Bacteria 8495
237 Ga0157372_10627916 3300013307 Unclassified 1252
238 Ga0157375_10240923 3300013308 Bacteria 1968
239 Ga0157375_11280173 3300013308 Bacteria 862
240 Ga0157375_11658099 3300013308 Bacteria 757
241 Ga0163163_10100505 3300014325 Bacteria 2914
242 Ga0157380_10065661 3300014326 Bacteria 2917
243 Ga0157380_10512722 3300014326 Bacteria 1168
244 Ga0157380_10674492 3300014326 Bacteria 1035
245 Ga0157380_11768576 3300014326 Unclassified 677
246 Ga0157380_11801166 3300014326 Unclassified 671
247 Ga0157379_10069302 3300014968 Bacteria 3154
248 Ga0157379_10900005 3300014968 Unclassified 839
249 Ga0157376_10013058 3300014969 Bacteria 6186
250 Ga0157376_10018124 3300014969 Bacteria 5388
251 Ga0157376_10333801 3300014969 Bacteria 1445
252 Ga0157376_11935462 3300014969 Unclassified 627
253 Ga0163161_11796965 3300017792 Bacteria 545
254 Ga0213876_10000053 3300021384 Bacteria 142404
255 Ga0207697_10035707 3300025315 Bacteria 2035
256 Ga0207656_10106994 3300025321 Bacteria 1288
257 Ga0207656_10525879 3300025321 Bacteria 601
258 Ga0207653_10052013 3300025885 Bacteria 1365
259 Ga0207642_10061054 3300025899 Bacteria 1751
260 Ga0207710_10571313 3300025900 Bacteria 590
261 Ga0207688_10327112 3300025901 Bacteria 941
262 Ga0207645_10002686 3300025907 Bacteria 13855
263 Ga0207645_10028377 3300025907 Bacteria 3613
264 Ga0207643_10095353 3300025908 Bacteria 1739
265 Ga0207705_10777818 3300025909 Unclassified 743
266 Ga0207660_10125627 3300025917 Bacteria 1948
267 Ga0207660_10376498 3300025917 Unclassified 1141
268 Ga0207649_10914596 3300025920 Unclassified 688
269 Ga0207646_10190973 3300025922 Bacteria 1850
270 Ga0207646_10913294 3300025922 Unclassified 778
271 Ga0207681_10735644 3300025923 Unclassified 822
272 Ga0207681_11097476 3300025923 Bacteria 668
273 Ga0207694_10094527 3300025924 Bacteria 2362
274 Ga0207650_11031841 3300025925 Unclassified 700
275 Ga0207659_10794375 3300025926 Bacteria 813
276 Ga0207687_10339657 3300025927 Unclassified 1221
277 Ga0207700_11626567 3300025928 Unclassified 571
278 Ga0207664_10010849 3300025929 Bacteria 6450
279 Ga0207686_10013034 3300025934 Bacteria 4590
280 Ga0207686_10022214 3300025934 Bacteria 3652
281 Ga0207670_10280288 3300025936 Bacteria 1299
282 Ga0207704_11161618 3300025938 Bacteria 657
283 Ga0207691_11761127 3300025940 Bacteria 500
284 Ga0207711_10085168 3300025941 Bacteria 2769
285 Ga0207711_10284138 3300025941 Bacteria 1524
286 Ga0207689_10061406 3300025942 Bacteria 3090
287 Ga0207661_10138902 3300025944 Bacteria 2089
288 Ga0207679_11961588 3300025945 Unclassified 533
289 Ga0207651_10097693 3300025960 Bacteria 2169
290 Ga0207712_10117347 3300025961 Unclassified 2007
291 Ga0207712_11668079 3300025961 Unclassified 571
292 Ga0207640_10174465 3300025981 Bacteria 1605
293 Ga0207640_10320337 3300025981 Bacteria 1234
294 Ga0207640_10378364 3300025981 Bacteria 1146
295 Ga0207658_10056651 3300025986 Bacteria 2910
296 Ga0207677_10402889 3300026023 Unclassified 1161
297 Ga0207703_10007478 3300026035 Bacteria 8677
298 Ga0207703_10258113 3300026035 Bacteria 1574
299 Ga0207639_11906563 3300026041 Unclassified 555
300 Ga0207678_10689097 3300026067 Unclassified 899
301 Ga0207678_10767941 3300026067 Bacteria 850
302 Ga0207708_10008686 3300026075 Bacteria 7519
303 Ga0207708_10126935 3300026075 Bacteria 1992
304 Ga0207708_10590789 3300026075 Bacteria 940
305 Ga0207702_10115261 3300026078 Bacteria 2396
306 Ga0207702_10725794 3300026078 Bacteria 980
307 Ga0207641_10031579 3300026088 Bacteria 4394
308 Ga0207648_10340484 3300026089 Unclassified 1350
309 Ga0207648_10828888 3300026089 Bacteria 862
310 Ga0207648_11730532 3300026089 Unclassified 587
311 Ga0207674_10032463 3300026116 Bacteria 5476
312 Ga0207674_10788652 3300026116 Bacteria 917
313 Ga0207675_100046521 3300026118 Bacteria 4054
314 Ga0207675_101066693 3300026118 Bacteria 827
315 Ga0207675_101317855 3300026118 Bacteria 742
316 Ga0207683_10237410 3300026121 Bacteria 1663
317 Ga0207683_10319994 3300026121 Bacteria 1421
318 Ga0207683_10394158 3300026121 Bacteria 1273
319 Ga0207698_11115995 3300026142 Unclassified 802
320 Ga0209813_10102893 3300027866 Bacteria 974
321 Ga0209974_10057876 3300027876 Bacteria 1310
322 Ga0209974_10284681 3300027876 Unclassified 629
323 Ga0207428_10000904 3300027907 Bacteria 33138
324 Ga0207428_10003846 3300027907 Bacteria 14398
325 Ga0207428_10118424 3300027907 Bacteria 2032
326 Ga0207428_11286282 3300027907 Bacteria 507
327 Ga0268266_10002004 3300028379 Bacteria 22766
328 Ga0268265_10424029 3300028380 Unclassified 1236
329 Ga0268265_12098367 3300028380 Unclassified 572
330 Ga0268264_10067935 3300028381 Bacteria 3010
331 Ga0316182_1222324 3300030745 Unclassified 743
332 Ga0307408_100052122 3300031548 Bacteria 2950
333 Ga0307408_100134895 3300031548 Bacteria 1930
334 Ga0307408_100142490 3300031548 Unclassified 1883
335 Ga0307408_100673499 3300031548 Unclassified 927
336 Ga0307408_100755788 3300031548 Bacteria 879
337 Ga0307405_10014948 3300031731 Bacteria 4190
338 Ga0307405_11958852 3300031731 Unclassified 524
339 Ga0307413_10606670 3300031824 Bacteria 897
340 Ga0307413_10766796 3300031824 Bacteria 808
341 Ga0307413_12183972 3300031824 Bacteria 502
342 Ga0307410_10094545 3300031852 Bacteria 2129
343 Ga0307410_10775155 3300031852 Bacteria 814
344 Ga0307406_10049455 3300031901 Unclassified 2661
345 Ga0307406_10369507 3300031901 Bacteria 1127
346 Ga0307406_10448163 3300031901 Bacteria 1035
347 Ga0307407_10231710 3300031903 Bacteria 1255
348 Ga0307407_10925742 3300031903 Bacteria 670
349 Ga0307412_10078618 3300031911 Bacteria 2273
350 Ga0307412_10297746 3300031911 Bacteria 1273
351 Ga0307409_100129841 3300031995 Bacteria 2151
352 Ga0307409_100774382 3300031995 Unclassified 965
353 Ga0307416_100041330 3300032002 Unclassified 3590
354 Ga0307416_100062930 3300032002 Bacteria 3036
355 Ga0307416_101121341 3300032002 Unclassified 891
356 Ga0307416_101698402 3300032002 Bacteria 736
357 Ga0307416_101929339 3300032002 Bacteria 694
358 Ga0307414_11576511 3300032004 Bacteria 612
359 Ga0307414_11906378 3300032004 Unclassified 555
360 Ga0307411_10092342 3300032005 Bacteria 2117
361 Ga0307411_10106571 3300032005 Unclassified 1995
362 Ga0307411_10162993 3300032005 Bacteria 1673
363 Ga0307411_10723264 3300032005 Bacteria 869
364 Ga0307415_100237956 3300032126 Unclassified 1471
365 Ga0307415_101462089 3300032126 Bacteria 653
366 Ga0373932_0034808 3300035112 Bacteria 1421
367 Ga0373936_0020695 3300035113 Bacteria 2557
368 Ga0373941_0422047 3300035115 Bacteria 555
369 Ga0373945_0156684 3300035116 Bacteria 926
370 Ga0373943_0739234 3300035170 Unclassified 584
371 Ga0373946_0245351 3300035171 Unclassified 872
372 Ga0373942_0287225 3300035207 Bacteria 568
373 Ga0373962_0136844 3300035242 Bacteria 793
374 Ga0373924_0030931 3300035410 Bacteria 2149
375 Ga0373935_1023615 3300035692 Unclassified 614
376 Ga0373947_0229925 3300035725 Bacteria 1221
377 Ga0373947_0842714 3300035725 Unclassified 626
378 Ga0373937_0047362 3300036401 Unclassified 3934
379 Ga0373937_0444920 3300036401 Bacteria 1230
380 Ga0373937_0693139 3300036401 Bacteria 965
381 Ga0373925_0129584 3300037068 Bacteria 1965
382 Ga0395900_0984318 3300037418 Bacteria 764
383 Ga0395898_0342751 3300037466 Bacteria 1425
384 Ga0436364_1049779 3300037853 Bacteria 1467
385 Ga0436364_1068981 3300037853 Unclassified 3017
386 Ga0436364_1203962 3300037853 Unclassified 864
387 Ga0395901_0902145 3300038443 Bacteria 866
388 Ga0400489_61415 3300039093 Unclassified 1313
389 Ga0436365_0873465 3300039437 Bacteria 246686
390 Ga0436365_1795675 3300039437 Plasmid 3883
391 Ga0436360_0056218 3300039438 Bacteria 1803
392 Ga0436360_0660040 3300039438 Unclassified 682
393 Ga0436362_1256871 3300039453 Unclassified 642
394 Ga0439443_018675 3300042003 Bacteria 1075
395 Ga0439443_034099 3300042003 Bacteria 849
396 Ga0439450_040495 3300042008 Unclassified 1080
397 Ga0439450_111941 3300042008 Bacteria 698
398 Ga0439462_0042339 3300042015 Bacteria 1217
399 Ga0439434_0204462 3300042435 Unclassified 667
400 Ga0439464_0083702 3300042439 Bacteria 955
401 Ga0439460_0098821 3300042461 Unclassified 935
402 Ga0439440_0244864 3300042993 Unclassified 544
403 Ga0453683_0918045 3300044673 Bacteria 579
404 Ga0466963_0592569 3300044694 Bacteria 783
405 Ga0466960_0858120 3300044901 Bacteria 552
406 Ga0451576_0467492 3300045051 Bacteria 1324
407 Ga0451576_0620043 3300045051 Unclassified 1137
408 Ga0466958_0954940 3300045836 Unclassified 559
409 Ga0495592_0671455 3300046454 Bacteria 626
410 Ga0495590_0430792 3300046457 Bacteria 508
411 Ga0495629_1079024 3300046459 Unclassified 520
412 Ga0495629_1128430 3300046459 Unclassified 506
413 Ga0495639_0570007 3300046475 Unclassified 581
414 Ga0495594_0147648 3300046499 Unclassified 1335
415 Ga0495630_0867683 3300046517 Bacteria 688
416 Ga0495630_0889087 3300046517 Unclassified 679
417 Ga0495630_1148312 3300046517 Unclassified 588
418 Ga0495640_0459733 3300046533 Unclassified 777
419 Ga0495621_0036241 3300046539 Bacteria 1711
420 Ga0495634_0417538 3300046642 Unclassified 795
421 Ga0495635_0302816 3300046663 Unclassified 1072
422 Ga0495647_0115600 3300046681 Unclassified 1124
423 Ga0495658_0081509 3300046683 Bacteria 1900
424 Ga0495613_0639625 3300046689 Unclassified 705
425 Ga0495674_0595842 3300047319 Unclassified 876
426 Ga0495674_1218672 3300047319 Bacteria 568
427 Ga0495677_0135095 3300047445 Bacteria 945
428 Ga0495684_0627528 3300047471 Bacteria 722
429 Ga0495614_0477483 3300048089 Unclassified 592
430 Ga0496104_0133485 3300048907 Unclassified 2385
431 Ga0496106_0368116 3300048909 Unclassified 1155
432 Ga0496108_0840795 3300048911 Bacteria 790
433 Ga0496109_1603205 3300048912 Bacteria 585
434 Ga0496110_0795469 3300048913 Bacteria 850
435 Ga0496114_0079875 3300048917 Bacteria 2762
436 Ga0496114_0232402 3300048917 Bacteria 1620
437 Ga0496126_0155949 3300048929 Bacteria 1954
438 Ga0501291_031015 3300049514 Bacteria 901
439 Ga0501291_063948 3300049514 Bacteria 699
440 Ga0501292_024526 3300049515 Unclassified 990
441 Ga0501292_054832 3300049515 Bacteria 713
442 Ga0501300_026510 3300049523 Bacteria 851
443 Ga0501302_025968 3300049525 Unclassified 533
444 Ga0501036_1197660 3300049572 Unclassified 619
445 Ga0501068_0242977 3300049584 Bacteria 1146
446 Ga0501071_1145359 3300049587 Bacteria 601
447 Ga0501073_0245990 3300049589 Bacteria 1235
448 Ga0501073_1082736 3300049589 Unclassified 551
449 Ga0501076_0298800 3300049592 Bacteria 1320
450 Ga0501076_1058914 3300049592 Bacteria 668
451 Ga0501209_159522 3300049656 Bacteria 682
452 Ga0501216_193146 3300049660 Bacteria 501
453 Ga0501233_199511 3300049668 Bacteria 582
454 Ga0501235_162348 3300049669 Unclassified 585
455 Ga0501243_054745 3300049675 Bacteria 727
456 Ga0501249_203110 3300049679 Bacteria 521
457 Ga0501261_099648 3300049690 Bacteria 551
458 Ga0501079_0986604 3300049741 Bacteria 663
459 Ga0501080_0140294 3300049742 Bacteria 2235
460 Ga0501081_0197949 3300049743 Unclassified 1457
461 Ga0501264_031214 3300049761 Unclassified 614
462 Ga0501271_012620 3300049768 Unclassified 917
463 Ga0501279_032980 3300049775 Bacteria 773
464 Ga0501282_046777 3300049778 Bacteria 527
465 Ga0501283_125780 3300049779 Unclassified 517
466 Ga0501212_043153 3300049851 Bacteria 750
467 nmdc:mga03683_19891_c1 3300050489 Bacteria 2569
468 nmdc:mga03n38_902415_c1 3300050490 Bacteria 519
469 nmdc:mga00v17_19857_c1 3300050491 Bacteria 3842
470 nmdc:mga00v17_199779_c1 3300050491 Bacteria 1292
471 nmdc:mga00v17_22070_c1 3300050491 Bacteria 3668
472 nmdc:mga00v17_47829_c1 3300050491 Bacteria 2591
473 nmdc:mga00v17_712512_c1 3300050491 Bacteria 643
474 nmdc:mga00v17_981998_c1 3300050491 Unclassified 532
475 nmdc:mga0yw44_30560_c1 3300050492 Bacteria 3123
476 nmdc:mga0k408_107679_c1 3300050493 Bacteria 1646
477 nmdc:mga0k408_1798_c1 3300050493 Bacteria 11496
478 nmdc:mga0k408_61717_c1 3300050493 Bacteria 2179
479 nmdc:mga0k408_63436_c1 3300050493 Bacteria 2149
480 nmdc:mga06z11_342078_c1 3300050494 Bacteria 895
481 nmdc:mga06z11_345615_c1 3300050494 Bacteria 890
482 nmdc:mga06z11_7398_c1 3300050494 Bacteria 4514
483 nmdc:mga06z11_87703_c2 3300050494 Bacteria 1389
484 nmdc:mga04h51_66895_c1 3300050495 Bacteria 1246
485 nmdc:mga07m45_1478_c1 3300050496 Bacteria 10792
486 nmdc:mga07m45_327341_c1 3300050496 Bacteria 891
487 nmdc:mga07m45_8178_c1 3300050496 Bacteria 5367
488 nmdc:mga05p37_1286827_c1 3300050507 Unclassified 747
489 nmdc:mga05p37_17344_c1 3300050507 Bacteria 8685
490 nmdc:mga05p37_1859999_c1 3300050507 Unclassified 577
491 nmdc:mga05p37_288056_c1 3300050507 Bacteria 1956
492 nmdc:mga05p37_545_c1 3300050507 Bacteria 41442
493 nmdc:mga09592_102477_c1 3300050508 Bacteria 2452
494 nmdc:mga09592_25730_c1 3300050508 Bacteria 4872
495 nmdc:mga09592_32073_c1 3300050508 Bacteria 4379
496 nmdc:mga09592_417444_c1 3300050508 Bacteria 1159
497 nmdc:mga09592_427704_c1 3300050508 Bacteria 1143
498 nmdc:mga09592_472484_c1 3300050508 Bacteria 1081
499 nmdc:mga09592_659298_c1 3300050508 Unclassified 893
500 nmdc:mga09592_71987_c1 3300050508 Unclassified 2935
501 nmdc:mga09592_912617_c1 3300050508 Bacteria 738
502 nmdc:mga09592_92548_c1 3300050508 Bacteria 2584
503 nmdc:mga0qj67_106013_c1 3300050509 Bacteria 2268
504 nmdc:mga0qj67_10926_c1 3300050509 Bacteria 6794
505 nmdc:mga0qj67_126155_c1 3300050509 Bacteria 2071
506 nmdc:mga0qj67_16027_c1 3300050509 Bacteria 5676
507 nmdc:mga0qj67_49284_c1 3300050509 Bacteria 3329
508 nmdc:mga0qj67_583607_c1 3300050509 Unclassified 895
509 nmdc:mga0qj67_623556_c1 3300050509 Bacteria 861
510 nmdc:mga0qj67_725592_c1 3300050509 Unclassified 789
511 nmdc:mga06r32_1155659_c1 3300050510 Unclassified 722
512 nmdc:mga06r32_1242158_c1 3300050510 Bacteria 690
513 nmdc:mga06r32_1430286_c1 3300050510 Unclassified 633
514 nmdc:mga06r32_213964_c1 3300050510 Bacteria 1915
515 nmdc:mga06r32_5060_c1 3300050510 Bacteria 11874
516 nmdc:mga06r32_539600_c1 3300050510 Bacteria 1141
517 nmdc:mga06r32_690401_c1 3300050510 Bacteria 987
518 nmdc:mga06r32_7050_c1 3300050510 Bacteria 10109
519 nmdc:mga06r32_71221_c1 3300050510 Bacteria 3364
520 nmdc:mga06r32_884481_c1 3300050510 Bacteria 850
521 nmdc:mga06r32_98200_c1 3300050510 Bacteria 2871
522 nmdc:mga08y16_12333_c1 3300050511 Bacteria 8988
523 nmdc:mga08y16_1362564_c1 3300050511 Unclassified 674
524 nmdc:mga08y16_148167_c1 3300050511 Bacteria 2439
525 nmdc:mga08y16_193917_c1 3300050511 Unclassified 2106
526 nmdc:mga08y16_222306_c1 3300050511 Unclassified 1955
527 nmdc:mga08y16_248683_c1 3300050511 Unclassified 1837
528 nmdc:mga08y16_52673_c1 3300050511 Bacteria 4258
529 nmdc:mga08y16_56728_c1 3300050511 Unclassified 4093
530 nmdc:mga08y16_657243_c1 3300050511 Bacteria 1052
531 nmdc:mga0n895_1061531_c1 3300050512 Bacteria 789
532 nmdc:mga0n895_140267_c1 3300050512 Bacteria 2445
533 nmdc:mga0n895_218723_c1 3300050512 Bacteria 1934
534 nmdc:mga0n895_3905_c1 3300050512 Bacteria 12112
535 nmdc:mga0n895_391044_c1 3300050512 Bacteria 1407
536 nmdc:mga0n895_61609_c1 3300050512 Bacteria 3705
537 nmdc:mga0n895_89560_c1 3300050512 Unclassified 3078
538 nmdc:mga0rr50_144255_c1 3300050513 Bacteria 1918
539 nmdc:mga0rr50_14435_c1 3300050513 Bacteria 5182
540 nmdc:mga0rr50_875278_c1 3300050513 Bacteria 766
541 nmdc:mga08x19_344235_c1 3300050514 Bacteria 1040
542 nmdc:mga0a205_12238_c1 3300050515 Bacteria 7933
543 nmdc:mga0a205_123625_c1 3300050515 Unclassified 2487
544 nmdc:mga0a205_168123_c1 3300050515 Bacteria 2088
545 nmdc:mga0a205_2111_c1 3300050515 Bacteria 17434
546 nmdc:mga0a205_7948_c1 3300050515 Bacteria 9632
547 nmdc:mga0a205_8259_c1 3300050515 Bacteria 9463
548 nmdc:mga0a205_8985_c1 3300050515 Bacteria 9106
549 Ga0495619_0570196 3300053085 Unclassified 776
550 Ga0500641_0008417 3300053096 Bacteria 3681
551 Ga0501084_1840976 3300054114 Unclassified 505
552 Ga0590071_056443 3300059421 Bacteria 956
553 Ga0530510_0277912 3300061734 Bacteria 1250

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100499047 Ga0070690_1004990472 105
2 3300005335 Ga0070666_10038610 Ga0070666_100386104 105
3 3300005367 Ga0070667_100469446 Ga0070667_1004694462 105
4 3300005459 Ga0068867_100772678 Ga0068867_1007726782 105
5 3300005535 Ga0070684_100436752 Ga0070684_1004367521 105
6 3300011119 Ga0105246_12358726 Ga0105246_123587261 105
7 3300050508 nmdc:mga09592_92548_c1 nmdc:mga09592_92548_c1_1626_1943 105
8 3300050509 nmdc:mga0qj67_725592_c1 nmdc:mga0qj67_725592_c1_212_529 105
9 3300050510 nmdc:mga06r32_213964_c1 nmdc:mga06r32_213964_c1_648_965 105
10 3300005406 Ga0070703_10410395 Ga0070703_104103952 106
11 3300050509 nmdc:mga0qj67_49284_c1 nmdc:mga0qj67_49284_c1_1998_2345 108
12 3300006847 Ga0075431_100075641 Ga0075431_1000756412 109
13 3300006880 Ga0075429_100442247 Ga0075429_1004422472 109
14 3300013296 Ga0157374_12533198 Ga0157374_125331981 109
15 3300042003 Ga0439443_034099 Ga0439443_034099_44_373 109
16 3300050508 nmdc:mga09592_659298_c1 nmdc:mga09592_659298_c1_292_630 109
17 3300050509 nmdc:mga0qj67_623556_c1 nmdc:mga0qj67_623556_c1_347_676 109
18 3300050515 nmdc:mga0a205_168123_c1 nmdc:mga0a205_168123_c1_985_1320 109
19 3300053096 Ga0500641_0008417 Ga0500641_0008417_441_779 109
20 3300005293 Ga0065715_10151282 Ga0065715_101512822 110
21 3300005293 Ga0065715_10232421 Ga0065715_102324212 110
22 3300005293 Ga0065715_10630225 Ga0065715_106302251 110
23 3300005295 Ga0065707_10165770 Ga0065707_101657703 110
24 3300005295 Ga0065707_10705893 Ga0065707_107058931 110
25 3300005327 Ga0070658_10020369 Ga0070658_100203694 110
26 3300005328 Ga0070676_10010438 Ga0070676_100104383 110
27 3300005328 Ga0070676_10796337 Ga0070676_107963371 110
28 3300005328 Ga0070676_11359398 Ga0070676_113593981 110
29 3300005329 Ga0070683_100073495 Ga0070683_1000734952 110
30 3300005333 Ga0070677_10254781 Ga0070677_102547812 110
31 3300005334 Ga0068869_100048654 Ga0068869_1000486542 110
32 3300005336 Ga0070680_100249954 Ga0070680_1002499541 110
33 3300005338 Ga0068868_100167660 Ga0068868_1001676601 110
34 3300005338 Ga0068868_100372524 Ga0068868_1003725242 110
35 3300005340 Ga0070689_101043340 Ga0070689_1010433402 110
36 3300005344 Ga0070661_100051858 Ga0070661_1000518582 110
37 3300005345 Ga0070692_10261133 Ga0070692_102611332 110
38 3300005347 Ga0070668_100467430 Ga0070668_1004674301 110
39 3300005353 Ga0070669_100590529 Ga0070669_1005905292 110
40 3300005353 Ga0070669_101545734 Ga0070669_1015457341 110
41 3300005354 Ga0070675_100736020 Ga0070675_1007360201 110
42 3300005354 Ga0070675_101607068 Ga0070675_1016070681 110
43 3300005364 Ga0070673_100006695 Ga0070673_1000066955 110
44 3300005364 Ga0070673_101395383 Ga0070673_1013953831 110
45 3300005366 Ga0070659_100856854 Ga0070659_1008568542 110
46 3300005366 Ga0070659_101963839 Ga0070659_1019638391 110
47 3300005436 Ga0070713_100757986 Ga0070713_1007579861 110
48 3300005438 Ga0070701_10820936 Ga0070701_108209361 110
49 3300005438 Ga0070701_10970857 Ga0070701_109708572 110
50 3300005440 Ga0070705_100637545 Ga0070705_1006375452 110
51 3300005441 Ga0070700_100020782 Ga0070700_1000207822 110
52 3300005441 Ga0070700_100074985 Ga0070700_1000749852 110
53 3300005444 Ga0070694_100331651 Ga0070694_1003316511 110
54 3300005444 Ga0070694_100522607 Ga0070694_1005226072 110
55 3300005444 Ga0070694_100942818 Ga0070694_1009428182 110
56 3300005444 Ga0070694_101214466 Ga0070694_1012144662 110
57 3300005445 Ga0070708_100362632 Ga0070708_1003626322 110
58 3300005455 Ga0070663_101962102 Ga0070663_1019621021 110
59 3300005456 Ga0070678_100088911 Ga0070678_1000889113 110
60 3300005456 Ga0070678_101826811 Ga0070678_1018268112 110
61 3300005457 Ga0070662_100487610 Ga0070662_1004876102 110
62 3300005459 Ga0068867_101610825 Ga0068867_1016108251 110
63 3300005468 Ga0070707_100209053 Ga0070707_1002090531 110
64 3300005468 Ga0070707_100460933 Ga0070707_1004609331 110
65 3300005468 Ga0070707_101487047 Ga0070707_1014870471 110
66 3300005471 Ga0070698_100608922 Ga0070698_1006089222 110
67 3300005471 Ga0070698_100959436 Ga0070698_1009594361 110
68 3300005471 Ga0070698_101131489 Ga0070698_1011314892 110
69 3300005471 Ga0070698_101794582 Ga0070698_1017945821 110
70 3300005518 Ga0070699_100097650 Ga0070699_1000976502 110
71 3300005518 Ga0070699_101940781 Ga0070699_1019407812 110
72 3300005535 Ga0070684_100096776 Ga0070684_1000967765 110
73 3300005539 Ga0068853_101717479 Ga0068853_1017174792 110
74 3300005546 Ga0070696_100262728 Ga0070696_1002627282 110
75 3300005546 Ga0070696_100712813 Ga0070696_1007128132 110
76 3300005546 Ga0070696_100826919 Ga0070696_1008269191 110
77 3300005548 Ga0070665_100008991 Ga0070665_1000089915 110
78 3300005549 Ga0070704_100073781 Ga0070704_1000737814 110
79 3300005549 Ga0070704_100475495 Ga0070704_1004754951 110
80 3300005549 Ga0070704_100534186 Ga0070704_1005341862 110
81 3300005563 Ga0068855_100671224 Ga0068855_1006712242 110
82 3300005564 Ga0070664_100163808 Ga0070664_1001638082 110
83 3300005564 Ga0070664_100769870 Ga0070664_1007698701 110
84 3300005577 Ga0068857_100038806 Ga0068857_1000388065 110
85 3300005578 Ga0068854_100061421 Ga0068854_1000614212 110
86 3300005578 Ga0068854_100065880 Ga0068854_1000658802 110
87 3300005614 Ga0068856_100020395 Ga0068856_1000203956 110
88 3300005614 Ga0068856_100255921 Ga0068856_1002559211 110
89 3300005615 Ga0070702_101345737 Ga0070702_1013457371 110
90 3300005617 Ga0068859_100011477 Ga0068859_1000114776 110
91 3300005618 Ga0068864_101277140 Ga0068864_1012771402 110
92 3300005718 Ga0068866_10198013 Ga0068866_101980132 110
93 3300005718 Ga0068866_10393216 Ga0068866_103932162 110
94 3300005719 Ga0068861_101209967 Ga0068861_1012099671 110
95 3300005719 Ga0068861_102334252 Ga0068861_1023342521 110
96 3300005719 Ga0068861_102505919 Ga0068861_1025059191 110
97 3300005840 Ga0068870_10357633 Ga0068870_103576332 110
98 3300005841 Ga0068863_100045716 Ga0068863_1000457162 110
99 3300005842 Ga0068858_100009368 Ga0068858_1000093683 110
100 3300005842 Ga0068858_100050631 Ga0068858_1000506313 110
101 3300005843 Ga0068860_100783576 Ga0068860_1007835762 110
102 3300005843 Ga0068860_101617690 Ga0068860_1016176901 110
103 3300005843 Ga0068860_101620985 Ga0068860_1016209851 110
104 3300005844 Ga0068862_101315235 Ga0068862_1013152352 110
105 3300005844 Ga0068862_101620612 Ga0068862_1016206121 110
106 3300005844 Ga0068862_101848890 Ga0068862_1018488902 110
107 3300006028 Ga0070717_11199345 Ga0070717_111993452 110
108 3300006038 Ga0075365_10024998 Ga0075365_100249982 110
109 3300006042 Ga0075368_10009062 Ga0075368_100090622 110
110 3300006042 Ga0075368_10010609 Ga0075368_100106092 110
111 3300006051 Ga0075364_10003177 Ga0075364_100031773 110
112 3300006051 Ga0075364_10050416 Ga0075364_100504162 110
113 3300006051 Ga0075364_10090918 Ga0075364_100909182 110
114 3300006051 Ga0075364_10111917 Ga0075364_101119172 110
115 3300006051 Ga0075364_10220068 Ga0075364_102200681 110
116 3300006051 Ga0075364_10664849 Ga0075364_106648492 110
117 3300006177 Ga0075362_10012413 Ga0075362_100124132 110
118 3300006178 Ga0075367_10009888 Ga0075367_100098883 110
119 3300006178 Ga0075367_10096443 Ga0075367_100964432 110
120 3300006178 Ga0075367_10097431 Ga0075367_100974312 110
121 3300006195 Ga0075366_10002880 Ga0075366_100028802 110
122 3300006195 Ga0075366_10008557 Ga0075366_100085573 110
123 3300006195 Ga0075366_10106137 Ga0075366_101061372 110
124 3300006195 Ga0075366_10171506 Ga0075366_101715062 110
125 3300006237 Ga0097621_100019736 Ga0097621_1000197365 110
126 3300006237 Ga0097621_100137861 Ga0097621_1001378612 110
127 3300006237 Ga0097621_102033566 Ga0097621_1020335662 110
128 3300006353 Ga0075370_10000584 Ga0075370_100005843 110
129 3300006353 Ga0075370_10001862 Ga0075370_100018625 110
130 3300006358 Ga0068871_100023787 Ga0068871_1000237874 110
131 3300006358 Ga0068871_100613099 Ga0068871_1006130992 110
132 3300006844 Ga0075428_100001990 Ga0075428_1000019908 110
133 3300006844 Ga0075428_100005939 Ga0075428_1000059398 110
134 3300006844 Ga0075428_100041386 Ga0075428_1000413864 110
135 3300006844 Ga0075428_100072908 Ga0075428_1000729084 110
136 3300006844 Ga0075428_100085251 Ga0075428_1000852512 110
137 3300006846 Ga0075430_100004736 Ga0075430_10000473612 110
138 3300006846 Ga0075430_100007248 Ga0075430_1000072485 110
139 3300006846 Ga0075430_100016154 Ga0075430_1000161544 110
140 3300006846 Ga0075430_100330961 Ga0075430_1003309611 110
141 3300006847 Ga0075431_100003585 Ga0075431_10000358511 110
142 3300006847 Ga0075431_100086786 Ga0075431_1000867862 110
143 3300006847 Ga0075431_100102179 Ga0075431_1001021792 110
144 3300006847 Ga0075431_100241461 Ga0075431_1002414612 110
145 3300006847 Ga0075431_100295093 Ga0075431_1002950931 110
146 3300006847 Ga0075431_100383577 Ga0075431_1003835773 110
147 3300006847 Ga0075431_100643328 Ga0075431_1006433282 110
148 3300006847 Ga0075431_100994110 Ga0075431_1009941102 110
149 3300006852 Ga0075433_10000075 Ga0075433_100000759 110
150 3300006852 Ga0075433_10001854 Ga0075433_100018548 110
151 3300006852 Ga0075433_10007792 Ga0075433_100077922 110
152 3300006852 Ga0075433_10041922 Ga0075433_100419222 110
153 3300006852 Ga0075433_10050580 Ga0075433_100505802 110
154 3300006852 Ga0075433_10177771 Ga0075433_101777712 110
155 3300006852 Ga0075433_11848346 Ga0075433_118483461 110
156 3300006871 Ga0075434_100001073 Ga0075434_1000010737 110
157 3300006871 Ga0075434_100003008 Ga0075434_1000030086 110
158 3300006871 Ga0075434_100045713 Ga0075434_1000457133 110
159 3300006871 Ga0075434_100211738 Ga0075434_1002117382 110
160 3300006871 Ga0075434_100331057 Ga0075434_1003310572 110
161 3300006871 Ga0075434_100389666 Ga0075434_1003896662 110
162 3300006871 Ga0075434_100953867 Ga0075434_1009538672 110
163 3300006871 Ga0075434_101731702 Ga0075434_1017317022 110
164 3300006880 Ga0075429_100001556 Ga0075429_1000015566 110
165 3300006880 Ga0075429_100002803 Ga0075429_1000028035 110
166 3300006880 Ga0075429_100013365 Ga0075429_1000133653 110
167 3300006880 Ga0075429_100138033 Ga0075429_1001380332 110
168 3300006880 Ga0075429_100226790 Ga0075429_1002267902 110
169 3300006880 Ga0075429_100481982 Ga0075429_1004819822 110
170 3300006880 Ga0075429_100722294 Ga0075429_1007222942 110
171 3300006880 Ga0075429_100815970 Ga0075429_1008159702 110
172 3300006880 Ga0075429_101080970 Ga0075429_1010809701 110
173 3300006881 Ga0068865_100017194 Ga0068865_1000171942 110
174 3300006881 Ga0068865_100023269 Ga0068865_1000232691 110
175 3300006881 Ga0068865_101051974 Ga0068865_1010519742 110
176 3300006881 Ga0068865_101179003 Ga0068865_1011790032 110
177 3300006881 Ga0068865_101709769 Ga0068865_1017097692 110
178 3300006931 Ga0097620_100011477 Ga0097620_1000114776 110
179 3300006931 Ga0097620_101383341 Ga0097620_1013833412 110
180 3300007076 Ga0075435_100006592 Ga0075435_1000065927 110
181 3300007076 Ga0075435_100021078 Ga0075435_1000210782 110
182 3300007076 Ga0075435_100136780 Ga0075435_1001367802 110
183 3300007076 Ga0075435_100143993 Ga0075435_1001439932 110
184 3300007788 Ga0099795_10012572 Ga0099795_100125722 110
185 3300009093 Ga0105240_10139630 Ga0105240_101396302 110
186 3300009093 Ga0105240_10545653 Ga0105240_105456532 110
187 3300009093 Ga0105240_10625872 Ga0105240_106258722 110
188 3300009094 Ga0111539_10001047 Ga0111539_100010479 110
189 3300009094 Ga0111539_10010457 Ga0111539_1001045710 110
190 3300009094 Ga0111539_10014457 Ga0111539_100144575 110
191 3300009094 Ga0111539_10015839 Ga0111539_100158392 110
192 3300009094 Ga0111539_10293640 Ga0111539_102936402 110
193 3300009094 Ga0111539_10317063 Ga0111539_103170632 110
194 3300009094 Ga0111539_10329138 Ga0111539_103291382 110
195 3300009094 Ga0111539_11037614 Ga0111539_110376141 110
196 3300009094 Ga0111539_11379368 Ga0111539_113793682 110
197 3300009094 Ga0111539_12237828 Ga0111539_122378281 110
198 3300009098 Ga0105245_10010723 Ga0105245_100107233 110
199 3300009098 Ga0105245_10062864 Ga0105245_100628642 110
200 3300009101 Ga0105247_10756680 Ga0105247_107566802 110
201 3300009101 Ga0105247_10776826 Ga0105247_107768262 110
202 3300009147 Ga0114129_10016308 Ga0114129_100163087 110
203 3300009147 Ga0114129_10024373 Ga0114129_1002437310 110
204 3300009147 Ga0114129_10100856 Ga0114129_101008563 110
205 3300009147 Ga0114129_10156357 Ga0114129_101563572 110
206 3300009147 Ga0114129_10158775 Ga0114129_101587752 110
207 3300009147 Ga0114129_10546738 Ga0114129_105467381 110
208 3300009147 Ga0114129_10571324 Ga0114129_105713241 110
209 3300009147 Ga0114129_11113868 Ga0114129_111138681 110
210 3300009147 Ga0114129_11891608 Ga0114129_118916082 110
211 3300009147 Ga0114129_12305103 Ga0114129_123051031 110
212 3300009147 Ga0114129_12335930 Ga0114129_123359301 110
213 3300009147 Ga0114129_12505328 Ga0114129_125053281 110
214 3300009147 Ga0114129_12651737 Ga0114129_126517371 110
215 3300009174 Ga0105241_10115131 Ga0105241_101151312 110
216 3300009174 Ga0105241_11114628 Ga0105241_111146282 110
217 3300009174 Ga0105241_11728746 Ga0105241_117287461 110
218 3300009176 Ga0105242_10001476 Ga0105242_100014764 110
219 3300009176 Ga0105242_10006429 Ga0105242_100064296 110
220 3300009176 Ga0105242_11224551 Ga0105242_112245511 110
221 3300009177 Ga0105248_10062130 Ga0105248_100621302 110
222 3300009177 Ga0105248_10199998 Ga0105248_101999982 110
223 3300009545 Ga0105237_10205086 Ga0105237_102050862 110
224 3300009551 Ga0105238_10706823 Ga0105238_107068232 110
225 3300009553 Ga0105249_10364865 Ga0105249_103648653 110
226 3300009553 Ga0105249_10926315 Ga0105249_109263152 110
227 3300009553 Ga0105249_10969792 Ga0105249_109697922 110
228 3300009553 Ga0105249_11440606 Ga0105249_114406061 110
229 3300009553 Ga0105249_12388355 Ga0105249_123883552 110
230 3300009553 Ga0105249_12957273 Ga0105249_129572731 110
231 3300010375 Ga0105239_10014649 Ga0105239_100146492 110
232 3300010375 Ga0105239_10076579 Ga0105239_100765794 110
233 3300011119 Ga0105246_10958619 Ga0105246_109586192 110
234 3300013100 Ga0157373_10627238 Ga0157373_106272381 110
235 3300013100 Ga0157373_10634659 Ga0157373_106346592 110
236 3300013102 Ga0157371_10664414 Ga0157371_106644141 110
237 3300013104 Ga0157370_10274287 Ga0157370_102742872 110
238 3300013105 Ga0157369_10091776 Ga0157369_100917763 110
239 3300013296 Ga0157374_10005661 Ga0157374_100056618 110
240 3300013297 Ga0157378_11074373 Ga0157378_110743732 110
241 3300013297 Ga0157378_12026094 Ga0157378_120260942 110
242 3300013306 Ga0163162_10000933 Ga0163162_100009338 110
243 3300013306 Ga0163162_11248235 Ga0163162_112482352 110
244 3300013306 Ga0163162_11259090 Ga0163162_112590902 110
245 3300013307 Ga0157372_10014264 Ga0157372_100142642 110
246 3300013307 Ga0157372_10627916 Ga0157372_106279163 110
247 3300013308 Ga0157375_10240923 Ga0157375_102409231 110
248 3300013308 Ga0157375_11280173 Ga0157375_112801732 110
249 3300013308 Ga0157375_11658099 Ga0157375_116580991 110
250 3300014325 Ga0163163_10100505 Ga0163163_101005052 110
251 3300014326 Ga0157380_10065661 Ga0157380_100656613 110
252 3300014326 Ga0157380_10512722 Ga0157380_105127222 110
253 3300014326 Ga0157380_10674492 Ga0157380_106744922 110
254 3300014326 Ga0157380_11768576 Ga0157380_117685761 110
255 3300014326 Ga0157380_11801166 Ga0157380_118011662 110
256 3300014968 Ga0157379_10069302 Ga0157379_100693022 110
257 3300014968 Ga0157379_10900005 Ga0157379_109000051 110
258 3300014969 Ga0157376_10013058 Ga0157376_100130585 110
259 3300014969 Ga0157376_10018124 Ga0157376_100181242 110
260 3300014969 Ga0157376_10333801 Ga0157376_103338011 110
261 3300014969 Ga0157376_11935462 Ga0157376_119354621 110
262 3300017792 Ga0163161_11796965 Ga0163161_117969651 110
263 3300021384 Ga0213876_10000053 Ga0213876_100000539 110
264 3300025315 Ga0207697_10035707 Ga0207697_100357072 110
265 3300025321 Ga0207656_10106994 Ga0207656_101069941 110
266 3300025321 Ga0207656_10525879 Ga0207656_105258792 110
267 3300025885 Ga0207653_10052013 Ga0207653_100520132 110
268 3300025899 Ga0207642_10061054 Ga0207642_100610542 110
269 3300025900 Ga0207710_10571313 Ga0207710_105713132 110
270 3300025901 Ga0207688_10327112 Ga0207688_103271122 110
271 3300025907 Ga0207645_10002686 Ga0207645_100026869 110
272 3300025907 Ga0207645_10028377 Ga0207645_100283774 110
273 3300025908 Ga0207643_10095353 Ga0207643_100953532 110
274 3300025909 Ga0207705_10777818 Ga0207705_107778181 110
275 3300025917 Ga0207660_10125627 Ga0207660_101256272 110
276 3300025917 Ga0207660_10376498 Ga0207660_103764982 110
277 3300025920 Ga0207649_10914596 Ga0207649_109145961 110
278 3300025922 Ga0207646_10190973 Ga0207646_101909733 110
279 3300025922 Ga0207646_10913294 Ga0207646_109132942 110
280 3300025923 Ga0207681_10735644 Ga0207681_107356442 110
281 3300025923 Ga0207681_11097476 Ga0207681_110974762 110
282 3300025924 Ga0207694_10094527 Ga0207694_100945272 110
283 3300025925 Ga0207650_11031841 Ga0207650_110318412 110
284 3300025926 Ga0207659_10794375 Ga0207659_107943752 110
285 3300025927 Ga0207687_10339657 Ga0207687_103396572 110
286 3300025928 Ga0207700_11626567 Ga0207700_116265671 110
287 3300025929 Ga0207664_10010849 Ga0207664_100108494 110
288 3300025934 Ga0207686_10013034 Ga0207686_100130342 110
289 3300025934 Ga0207686_10022214 Ga0207686_100222143 110
290 3300025936 Ga0207670_10280288 Ga0207670_102802883 110
291 3300025938 Ga0207704_11161618 Ga0207704_111616181 110
292 3300025940 Ga0207691_11761127 Ga0207691_117611272 110
293 3300025941 Ga0207711_10085168 Ga0207711_100851684 110
294 3300025941 Ga0207711_10284138 Ga0207711_102841381 110
295 3300025942 Ga0207689_10061406 Ga0207689_100614062 110
296 3300025944 Ga0207661_10138902 Ga0207661_101389022 110
297 3300025945 Ga0207679_11961588 Ga0207679_119615881 110
298 3300025960 Ga0207651_10097693 Ga0207651_100976931 110
299 3300025961 Ga0207712_10117347 Ga0207712_101173473 110
300 3300025961 Ga0207712_11668079 Ga0207712_116680792 110
301 3300025981 Ga0207640_10174465 Ga0207640_101744652 110
302 3300025981 Ga0207640_10320337 Ga0207640_103203372 110
303 3300025981 Ga0207640_10378364 Ga0207640_103783642 110
304 3300025986 Ga0207658_10056651 Ga0207658_100566512 110
305 3300026023 Ga0207677_10402889 Ga0207677_104028891 110
306 3300026035 Ga0207703_10007478 Ga0207703_100074785 110
307 3300026035 Ga0207703_10258113 Ga0207703_102581131 110
308 3300026041 Ga0207639_11906563 Ga0207639_119065632 110
309 3300026067 Ga0207678_10689097 Ga0207678_106890973 110
310 3300026067 Ga0207678_10767941 Ga0207678_107679411 110
311 3300026075 Ga0207708_10008686 Ga0207708_100086862 110
312 3300026075 Ga0207708_10126935 Ga0207708_101269352 110
313 3300026075 Ga0207708_10590789 Ga0207708_105907892 110
314 3300026078 Ga0207702_10115261 Ga0207702_101152612 110
315 3300026078 Ga0207702_10725794 Ga0207702_107257942 110
316 3300026088 Ga0207641_10031579 Ga0207641_100315792 110
317 3300026089 Ga0207648_10340484 Ga0207648_103404842 110
318 3300026089 Ga0207648_10828888 Ga0207648_108288883 110
319 3300026089 Ga0207648_11730532 Ga0207648_117305322 110
320 3300026116 Ga0207674_10032463 Ga0207674_100324632 110
321 3300026116 Ga0207674_10788652 Ga0207674_107886522 110
322 3300026118 Ga0207675_100046521 Ga0207675_1000465213 110
323 3300026118 Ga0207675_101066693 Ga0207675_1010666931 110
324 3300026118 Ga0207675_101317855 Ga0207675_1013178552 110
325 3300026121 Ga0207683_10237410 Ga0207683_102374102 110
326 3300026121 Ga0207683_10319994 Ga0207683_103199942 110
327 3300026121 Ga0207683_10394158 Ga0207683_103941582 110
328 3300026142 Ga0207698_11115995 Ga0207698_111159952 110
329 3300027866 Ga0209813_10102893 Ga0209813_101028932 110
330 3300027876 Ga0209974_10057876 Ga0209974_100578762 110
331 3300027876 Ga0209974_10284681 Ga0209974_102846811 110
332 3300027907 Ga0207428_10000904 Ga0207428_1000090418 110
333 3300027907 Ga0207428_10003846 Ga0207428_100038462 110
334 3300027907 Ga0207428_10118424 Ga0207428_101184242 110
335 3300027907 Ga0207428_11286282 Ga0207428_112862822 110
336 3300028379 Ga0268266_10002004 Ga0268266_100020049 110
337 3300028380 Ga0268265_10424029 Ga0268265_104240291 110
338 3300028380 Ga0268265_12098367 Ga0268265_120983672 110
339 3300028381 Ga0268264_10067935 Ga0268264_100679352 110
340 3300030745 Ga0316182_1222324 Ga0316182_12223242 110
341 3300031548 Ga0307408_100052122 Ga0307408_1000521222 110
342 3300031548 Ga0307408_100134895 Ga0307408_1001348951 110
343 3300031548 Ga0307408_100142490 Ga0307408_1001424902 110
344 3300031548 Ga0307408_100673499 Ga0307408_1006734992 110
345 3300031548 Ga0307408_100755788 Ga0307408_1007557882 110
346 3300031731 Ga0307405_10014948 Ga0307405_100149483 110
347 3300031731 Ga0307405_11958852 Ga0307405_119588521 110
348 3300031824 Ga0307413_10606670 Ga0307413_106066702 110
349 3300031824 Ga0307413_10766796 Ga0307413_107667961 110
350 3300031824 Ga0307413_12183972 Ga0307413_121839721 110
351 3300031852 Ga0307410_10094545 Ga0307410_100945452 110
352 3300031852 Ga0307410_10775155 Ga0307410_107751552 110
353 3300031901 Ga0307406_10049455 Ga0307406_100494552 110
354 3300031901 Ga0307406_10369507 Ga0307406_103695072 110
355 3300031901 Ga0307406_10448163 Ga0307406_104481632 110
356 3300031903 Ga0307407_10231710 Ga0307407_102317103 110
357 3300031903 Ga0307407_10925742 Ga0307407_109257421 110
358 3300031911 Ga0307412_10078618 Ga0307412_100786182 110
359 3300031911 Ga0307412_10297746 Ga0307412_102977462 110
360 3300031995 Ga0307409_100129841 Ga0307409_1001298412 110
361 3300031995 Ga0307409_100774382 Ga0307409_1007743822 110
362 3300032002 Ga0307416_100041330 Ga0307416_1000413302 110
363 3300032002 Ga0307416_100062930 Ga0307416_1000629301 110
364 3300032002 Ga0307416_101121341 Ga0307416_1011213411 110
365 3300032002 Ga0307416_101698402 Ga0307416_1016984022 110
366 3300032002 Ga0307416_101929339 Ga0307416_1019293391 110
367 3300032004 Ga0307414_11576511 Ga0307414_115765111 110
368 3300032004 Ga0307414_11906378 Ga0307414_119063781 110
369 3300032005 Ga0307411_10092342 Ga0307411_100923422 110
370 3300032005 Ga0307411_10106571 Ga0307411_101065712 110
371 3300032005 Ga0307411_10162993 Ga0307411_101629932 110
372 3300032005 Ga0307411_10723264 Ga0307411_107232641 110
373 3300032126 Ga0307415_100237956 Ga0307415_1002379562 110
374 3300032126 Ga0307415_101462089 Ga0307415_1014620892 110
375 3300035112 Ga0373932_0034808 Ga0373932_0034808_943_1275 110
376 3300035113 Ga0373936_0020695 Ga0373936_0020695_40_390 110
377 3300035115 Ga0373941_0422047 Ga0373941_0422047_29_382 110
378 3300035116 Ga0373945_0156684 Ga0373945_0156684_545_895 110
379 3300035170 Ga0373943_0739234 Ga0373943_0739234_129_461 110
380 3300035171 Ga0373946_0245351 Ga0373946_0245351_418_750 110
381 3300035207 Ga0373942_0287225 Ga0373942_0287225_179_511 110
382 3300035242 Ga0373962_0136844 Ga0373962_0136844_159_512 110
383 3300035410 Ga0373924_0030931 Ga0373924_0030931_151_495 110
384 3300035692 Ga0373935_1023615 Ga0373935_1023615_178_510 110
385 3300035725 Ga0373947_0229925 Ga0373947_0229925_862_1194 110
386 3300035725 Ga0373947_0842714 Ga0373947_0842714_239_589 110
387 3300036401 Ga0373937_0047362 Ga0373937_0047362_443_787 110
388 3300036401 Ga0373937_0444920 Ga0373937_0444920_184_516 110
389 3300036401 Ga0373937_0693139 Ga0373937_0693139_306_638 110
390 3300037068 Ga0373925_0129584 Ga0373925_0129584_917_1267 110
391 3300037418 Ga0395900_0984318 Ga0395900_0984318_193_543 110
392 3300037466 Ga0395898_0342751 Ga0395898_0342751_868_1218 110
393 3300037853 Ga0436364_1049779 Ga0436364_1049779_575_919 110
394 3300037853 Ga0436364_1068981 Ga0436364_1068981_1303_1647 110
395 3300037853 Ga0436364_1203962 Ga0436364_1203962_324_668 110
396 3300038443 Ga0395901_0902145 Ga0395901_0902145_481_834 110
397 3300039093 Ga0400489_61415 Ga0400489_61415_235_582 110
398 3300039437 Ga0436365_0873465 Ga0436365_0873465_116591_116950 110
399 3300039437 Ga0436365_1795675 Ga0436365_1795675_2651_2995 110
400 3300039438 Ga0436360_0056218 Ga0436360_0056218_478_831 110
401 3300039438 Ga0436360_0660040 Ga0436360_0660040_81_425 110
402 3300039453 Ga0436362_1256871 Ga0436362_1256871_63_407 110
403 3300042003 Ga0439443_018675 Ga0439443_018675_299_643 110
404 3300042008 Ga0439450_040495 Ga0439450_040495_107_460 110
405 3300042008 Ga0439450_111941 Ga0439450_111941_176_508 110
406 3300042015 Ga0439462_0042339 Ga0439462_0042339_805_1155 110
407 3300042435 Ga0439434_0204462 Ga0439434_0204462_246_599 110
408 3300042439 Ga0439464_0083702 Ga0439464_0083702_436_768 110
409 3300042461 Ga0439460_0098821 Ga0439460_0098821_28_381 110
410 3300042993 Ga0439440_0244864 Ga0439440_0244864_152_505 110
411 3300044673 Ga0453683_0918045 Ga0453683_0918045_147_491 110
412 3300044694 Ga0466963_0592569 Ga0466963_0592569_330_680 110
413 3300044901 Ga0466960_0858120 Ga0466960_0858120_104_463 110
414 3300045051 Ga0451576_0467492 Ga0451576_0467492_178_531 110
415 3300045051 Ga0451576_0620043 Ga0451576_0620043_611_964 110
416 3300045836 Ga0466958_0954940 Ga0466958_0954940_63_410 110
417 3300046454 Ga0495592_0671455 Ga0495592_0671455_201_533 110
418 3300046457 Ga0495590_0430792 Ga0495590_0430792_89_442 110
419 3300046459 Ga0495629_1079024 Ga0495629_1079024_32_364 110
420 3300046459 Ga0495629_1128430 Ga0495629_1128430_14_346 110
421 3300046475 Ga0495639_0570007 Ga0495639_0570007_177_509 110
422 3300046499 Ga0495594_0147648 Ga0495594_0147648_247_579 110
423 3300046517 Ga0495630_0867683 Ga0495630_0867683_320_652 110
424 3300046517 Ga0495630_0889087 Ga0495630_0889087_70_402 110
425 3300046517 Ga0495630_1148312 Ga0495630_1148312_27_371 110
426 3300046533 Ga0495640_0459733 Ga0495640_0459733_151_495 110
427 3300046539 Ga0495621_0036241 Ga0495621_0036241_1183_1527 110
428 3300046642 Ga0495634_0417538 Ga0495634_0417538_44_397 110
429 3300046663 Ga0495635_0302816 Ga0495635_0302816_20_352 110
430 3300046681 Ga0495647_0115600 Ga0495647_0115600_235_567 110
431 3300046683 Ga0495658_0081509 Ga0495658_0081509_1232_1564 110
432 3300046689 Ga0495613_0639625 Ga0495613_0639625_307_639 110
433 3300047319 Ga0495674_0595842 Ga0495674_0595842_511_843 110
434 3300047319 Ga0495674_1218672 Ga0495674_1218672_122_454 110
435 3300047445 Ga0495677_0135095 Ga0495677_0135095_313_657 110
436 3300047471 Ga0495684_0627528 Ga0495684_0627528_237_569 110
437 3300048089 Ga0495614_0477483 Ga0495614_0477483_41_373 110
438 3300048907 Ga0496104_0133485 Ga0496104_0133485_838_1191 110
439 3300048909 Ga0496106_0368116 Ga0496106_0368116_760_1113 110
440 3300048911 Ga0496108_0840795 Ga0496108_0840795_227_571 110
441 3300048912 Ga0496109_1603205 Ga0496109_1603205_199_552 110
442 3300048913 Ga0496110_0795469 Ga0496110_0795469_430_783 110
443 3300048917 Ga0496114_0079875 Ga0496114_0079875_2420_2752 110
444 3300048917 Ga0496114_0232402 Ga0496114_0232402_108_461 110
445 3300048929 Ga0496126_0155949 Ga0496126_0155949_515_859 110
446 3300049514 Ga0501291_031015 Ga0501291_031015_213_566 110
447 3300049514 Ga0501291_063948 Ga0501291_063948_178_531 110
448 3300049515 Ga0501292_024526 Ga0501292_024526_549_902 110
449 3300049515 Ga0501292_054832 Ga0501292_054832_189_542 110
450 3300049523 Ga0501300_026510 Ga0501300_026510_410_763 110
451 3300049525 Ga0501302_025968 Ga0501302_025968_59_412 110
452 3300049572 Ga0501036_1197660 Ga0501036_1197660_113_466 110
453 3300049584 Ga0501068_0242977 Ga0501068_0242977_783_1133 110
454 3300049587 Ga0501071_1145359 Ga0501071_1145359_92_436 110
455 3300049589 Ga0501073_0245990 Ga0501073_0245990_431_784 110
456 3300049589 Ga0501073_1082736 Ga0501073_1082736_70_423 110
457 3300049592 Ga0501076_0298800 Ga0501076_0298800_247_600 110
458 3300049592 Ga0501076_1058914 Ga0501076_1058914_116_448 110
459 3300049656 Ga0501209_159522 Ga0501209_159522_174_527 110
460 3300049660 Ga0501216_193146 Ga0501216_193146_97_456 110
461 3300049668 Ga0501233_199511 Ga0501233_199511_156_509 110
462 3300049669 Ga0501235_162348 Ga0501235_162348_142_495 110
463 3300049675 Ga0501243_054745 Ga0501243_054745_285_638 110
464 3300049679 Ga0501249_203110 Ga0501249_203110_54_398 110
465 3300049690 Ga0501261_099648 Ga0501261_099648_111_470 110
466 3300049741 Ga0501079_0986604 Ga0501079_0986604_125_478 110
467 3300049742 Ga0501080_0140294 Ga0501080_0140294_1116_1469 110
468 3300049743 Ga0501081_0197949 Ga0501081_0197949_516_848 110
469 3300049761 Ga0501264_031214 Ga0501264_031214_101_433 110
470 3300049768 Ga0501271_012620 Ga0501271_012620_455_808 110
471 3300049775 Ga0501279_032980 Ga0501279_032980_40_393 110
472 3300049778 Ga0501282_046777 Ga0501282_046777_18_368 110
473 3300049779 Ga0501283_125780 Ga0501283_125780_21_374 110
474 3300049851 Ga0501212_043153 Ga0501212_043153_25_357 110
475 3300050489 nmdc:mga03683_19891_c1 nmdc:mga03683_19891_c1_683_1036 110
476 3300050490 nmdc:mga03n38_902415_c1 nmdc:mga03n38_902415_c1_79_411 110
477 3300050491 nmdc:mga00v17_19857_c1 nmdc:mga00v17_19857_c1_1956_2309 110
478 3300050491 nmdc:mga00v17_199779_c1 nmdc:mga00v17_199779_c1_936_1280 110
479 3300050491 nmdc:mga00v17_22070_c1 nmdc:mga00v17_22070_c1_2208_2561 110
480 3300050491 nmdc:mga00v17_47829_c1 nmdc:mga00v17_47829_c1_2138_2491 110
481 3300050491 nmdc:mga00v17_712512_c1 nmdc:mga00v17_712512_c1_174_527 110
482 3300050491 nmdc:mga00v17_981998_c1 nmdc:mga00v17_981998_c1_23_376 110
483 3300050492 nmdc:mga0yw44_30560_c1 nmdc:mga0yw44_30560_c1_1237_1590 110
484 3300050493 nmdc:mga0k408_107679_c1 nmdc:mga0k408_107679_c1_852_1184 110
485 3300050493 nmdc:mga0k408_1798_c1 nmdc:mga0k408_1798_c1_9361_9714 110
486 3300050493 nmdc:mga0k408_61717_c1 nmdc:mga0k408_61717_c1_1277_1630 110
487 3300050493 nmdc:mga0k408_63436_c1 nmdc:mga0k408_63436_c1_738_1091 110
488 3300050494 nmdc:mga06z11_342078_c1 nmdc:mga06z11_342078_c1_518_871 110
489 3300050494 nmdc:mga06z11_345615_c1 nmdc:mga06z11_345615_c1_71_424 110
490 3300050494 nmdc:mga06z11_7398_c1 nmdc:mga06z11_7398_c1_1213_1566 110
491 3300050494 nmdc:mga06z11_87703_c2 nmdc:mga06z11_87703_c2_913_1266 110
492 3300050495 nmdc:mga04h51_66895_c1 nmdc:mga04h51_66895_c1_302_655 110
493 3300050496 nmdc:mga07m45_1478_c1 nmdc:mga07m45_1478_c1_4977_5330 110
494 3300050496 nmdc:mga07m45_327341_c1 nmdc:mga07m45_327341_c1_492_845 110
495 3300050496 nmdc:mga07m45_8178_c1 nmdc:mga07m45_8178_c1_1619_1972 110
496 3300050507 nmdc:mga05p37_1286827_c1 nmdc:mga05p37_1286827_c1_203_556 110
497 3300050507 nmdc:mga05p37_17344_c1 nmdc:mga05p37_17344_c1_1716_2048 110
498 3300050507 nmdc:mga05p37_1859999_c1 nmdc:mga05p37_1859999_c1_101_445 110
499 3300050507 nmdc:mga05p37_288056_c1 nmdc:mga05p37_288056_c1_10_342 110
500 3300050507 nmdc:mga05p37_545_c1 nmdc:mga05p37_545_c1_34268_34621 110
501 3300050508 nmdc:mga09592_102477_c1 nmdc:mga09592_102477_c1_350_694 110
502 3300050508 nmdc:mga09592_25730_c1 nmdc:mga09592_25730_c1_2885_3238 110
503 3300050508 nmdc:mga09592_32073_c1 nmdc:mga09592_32073_c1_3410_3763 110
504 3300050508 nmdc:mga09592_417444_c1 nmdc:mga09592_417444_c1_253_585 110
505 3300050508 nmdc:mga09592_427704_c1 nmdc:mga09592_427704_c1_697_1050 110
506 3300050508 nmdc:mga09592_472484_c1 nmdc:mga09592_472484_c1_291_629 110
507 3300050508 nmdc:mga09592_71987_c1 nmdc:mga09592_71987_c1_1601_1954 110
508 3300050508 nmdc:mga09592_912617_c1 nmdc:mga09592_912617_c1_164_517 110
509 3300050509 nmdc:mga0qj67_106013_c1 nmdc:mga0qj67_106013_c1_870_1223 110
510 3300050509 nmdc:mga0qj67_10926_c1 nmdc:mga0qj67_10926_c1_770_1123 110
511 3300050509 nmdc:mga0qj67_126155_c1 nmdc:mga0qj67_126155_c1_816_1148 110
512 3300050509 nmdc:mga0qj67_16027_c1 nmdc:mga0qj67_16027_c1_3436_3789 110
513 3300050509 nmdc:mga0qj67_583607_c1 nmdc:mga0qj67_583607_c1_279_617 110
514 3300050510 nmdc:mga06r32_1155659_c1 nmdc:mga06r32_1155659_c1_174_506 110
515 3300050510 nmdc:mga06r32_1242158_c1 nmdc:mga06r32_1242158_c1_172_525 110
516 3300050510 nmdc:mga06r32_1430286_c1 nmdc:mga06r32_1430286_c1_45_383 110
517 3300050510 nmdc:mga06r32_5060_c1 nmdc:mga06r32_5060_c1_3627_3980 110
518 3300050510 nmdc:mga06r32_539600_c1 nmdc:mga06r32_539600_c1_385_738 110
519 3300050510 nmdc:mga06r32_690401_c1 nmdc:mga06r32_690401_c1_360_713 110
520 3300050510 nmdc:mga06r32_7050_c1 nmdc:mga06r32_7050_c1_3757_4110 110
521 3300050510 nmdc:mga06r32_71221_c1 nmdc:mga06r32_71221_c1_2239_2592 110
522 3300050510 nmdc:mga06r32_884481_c1 nmdc:mga06r32_884481_c1_171_524 110
523 3300050510 nmdc:mga06r32_98200_c1 nmdc:mga06r32_98200_c1_2444_2794 110
524 3300050511 nmdc:mga08y16_12333_c1 nmdc:mga08y16_12333_c1_2636_2989 110
525 3300050511 nmdc:mga08y16_1362564_c1 nmdc:mga08y16_1362564_c1_259_591 110
526 3300050511 nmdc:mga08y16_148167_c1 nmdc:mga08y16_148167_c1_886_1218 110
527 3300050511 nmdc:mga08y16_193917_c1 nmdc:mga08y16_193917_c1_1441_1773 110
528 3300050511 nmdc:mga08y16_222306_c1 nmdc:mga08y16_222306_c1_992_1345 110
529 3300050511 nmdc:mga08y16_248683_c1 nmdc:mga08y16_248683_c1_372_704 110
530 3300050511 nmdc:mga08y16_52673_c1 nmdc:mga08y16_52673_c1_3081_3425 110
531 3300050511 nmdc:mga08y16_56728_c1 nmdc:mga08y16_56728_c1_607_939 110
532 3300050511 nmdc:mga08y16_657243_c1 nmdc:mga08y16_657243_c1_182_514 110
533 3300050512 nmdc:mga0n895_1061531_c1 nmdc:mga0n895_1061531_c1_290_634 110
534 3300050512 nmdc:mga0n895_140267_c1 nmdc:mga0n895_140267_c1_1914_2267 110
535 3300050512 nmdc:mga0n895_218723_c1 nmdc:mga0n895_218723_c1_814_1146 110
536 3300050512 nmdc:mga0n895_3905_c1 nmdc:mga0n895_3905_c1_7110_7463 110
537 3300050512 nmdc:mga0n895_391044_c1 nmdc:mga0n895_391044_c1_960_1310 110
538 3300050512 nmdc:mga0n895_61609_c1 nmdc:mga0n895_61609_c1_3165_3521 110
539 3300050512 nmdc:mga0n895_89560_c1 nmdc:mga0n895_89560_c1_95_448 110
540 3300050513 nmdc:mga0rr50_144255_c1 nmdc:mga0rr50_144255_c1_937_1269 110
541 3300050513 nmdc:mga0rr50_14435_c1 nmdc:mga0rr50_14435_c1_1225_1581 110
542 3300050513 nmdc:mga0rr50_875278_c1 nmdc:mga0rr50_875278_c1_182_532 110
543 3300050514 nmdc:mga08x19_344235_c1 nmdc:mga08x19_344235_c1_278_628 110
544 3300050515 nmdc:mga0a205_12238_c1 nmdc:mga0a205_12238_c1_722_1054 110
545 3300050515 nmdc:mga0a205_123625_c1 nmdc:mga0a205_123625_c1_750_1103 110
546 3300050515 nmdc:mga0a205_2111_c1 nmdc:mga0a205_2111_c1_4982_5335 110
547 3300050515 nmdc:mga0a205_7948_c1 nmdc:mga0a205_7948_c1_1179_1511 110
548 3300050515 nmdc:mga0a205_8259_c1 nmdc:mga0a205_8259_c1_1536_1892 110
549 3300050515 nmdc:mga0a205_8985_c1 nmdc:mga0a205_8985_c1_6088_6441 110
550 3300053085 Ga0495619_0570196 Ga0495619_0570196_164_496 110
551 3300054114 Ga0501084_1840976 Ga0501084_1840976_120_473 110
552 3300059421 Ga0590071_056443 Ga0590071_056443_308_652 110
553 3300061734 Ga0530510_0277912 Ga0530510_0277912_673_1005 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

45

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9237 5 102
5x11-assembly1.cif.gz_A crystal structure of bacillus subtilis padr in complex with operator dna 0.9158 10 89
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.9144 10 89
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9105 5 102
2co5-assembly1.cif.gz_A f93 from stiv, a winged-helix dna-binding protein 0.906 13 98
ID Description Score Start End Superfamily
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9158 10 89 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9105 5 102 1.10.10.10
2co5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.906 13 98 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8941 12 105 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8934 15 80 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A534KDG9-F1-model_v4 PadR family transcriptional regulator 0.9806 8 104
AF-D0LFT7-F1-model_v4 Transcriptional regulator, PadR-like family 0.976 12 106
AF-A0A7W1QDS0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9705 7 106
AF-A0A7V9BJQ0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9703 1 81
AF-A0A843T8Z1-F1-model_v4 PadR family transcriptional regulator 0.9695 7 110

Feature Viewer

pLDDT pTM Quality
90.8 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map