F462826

General Info

Members Datasets Scaffolds Average Seq Length
553 290 553 231

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100023317|Ga0070708_1000233172
Length 268
Sequence VPPLSGSKEAESGGVAAALQKSRRLARAANTTEELLAKHGKKYRASAAKVEQRPYQLDEAVQLLKQIAYAKFNETVELSMLLGVDPKHADQMVRGTTVLPHGTGKSKRVLVIAGGDKQKEAQEAGADFVGGDDMVQKIQEGWVDFDAVIATPDMMRSVGKLGKVLGPRGLMPNPKTGTVTFDVTKALQEIKAGKVEFRVDKTSIIHVPVGKIQFTAEQLRDNASAIINAVRKAKPPAAKGKYVRTMYISSTMSPSIQLDPALAEVKEV

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
213 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
214 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
215 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
216 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
217 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
223 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
224 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 2.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.44
Rhizosphere 93.49
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1019576 3300002076 Bacteria 956
2 JGI26145J50221_1002425 3300003371 Bacteria 1468
3 Ga0065704_10007935 3300005289 Bacteria 2439
4 Ga0065715_10142197 3300005293 Bacteria 1837
5 Ga0065715_10151325 3300005293 Bacteria 1725
6 Ga0065715_10213728 3300005293 Bacteria 1302
7 Ga0065707_10035388 3300005295 Bacteria 1139
8 Ga0065707_10168329 3300005295 Bacteria 1501
9 Ga0070658_10020602 3300005327 Bacteria 5285
10 Ga0070676_10023017 3300005328 Bacteria 3499
11 Ga0070676_10172489 3300005328 Bacteria 1400
12 Ga0070683_100000118 3300005329 Bacteria 51816
13 Ga0070690_100000715 3300005330 Bacteria 17046
14 Ga0070670_100005117 3300005331 Bacteria 11035
15 Ga0070670_100104615 3300005331 Bacteria 2438
16 Ga0070677_10000509 3300005333 Bacteria 13392
17 Ga0068869_100030964 3300005334 Bacteria 3761
18 Ga0068869_100043571 3300005334 Bacteria 3224
19 Ga0068869_100164420 3300005334 Bacteria 1729
20 Ga0070666_10007087 3300005335 Bacteria 6912
21 Ga0070666_10024889 3300005335 Bacteria 3901
22 Ga0070680_100114817 3300005336 Bacteria 2243
23 Ga0070682_100000004 3300005337 Bacteria 388780
24 Ga0070682_100160991 3300005337 Bacteria 1550
25 Ga0068868_100000927 3300005338 Bacteria 19963
26 Ga0068868_100006109 3300005338 Bacteria 8509
27 Ga0068868_100091473 3300005338 Bacteria 2451
28 Ga0068868_100445305 3300005338 Bacteria 1126
29 Ga0070687_100075125 3300005343 Bacteria 1826
30 Ga0070687_100237025 3300005343 Bacteria 1126
31 Ga0070687_100279441 3300005343 Bacteria 1050
32 Ga0070661_100135339 3300005344 Bacteria 1854
33 Ga0070661_100422374 3300005344 Bacteria 1057
34 Ga0070692_10001894 3300005345 Bacteria 7889
35 Ga0070692_10003744 3300005345 Bacteria 6248
36 Ga0070692_10084075 3300005345 Bacteria 1720
37 Ga0070692_10084192 3300005345 Bacteria 1718
38 Ga0070675_100000019 3300005354 Bacteria 173624
39 Ga0070675_100032065 3300005354 Bacteria 4250
40 Ga0070675_100063190 3300005354 Bacteria 3060
41 Ga0070671_100018596 3300005355 Bacteria 5646
42 Ga0070671_100064281 3300005355 Bacteria 3056
43 Ga0070671_100131995 3300005355 Bacteria 2104
44 Ga0070674_100011990 3300005356 Bacteria 5306
45 Ga0070674_100141971 3300005356 Bacteria 1803
46 Ga0070673_100036810 3300005364 Bacteria 3724
47 Ga0070673_100041919 3300005364 Bacteria 3525
48 Ga0070667_100010865 3300005367 Bacteria 7528
49 Ga0070667_100029890 3300005367 Bacteria 4542
50 Ga0070667_100271420 3300005367 Bacteria 1521
51 Ga0070703_10000669 3300005406 Bacteria 11859
52 Ga0070714_100028589 3300005435 Bacteria 4628
53 Ga0070713_100020740 3300005436 Bacteria 5044
54 Ga0070701_10001087 3300005438 Bacteria 9928
55 Ga0070705_100479465 3300005440 Bacteria 940
56 Ga0070700_100000023 3300005441 Bacteria 129791
57 Ga0070694_100001347 3300005444 Bacteria 14324
58 Ga0070694_100013152 3300005444 Bacteria 5164
59 Ga0070694_100016002 3300005444 Bacteria 4720
60 Ga0070694_100050865 3300005444 Bacteria 2795
61 Ga0070694_100117297 3300005444 Bacteria 1905
62 Ga0070694_100276159 3300005444 Bacteria 1279
63 Ga0070694_100291713 3300005444 Bacteria 1247
64 Ga0070694_100486631 3300005444 Bacteria 980
65 Ga0070708_100008735 3300005445 Bacteria 8143
66 Ga0070708_100023317 3300005445 Bacteria 5262
67 Ga0070708_100099202 3300005445 Bacteria 2664
68 Ga0070708_100369829 3300005445 Bacteria 1351
69 Ga0070708_100548058 3300005445 Bacteria 1091
70 Ga0070663_100043942 3300005455 Bacteria 3147
71 Ga0070663_100057999 3300005455 Bacteria 2779
72 Ga0070663_100067244 3300005455 Bacteria 2599
73 Ga0070663_100430826 3300005455 Bacteria 1083
74 Ga0070678_100005784 3300005456 Bacteria 7194
75 Ga0070678_100352952 3300005456 Bacteria 1265
76 Ga0068867_100028469 3300005459 Bacteria 4023
77 Ga0068867_100273427 3300005459 Bacteria 1382
78 Ga0070685_10026972 3300005466 Bacteria 3171
79 Ga0070706_100024463 3300005467 Bacteria 5560
80 Ga0070706_100042452 3300005467 Bacteria 4201
81 Ga0070706_100047280 3300005467 Bacteria 3970
82 Ga0070706_100077441 3300005467 Bacteria 3078
83 Ga0070706_100098251 3300005467 Bacteria 2720
84 Ga0070706_100386484 3300005467 Bacteria 1303
85 Ga0070707_100077037 3300005468 Bacteria 3217
86 Ga0070707_100122006 3300005468 Bacteria 2530
87 Ga0070707_100233630 3300005468 Bacteria 1789
88 Ga0070698_100029948 3300005471 Bacteria 5648
89 Ga0070698_100100026 3300005471 Bacteria 2873
90 Ga0070698_100173503 3300005471 Bacteria 2096
91 Ga0070699_100174109 3300005518 Bacteria 1907
92 Ga0070699_100455157 3300005518 Bacteria 1161
93 Ga0070684_100004380 3300005535 Bacteria 10734
94 Ga0070684_100135642 3300005535 Bacteria 2223
95 Ga0070684_100225836 3300005535 Bacteria 1709
96 Ga0070697_100010304 3300005536 Bacteria 7286
97 Ga0070697_100056398 3300005536 Bacteria 3196
98 Ga0070697_100072171 3300005536 Bacteria 2832
99 Ga0070697_100159513 3300005536 Bacteria 1905
100 Ga0070697_100222181 3300005536 Bacteria 1610
101 Ga0070697_100245185 3300005536 Bacteria 1531
102 Ga0070697_100287442 3300005536 Bacteria 1412
103 Ga0068853_100078497 3300005539 Bacteria 2885
104 Ga0070672_100000645 3300005543 Bacteria 20439
105 Ga0070672_100009524 3300005543 Bacteria 6703
106 Ga0070672_100440940 3300005543 Bacteria 1121
107 Ga0070686_100117370 3300005544 Bacteria 1822
108 Ga0070695_100219880 3300005545 Bacteria 1368
109 Ga0070695_100370983 3300005545 Bacteria 1077
110 Ga0070695_100391313 3300005545 Bacteria 1051
111 Ga0070695_100465121 3300005545 Bacteria 972
112 Ga0070696_100013240 3300005546 Bacteria 5535
113 Ga0070696_100057640 3300005546 Bacteria 2711
114 Ga0070696_100082185 3300005546 Bacteria 2283
115 Ga0070696_100085798 3300005546 Bacteria 2235
116 Ga0070696_100192349 3300005546 Bacteria 1519
117 Ga0070696_100369671 3300005546 Bacteria 1115
118 Ga0070696_100585324 3300005546 Bacteria 898
119 Ga0070665_100031052 3300005548 Bacteria 5376
120 Ga0070665_100057140 3300005548 Bacteria 3912
121 Ga0070665_100080240 3300005548 Bacteria 3268
122 Ga0070704_100024986 3300005549 Bacteria 3927
123 Ga0070704_100135448 3300005549 Bacteria 1915
124 Ga0070704_100146613 3300005549 Bacteria 1850
125 Ga0070704_100157809 3300005549 Bacteria 1791
126 Ga0070704_100234866 3300005549 Bacteria 1498
127 Ga0070704_100287416 3300005549 Bacteria 1365
128 Ga0070704_100593210 3300005549 Bacteria 973
129 Ga0068855_100898123 3300005563 Bacteria 936
130 Ga0070664_100029833 3300005564 Bacteria 4547
131 Ga0070664_100105624 3300005564 Bacteria 2453
132 Ga0070664_100208778 3300005564 Bacteria 1745
133 Ga0068857_100085364 3300005577 Bacteria 2821
134 Ga0068857_100151752 3300005577 Bacteria 2099
135 Ga0068854_100233583 3300005578 Bacteria 1461
136 Ga0068856_100011643 3300005614 Bacteria 8532
137 Ga0070702_100016630 3300005615 Bacteria 3777
138 Ga0070702_100087415 3300005615 Bacteria 1882
139 Ga0068852_100642814 3300005616 Bacteria 1068
140 Ga0068859_100003783 3300005617 Bacteria 15437
141 Ga0068859_100155418 3300005617 Bacteria 2364
142 Ga0068864_100009374 3300005618 Bacteria 8076
143 Ga0068864_100052072 3300005618 Bacteria 3528
144 Ga0068864_100093789 3300005618 Bacteria 2652
145 Ga0068864_100394802 3300005618 Bacteria 1314
146 Ga0068866_10033142 3300005718 Bacteria 2503
147 Ga0068866_10434369 3300005718 Bacteria 855
148 Ga0068861_100078892 3300005719 Bacteria 2573
149 Ga0068861_100261401 3300005719 Bacteria 1482
150 Ga0068861_100488495 3300005719 Bacteria 1111
151 Ga0068851_10345870 3300005834 Bacteria 864
152 Ga0068870_10046539 3300005840 Bacteria 2275
153 Ga0068870_10057287 3300005840 Bacteria 2083
154 Ga0068863_100032041 3300005841 Bacteria 5013
155 Ga0068863_100036843 3300005841 Bacteria 4658
156 Ga0068863_100178518 3300005841 Bacteria 2038
157 Ga0068863_100360149 3300005841 Bacteria 1418
158 Ga0068858_100000126 3300005842 Bacteria 79740
159 Ga0068858_100465033 3300005842 Bacteria 1220
160 Ga0068860_100006092 3300005843 Bacteria 12136
161 Ga0068860_100019789 3300005843 Bacteria 6526
162 Ga0068860_100434822 3300005843 Bacteria 1303
163 Ga0068862_100002514 3300005844 Bacteria 16227
164 Ga0068862_100009052 3300005844 Bacteria 8243
165 Ga0081455_10015825 3300005937 Bacteria 7305
166 Ga0070717_10000358 3300006028 Bacteria 29359
167 Ga0070717_10089781 3300006028 Bacteria 2592
168 Ga0070717_10270617 3300006028 Bacteria 1505
169 Ga0070716_100096127 3300006173 Bacteria 1805
170 Ga0070716_100185537 3300006173 Bacteria 1370
171 Ga0097621_100145181 3300006237 Bacteria 2031
172 Ga0097621_100231444 3300006237 Bacteria 1613
173 Ga0097621_100614068 3300006237 Bacteria 995
174 Ga0068871_100080654 3300006358 Bacteria 2694
175 Ga0068871_100486559 3300006358 Bacteria 1111
176 Ga0075428_100025919 3300006844 Bacteria 6493
177 Ga0075428_100040925 3300006844 Bacteria 5096
178 Ga0075428_100281334 3300006844 Bacteria 1790
179 Ga0075428_100303669 3300006844 Bacteria 1716
180 Ga0075428_100816333 3300006844 Bacteria 991
181 Ga0075430_100091926 3300006846 Bacteria 2537
182 Ga0075431_100001900 3300006847 Bacteria 19822
183 Ga0075431_100061605 3300006847 Bacteria 3871
184 Ga0075431_100067235 3300006847 Bacteria 3699
185 Ga0075431_100251750 3300006847 Bacteria 1795
186 Ga0075433_10045513 3300006852 Bacteria 3815
187 Ga0075433_10144724 3300006852 Bacteria 2113
188 Ga0075433_10329303 3300006852 Bacteria 1351
189 Ga0075434_100097085 3300006871 Bacteria 2951
190 Ga0075434_100172980 3300006871 Bacteria 2179
191 Ga0075434_100246534 3300006871 Bacteria 1806
192 Ga0075429_100000951 3300006880 Bacteria 22943
193 Ga0068865_100292266 3300006881 Bacteria 1301
194 Ga0075436_100015219 3300006914 Bacteria 5268
195 Ga0097620_100003783 3300006931 Bacteria 15437
196 Ga0097620_100155408 3300006931 Bacteria 2364
197 Ga0075435_100019811 3300007076 Bacteria 5145
198 Ga0075435_100048622 3300007076 Bacteria 3408
199 Ga0099794_10162664 3300007265 Bacteria 1136
200 Ga0099795_10181296 3300007788 Bacteria 880
201 Ga0105244_10033985 3300009036 Bacteria 2686
202 Ga0111539_10000004 3300009094 Bacteria 751278
203 Ga0111539_10023336 3300009094 Bacteria 7601
204 Ga0111539_10386172 3300009094 Bacteria 1630
205 Ga0111539_10503875 3300009094 Bacteria 1410
206 Ga0105245_10002811 3300009098 Bacteria 15656
207 Ga0105245_10003274 3300009098 Bacteria 14536
208 Ga0105245_10089609 3300009098 Bacteria 2828
209 Ga0105245_10300186 3300009098 Bacteria 1576
210 Ga0105245_10698338 3300009098 Bacteria 1048
211 Ga0114129_10006614 3300009147 Bacteria 16457
212 Ga0114129_10007335 3300009147 Bacteria 15696
213 Ga0114129_10024295 3300009147 Bacteria 8586
214 Ga0114129_10280809 3300009147 Bacteria 2225
215 Ga0114129_10315790 3300009147 Bacteria 2078
216 Ga0114129_10397700 3300009147 Bacteria 1816
217 Ga0114129_10441641 3300009147 Bacteria 1708
218 Ga0105241_10253614 3300009174 Bacteria 1493
219 Ga0105242_10007796 3300009176 Bacteria 8240
220 Ga0105248_10003883 3300009177 Bacteria 16522
221 Ga0105238_10000002 3300009551 Bacteria 772711
222 Ga0105249_10033683 3300009553 Bacteria 4639
223 Ga0099796_10083304 3300010159 Bacteria 1176
224 Ga0157371_10613965 3300013102 Bacteria 810
225 Ga0157369_10000363 3300013105 Bacteria 60464
226 Ga0157374_10000016 3300013296 Bacteria 293656
227 Ga0157374_10053860 3300013296 Bacteria 3752
228 Ga0157378_10044976 3300013297 Bacteria 3922
229 Ga0157378_10055531 3300013297 Bacteria 3528
230 Ga0157378_10059344 3300013297 Bacteria 3413
231 Ga0157378_10616354 3300013297 Bacteria 1098
232 Ga0163162_10009455 3300013306 Bacteria 9479
233 Ga0163162_10024906 3300013306 Bacteria 5912
234 Ga0163162_10027719 3300013306 Bacteria 5603
235 Ga0163162_10425776 3300013306 Bacteria 1459
236 Ga0157372_10637722 3300013307 Bacteria 1241
237 Ga0157375_10001186 3300013308 Bacteria 22482
238 Ga0157375_10004506 3300013308 Bacteria 12112
239 Ga0157375_10017011 3300013308 Bacteria 6550
240 Ga0157375_10038879 3300013308 Bacteria 4572
241 Ga0157375_10061602 3300013308 Bacteria 3726
242 Ga0157375_10442167 3300013308 Bacteria 1466
243 Ga0163163_10082481 3300014325 Bacteria 3219
244 Ga0157380_10023433 3300014326 Bacteria 4657
245 Ga0157380_10055375 3300014326 Bacteria 3150
246 Ga0157377_10000026 3300014745 Bacteria 138648
247 Ga0157377_10000370 3300014745 Bacteria 20086
248 Ga0157377_10140469 3300014745 Bacteria 1484
249 Ga0157379_10037586 3300014968 Bacteria 4318
250 Ga0157379_10737783 3300014968 Unclassified 926
251 Ga0157376_10000018 3300014969 Bacteria 259397
252 Ga0157376_10112587 3300014969 Bacteria 2398
253 Ga0157376_10332419 3300014969 Bacteria 1448
254 Ga0157376_11054556 3300014969 Bacteria 837
255 Ga0163161_10127156 3300017792 Bacteria 1920
256 Ga0197907_10017840 3300020069 Bacteria 1135
257 Ga0206355_1085075 3300020076 Bacteria 746
258 Ga0206352_10233347 3300020078 Bacteria 2872
259 Ga0206350_11532297 3300020080 Bacteria 1047
260 Ga0206354_11262369 3300020081 Bacteria 1100
261 Ga0213873_10000001 3300021358 Bacteria 1657979
262 Ga0213876_10000009 3300021384 Bacteria 496136
263 Ga0213876_10000037 3300021384 Bacteria 185653
264 Ga0213876_10117650 3300021384 Bacteria 1410
265 Ga0224712_10007473 3300022467 Bacteria 3185
266 Ga0224712_10116476 3300022467 Bacteria 1152
267 Ga0207697_10004944 3300025315 Bacteria 6284
268 Ga0207655_1031667 3300025728 Bacteria 2432
269 Ga0207682_10007123 3300025893 Bacteria 4477
270 Ga0207642_10008709 3300025899 Bacteria 3497
271 Ga0207688_10023503 3300025901 Bacteria 3376
272 Ga0207680_10009869 3300025903 Bacteria 4754
273 Ga0207647_10041680 3300025904 Bacteria 2885
274 Ga0207647_10118962 3300025904 Bacteria 1558
275 Ga0207645_10004788 3300025907 Bacteria 9949
276 Ga0207645_10128356 3300025907 Bacteria 1649
277 Ga0207643_10021848 3300025908 Bacteria 3520
278 Ga0207705_10037305 3300025909 Bacteria 3478
279 Ga0207684_10028407 3300025910 Bacteria 4766
280 Ga0207684_10033979 3300025910 Bacteria 4336
281 Ga0207684_10038141 3300025910 Bacteria 4078
282 Ga0207684_10097226 3300025910 Bacteria 2514
283 Ga0207684_10124856 3300025910 Bacteria 2208
284 Ga0207684_10314851 3300025910 Bacteria 1349
285 Ga0207684_10348474 3300025910 Bacteria 1275
286 Ga0207654_10195966 3300025911 Bacteria 1327
287 Ga0207695_10061631 3300025913 Bacteria 3876
288 Ga0207660_10061956 3300025917 Bacteria 2694
289 Ga0207662_10148898 3300025918 Bacteria 1487
290 Ga0207649_10172390 3300025920 Bacteria 1508
291 Ga0207646_10051275 3300025922 Bacteria 3693
292 Ga0207646_10065243 3300025922 Bacteria 3250
293 Ga0207646_10118003 3300025922 Bacteria 2383
294 Ga0207646_10225698 3300025922 Bacteria 1692
295 Ga0207646_10358592 3300025922 Bacteria 1317
296 Ga0207694_10000001 3300025924 Bacteria 4078485
297 Ga0207650_10001851 3300025925 Bacteria 14917
298 Ga0207650_10032454 3300025925 Bacteria 3777
299 Ga0207659_10000001 3300025926 Bacteria 660958
300 Ga0207659_10043446 3300025926 Bacteria 3156
301 Ga0207659_10217814 3300025926 Bacteria 1533
302 Ga0207687_10000009 3300025927 Bacteria 443946
303 Ga0207687_10002004 3300025927 Bacteria 14005
304 Ga0207687_10004933 3300025927 Bacteria 8859
305 Ga0207700_10014828 3300025928 Bacteria 5119
306 Ga0207644_10001615 3300025931 Bacteria 14550
307 Ga0207706_10024888 3300025933 Bacteria 5366
308 Ga0207686_10024337 3300025934 Bacteria 3508
309 Ga0207670_10001935 3300025936 Bacteria 10844
310 Ga0207669_10010324 3300025937 Bacteria 4491
311 Ga0207669_10611716 3300025937 Bacteria 887
312 Ga0207704_10099350 3300025938 Bacteria 1936
313 Ga0207704_10183341 3300025938 Bacteria 1515
314 Ga0207691_10002406 3300025940 Bacteria 18319
315 Ga0207691_10188850 3300025940 Bacteria 1798
316 Ga0207711_10002464 3300025941 Bacteria 16513
317 Ga0207711_10102821 3300025941 Bacteria 2529
318 Ga0207711_10717118 3300025941 Bacteria 933
319 Ga0207689_10016588 3300025942 Bacteria 6232
320 Ga0207689_10059495 3300025942 Bacteria 3142
321 Ga0207689_10067634 3300025942 Bacteria 2936
322 Ga0207661_10000015 3300025944 Bacteria 318960
323 Ga0207679_10070562 3300025945 Bacteria 2632
324 Ga0207679_10406642 3300025945 Bacteria 1198
325 Ga0207667_10921217 3300025949 Bacteria 865
326 Ga0207651_10003479 3300025960 Bacteria 7737
327 Ga0207651_10034634 3300025960 Bacteria 3273
328 Ga0207712_10159659 3300025961 Bacteria 1751
329 Ga0207640_10082778 3300025981 Bacteria 2198
330 Ga0207658_10020060 3300025986 Bacteria 4627
331 Ga0207658_10078118 3300025986 Bacteria 2528
332 Ga0207677_10000017 3300026023 Bacteria 140155
333 Ga0207677_10000366 3300026023 Bacteria 31484
334 Ga0207703_10000653 3300026035 Bacteria 34790
335 Ga0207703_10002877 3300026035 Bacteria 14648
336 Ga0207703_10219138 3300026035 Bacteria 1700
337 Ga0207639_10000013 3300026041 Bacteria 293084
338 Ga0207678_10029933 3300026067 Bacteria 4753
339 Ga0207678_10071984 3300026067 Bacteria 2963
340 Ga0207678_10730180 3300026067 Bacteria 873
341 Ga0207708_10000022 3300026075 Bacteria 181216
342 Ga0207708_10006421 3300026075 Bacteria 8710
343 Ga0207702_10008952 3300026078 Bacteria 8435
344 Ga0207702_10380259 3300026078 Bacteria 1358
345 Ga0207641_10044698 3300026088 Bacteria 3725
346 Ga0207641_10106298 3300026088 Bacteria 2480
347 Ga0207641_10156827 3300026088 Bacteria 2066
348 Ga0207648_10008001 3300026089 Bacteria 10310
349 Ga0207648_10025661 3300026089 Bacteria 5246
350 Ga0207648_10395134 3300026089 Bacteria 1252
351 Ga0207676_10000002 3300026095 Bacteria 1198607
352 Ga0207676_10017667 3300026095 Bacteria 5173
353 Ga0207676_10077878 3300026095 Bacteria 2683
354 Ga0207674_10029202 3300026116 Bacteria 5808
355 Ga0207675_100010263 3300026118 Bacteria 8776
356 Ga0207675_100269826 3300026118 Bacteria 1651
357 Ga0207675_100271865 3300026118 Bacteria 1645
358 Ga0207683_10008562 3300026121 Bacteria 8755
359 Ga0207683_10033221 3300026121 Bacteria 4481
360 Ga0207683_10057109 3300026121 Bacteria 3426
361 Ga0207698_10210744 3300026142 Bacteria 1748
362 Ga0209969_1012877 3300027360 Bacteria 1208
363 Ga0209967_1004046 3300027364 Bacteria 1939
364 Ga0209981_1014621 3300027378 Bacteria 1096
365 Ga0209996_1003510 3300027395 Bacteria 1978
366 Ga0209968_1000569 3300027526 Bacteria 5714
367 Ga0209999_1000991 3300027543 Bacteria 4800
368 Ga0209970_1000622 3300027614 Bacteria 6138
369 Ga0209983_1002684 3300027665 Bacteria 3861
370 Ga0209971_1000924 3300027682 Bacteria 7567
371 Ga0209998_10002526 3300027717 Bacteria 4167
372 Ga0209974_10000553 3300027876 Bacteria 12476
373 Ga0209974_10173738 3300027876 Bacteria 786
374 Ga0207428_10000006 3300027907 Bacteria 491716
375 Ga0268266_10024065 3300028379 Bacteria 5183
376 Ga0268266_10048431 3300028379 Bacteria 3643
377 Ga0268266_10265949 3300028379 Bacteria 1590
378 Ga0268265_10012616 3300028380 Bacteria 5730
379 Ga0268264_10002139 3300028381 Bacteria 17627
380 Ga0268264_10108473 3300028381 Bacteria 2427
381 Ga0268264_10127834 3300028381 Bacteria 2248
382 Ga0307511_10009343 3300030521 Bacteria 9771
383 Ga0265328_10054782 3300031239 Bacteria 1464
384 Ga0265328_10132279 3300031239 Bacteria 934
385 Ga0265331_10086642 3300031250 Bacteria 1451
386 Ga0265316_10070150 3300031344 Bacteria 2703
387 Ga0307408_100167894 3300031548 Bacteria 1750
388 Ga0265342_10196129 3300031712 Bacteria 1100
389 Ga0316576_10031748 3300031727 Bacteria 3750
390 Ga0316576_10105538 3300031727 Bacteria 2109
391 Ga0316578_10142429 3300031728 Bacteria 1444
392 Ga0307405_10274484 3300031731 Bacteria 1266
393 Ga0307410_10436834 3300031852 Bacteria 1065
394 Ga0307412_10510246 3300031911 Bacteria 1003
395 Ga0307409_100935141 3300031995 Unclassified 882
396 Ga0316593_10001612 3300032168 Bacteria 5043
397 Ga0316592_1001061 3300033524 Bacteria 4289
398 Ga0316588_1001368 3300033528 Bacteria 3965
399 Ga0316596_1001657 3300033541 Bacteria 4585
400 Ga0373926_0065784 3300035083 Bacteria 1327
401 Ga0373932_0000892 3300035112 Bacteria 8739
402 Ga0373954_0153240 3300035118 Bacteria 1126
403 Ga0373943_0005573 3300035170 Bacteria 5653
404 Ga0373943_0024063 3300035170 Bacteria 2838
405 Ga0373943_0026247 3300035170 Bacteria 2729
406 Ga0373943_0038288 3300035170 Bacteria 2305
407 Ga0373946_0039005 3300035171 Bacteria 1937
408 Ga0373955_0165806 3300035172 Bacteria 1306
409 Ga0316574_0083150 3300035398 Bacteria 2035
410 Ga0373924_0102490 3300035410 Bacteria 1232
411 Ga0373935_0047294 3300035692 Bacteria 2720
412 Ga0373933_0014123 3300035724 Bacteria 4435
413 Ga0373937_0209302 3300036401 Bacteria 1835
414 Ga0373937_0340483 3300036401 Bacteria 1420
415 Ga0316582_0033233 3300036647 Bacteria 3167
416 Ga0316584_0078949 3300036712 Bacteria 2465
417 Ga0316584_0271881 3300036712 Bacteria 1233
418 Ga0373925_0003459 3300037068 Bacteria 12209
419 Ga0373925_0092687 3300037068 Bacteria 2311
420 Ga0373925_0267593 3300037068 Bacteria 1374
421 Ga0436364_0202057 3300037853 Bacteria 1371
422 Ga0400490_38000 3300038726 Bacteria 15835
423 Ga0400485_14986 3300038735 Bacteria 15723
424 Ga0400488_13418 3300038741 Bacteria 8755
425 Ga0400486_05790 3300038742 Bacteria 15744
426 Ga0400483_018255 3300039062 Bacteria 9505
427 Ga0400487_02246 3300039110 Bacteria 22294
428 Ga0400487_32123 3300039110 Bacteria 15704
429 Ga0436365_0269205 3300039437 Bacteria 10103
430 Ga0436365_0605606 3300039437 Bacteria 64934
431 Ga0436365_1657599 3300039437 Bacteria 4704
432 Ga0436363_0743676 3300039450 Bacteria 1197
433 Ga0436362_0309166 3300039453 Bacteria 15196
434 Ga0436362_0969073 3300039453 Bacteria 64846
435 Ga0451789_0814512 3300041443 Bacteria 1488
436 Ga0451802_1441562 3300041460 Bacteria 1545
437 Ga0451804_0934213 3300041463 Bacteria 973
438 Ga0451839_0501607 3300041496 Bacteria 2990
439 Ga0451577_0026601 3300042876 Bacteria 5239
440 Ga0451577_0148364 3300042876 Bacteria 2109
441 Ga0453683_0149410 3300044673 Bacteria 1476
442 Ga0453683_0243930 3300044673 Bacteria 1144
443 Ga0453684_0001061 3300044712 Bacteria 87486
444 Ga0453684_0747054 3300044712 Bacteria 1059
445 Ga0453684_1181783 3300044712 Bacteria 804
446 Ga0466959_0389225 3300045049 Bacteria 948
447 Ga0451576_0044159 3300045051 Bacteria 4700
448 Ga0451576_0138339 3300045051 Bacteria 2540
449 Ga0451576_0154747 3300045051 Bacteria 2391
450 Ga0495629_0000007 3300046459 Bacteria 358693
451 Ga0495629_0016450 3300046459 Bacteria 5310
452 Ga0495629_0223763 3300046459 Bacteria 1298
453 Ga0495629_0365968 3300046459 Bacteria 982
454 Ga0495653_0339957 3300046463 Bacteria 968
455 Ga0495580_0003149 3300046472 Bacteria 14135
456 Ga0495580_0060566 3300046472 Bacteria 2659
457 Ga0495580_0188197 3300046472 Bacteria 1424
458 Ga0495580_0538645 3300046472 Bacteria 776
459 Ga0495582_0142354 3300046473 Bacteria 1359
460 Ga0495639_0000121 3300046475 Bacteria 39571
461 Ga0495585_0035611 3300046492 Bacteria 2811
462 Ga0495620_0004391 3300046515 Bacteria 7958
463 Ga0495666_0002494 3300046526 Bacteria 9137
464 Ga0495665_0098255 3300046531 Unclassified 1537
465 Ga0495665_0099484 3300046531 Bacteria 1527
466 Ga0495640_0080883 3300046533 Bacteria 2160
467 Ga0495640_0403724 3300046533 Bacteria 839
468 Ga0495586_0001107 3300046535 Bacteria 15235
469 Ga0495586_0237474 3300046535 Bacteria 1038
470 Ga0495598_0088932 3300046537 Bacteria 1004
471 Ga0495635_0001256 3300046663 Bacteria 16963
472 Ga0495588_0346445 3300046674 Bacteria 781
473 Ga0495623_0104610 3300046679 Bacteria 1721
474 Ga0495647_0010500 3300046681 Bacteria 3155
475 Ga0495647_0017709 3300046681 Bacteria 2524
476 Ga0495647_0018329 3300046681 Bacteria 2491
477 Ga0495658_0070176 3300046683 Bacteria 2032
478 Ga0495658_0139845 3300046683 Bacteria 1480
479 Ga0495613_0093343 3300046689 Bacteria 2179
480 Ga0495613_0164981 3300046689 Bacteria 1574
481 Ga0495613_0285713 3300046689 Bacteria 1145
482 Ga0495624_0257744 3300046690 Bacteria 1054
483 Ga0495600_0039531 3300046809 Bacteria 3072
484 Ga0495581_0015277 3300047315 Bacteria 4457
485 Ga0495581_0124314 3300047315 Bacteria 1502
486 Ga0495674_0241997 3300047319 Bacteria 1487
487 Ga0495676_0004533 3300047321 Bacteria 12711
488 Ga0495680_0003482 3300047322 Bacteria 15463
489 Ga0495675_0147887 3300047444 Bacteria 1453
490 Ga0495679_023095 3300047446 Bacteria 2116
491 Ga0495684_0022313 3300047471 Bacteria 4873
492 Ga0495684_0062544 3300047471 Bacteria 2831
493 Ga0495684_0063429 3300047471 Bacteria 2809
494 Ga0495602_0195739 3300048088 Bacteria 1546
495 Ga0496101_0003778 3300048904 Bacteria 9460
496 Ga0496102_0005621 3300048905 Bacteria 10640
497 Ga0496103_0051555 3300048906 Bacteria 2547
498 Ga0496103_0063254 3300048906 Bacteria 2305
499 Ga0496104_0316229 3300048907 Bacteria 1474
500 Ga0496106_0000888 3300048909 Bacteria 21827
501 Ga0496106_0092000 3300048909 Bacteria 2342
502 Ga0496106_0742919 3300048909 Bacteria 780
503 Ga0496107_0001018 3300048910 Bacteria 16746
504 Ga0496108_0088766 3300048911 Bacteria 2627
505 Ga0496108_0117399 3300048911 Bacteria 2280
506 Ga0496111_0020441 3300048914 Bacteria 4609
507 Ga0496112_0202003 3300048915 Bacteria 1947
508 Ga0496112_0531527 3300048915 Bacteria 1110
509 Ga0496113_0064340 3300048916 Bacteria 2773
510 Ga0496115_0021093 3300048918 Bacteria 5028
511 Ga0501070_0343264 3300049586 Bacteria 1213
512 Ga0501073_0001571 3300049589 Bacteria 16936
513 Ga0501074_0214188 3300049590 Bacteria 1372
514 Ga0501076_0294718 3300049592 Bacteria 1329
515 Ga0501080_0070589 3300049742 Bacteria 3249
516 Ga0501080_0212868 3300049742 Bacteria 1771
517 Ga0501081_0086410 3300049743 Bacteria 2202
518 nmdc:mga05p37_13942_c1 3300050507 Bacteria 9636
519 nmdc:mga05p37_145535_c1 3300050507 Bacteria 2902
520 nmdc:mga05p37_335068_c2 3300050507 Bacteria 1284
521 nmdc:mga05p37_3917_c1 3300050507 Bacteria 17431
522 nmdc:mga05p37_6359_c1 3300050507 Bacteria 13919
523 nmdc:mga09592_182465_c1 3300050508 Bacteria 1816
524 nmdc:mga09592_3044_c1 3300050508 Bacteria 13603
525 nmdc:mga0qj67_65344_c1 3300050509 Bacteria 2896
526 nmdc:mga06r32_159630_c1 3300050510 Bacteria 2237
527 nmdc:mga06r32_1776_c2 3300050510 Bacteria 18602
528 nmdc:mga06r32_232301_c1 3300050510 Bacteria 1832
529 nmdc:mga06r32_239593_c1 3300050510 Bacteria 1802
530 nmdc:mga06r32_307540_c1 3300050510 Bacteria 1570
531 nmdc:mga08y16_501543_c1 3300050511 Bacteria 1233
532 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
533 nmdc:mga08y16_6976_c1 3300050511 Bacteria 11845
534 nmdc:mga0n895_246816_c1 3300050512 Bacteria 1812
535 nmdc:mga0n895_281252_c1 3300050512 Bacteria 1687
536 nmdc:mga0n895_319650_c1 3300050512 Bacteria 1573
537 nmdc:mga0n895_823283_c1 3300050512 Bacteria 917
538 nmdc:mga0n895_84154_c1 3300050512 Bacteria 3174
539 nmdc:mga0rr50_151479_c1 3300050513 Bacteria 1874
540 nmdc:mga0rr50_161_c1 3300050513 Bacteria 36290
541 nmdc:mga0rr50_425628_c1 3300050513 Bacteria 1123
542 nmdc:mga08x19_12478_c1 3300050514 Bacteria 5121
543 nmdc:mga08x19_279707_c1 3300050514 Bacteria 1156
544 nmdc:mga0a205_135125_c1 3300050515 Bacteria 2367
545 nmdc:mga0a205_217771_c1 3300050515 Bacteria 1796
546 nmdc:mga0a205_6528_c1 3300050515 Bacteria 10547
547 Ga0495655_0000225 3300053083 Bacteria 10607
548 Ga0495619_0009510 3300053085 Bacteria 6133
549 Ga0501084_0130004 3300054114 Bacteria 2120
550 Ga0587101_033132 3300059623 Bacteria 816
551 Ga0587076_029326 3300059645 Bacteria 965
552 Ga0501082_0204266 3300060353 Bacteria 1719
553 Ga0530510_0235344 3300061734 Bacteria 1363

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10142197 Ga0065715_101421972 206
2 3300005295 Ga0065707_10035388 Ga0065707_100353882 206
3 3300005336 Ga0070680_100114817 Ga0070680_1001148172 206
4 3300005338 Ga0068868_100091473 Ga0068868_1000914733 206
5 3300005343 Ga0070687_100075125 Ga0070687_1000751253 206
6 3300005345 Ga0070692_10084075 Ga0070692_100840751 206
7 3300005345 Ga0070692_10084192 Ga0070692_100841921 206
8 3300005406 Ga0070703_10000669 Ga0070703_100006694 206
9 3300005444 Ga0070694_100016002 Ga0070694_1000160021 206
10 3300005444 Ga0070694_100117297 Ga0070694_1001172973 206
11 3300005445 Ga0070708_100369829 Ga0070708_1003698291 206
12 3300005467 Ga0070706_100047280 Ga0070706_1000472803 206
13 3300005471 Ga0070698_100100026 Ga0070698_1001000262 206
14 3300005545 Ga0070695_100391313 Ga0070695_1003913131 206
15 3300005546 Ga0070696_100057640 Ga0070696_1000576403 206
16 3300005546 Ga0070696_100082185 Ga0070696_1000821852 206
17 3300005549 Ga0070704_100135448 Ga0070704_1001354481 206
18 3300005549 Ga0070704_100146613 Ga0070704_1001466131 206
19 3300005577 Ga0068857_100151752 Ga0068857_1001517522 206
20 3300005719 Ga0068861_100488495 Ga0068861_1004884952 206
21 3300005840 Ga0068870_10046539 Ga0068870_100465392 206
22 3300006852 Ga0075433_10329303 Ga0075433_103293032 206
23 3300009094 Ga0111539_10503875 Ga0111539_105038752 206
24 3300009098 Ga0105245_10698338 Ga0105245_106983382 206
25 3300025910 Ga0207684_10038141 Ga0207684_100381415 206
26 3300027360 Ga0209969_1012877 Ga0209969_10128772 215
27 3300005329 Ga0070683_100000118 Ga0070683_10000011834 216
28 3300005331 Ga0070670_100005117 Ga0070670_10000511718 216
29 3300005338 Ga0068868_100000927 Ga0068868_10000092725 216
30 3300005445 Ga0070708_100008735 Ga0070708_1000087355 216
31 3300005535 Ga0070684_100004380 Ga0070684_1000043804 216
32 3300005549 Ga0070704_100234866 Ga0070704_1002348662 216
33 3300005618 Ga0068864_100394802 Ga0068864_1003948022 216
34 3300006847 Ga0075431_100067235 Ga0075431_1000672353 216
35 3300006880 Ga0075429_100000951 Ga0075429_1000009517 216
36 3300009098 Ga0105245_10002811 Ga0105245_100028114 216
37 3300009147 Ga0114129_10024295 Ga0114129_100242955 216
38 3300009147 Ga0114129_10280809 Ga0114129_102808092 216
39 3300009551 Ga0105238_10000002 Ga0105238_10000002369 216
40 3300013105 Ga0157369_10000363 Ga0157369_100003636 216
41 3300013296 Ga0157374_10000016 Ga0157374_1000001642 216
42 3300013308 Ga0157375_10061602 Ga0157375_100616025 216
43 3300014745 Ga0157377_10000026 Ga0157377_100000263 216
44 3300014969 Ga0157376_10000018 Ga0157376_1000001822 216
45 3300021384 Ga0213876_10000009 Ga0213876_1000000982 216
46 3300025924 Ga0207694_10000001 Ga0207694_10000001370 216
47 3300025925 Ga0207650_10001851 Ga0207650_1000185114 216
48 3300025927 Ga0207687_10000009 Ga0207687_10000009182 216
49 3300025944 Ga0207661_10000015 Ga0207661_10000015218 216
50 3300026023 Ga0207677_10000017 Ga0207677_10000017127 216
51 3300039437 Ga0436365_0605606 Ga0436365_0605606_56030_56737 216
52 3300039453 Ga0436362_0309166 Ga0436362_0309166_11512_12219 216
53 3300050507 nmdc:mga05p37_6359_c1 nmdc:mga05p37_6359_c1_2105_2827 216
54 3300050508 nmdc:mga09592_3044_c1 nmdc:mga09592_3044_c1_10749_11471 216
55 3300050510 nmdc:mga06r32_159630_c1 nmdc:mga06r32_159630_c1_933_1655 216
56 3300036401 Ga0373937_0340483 Ga0373937_0340483_315_1022 217
57 3300046463 Ga0495653_0339957 Ga0495653_0339957_186_893 217
58 3300046679 Ga0495623_0104610 Ga0495623_0104610_203_910 217
59 3300048088 Ga0495602_0195739 Ga0495602_0195739_294_1001 217
60 3300005440 Ga0070705_100479465 Ga0070705_1004794651 218
61 3300005444 Ga0070694_100486631 Ga0070694_1004866312 218
62 3300005536 Ga0070697_100287442 Ga0070697_1002874421 218
63 3300014325 Ga0163163_10082481 Ga0163163_100824814 218
64 3300025945 Ga0207679_10406642 Ga0207679_104066422 218
65 3300005328 Ga0070676_10172489 Ga0070676_101724892 220
66 3300005466 Ga0070685_10026972 Ga0070685_100269721 220
67 3300014745 Ga0157377_10000370 Ga0157377_100003705 220
68 3300025907 Ga0207645_10128356 Ga0207645_101283563 220
69 3300025942 Ga0207689_10067634 Ga0207689_100676342 220
70 3300026118 Ga0207675_100271865 Ga0207675_1002718653 220
71 3300031852 Ga0307410_10436834 Ga0307410_104368342 220
72 3300030521 Ga0307511_10009343 Ga0307511_100093436 221
73 3300041496 Ga0451839_0501607 Ga0451839_0501607_409_1116 221
74 3300005468 Ga0070707_100122006 Ga0070707_1001220061 226
75 3300021358 Ga0213873_10000001 Ga0213873_1000000152 226
76 3300021384 Ga0213876_10000037 Ga0213876_1000003752 226
77 3300039437 Ga0436365_0269205 Ga0436365_0269205_2389_3090 226
78 3300039453 Ga0436362_0969073 Ga0436362_0969073_55998_56699 226
79 3300059623 Ga0587101_033132 Ga0587101_033132_83_784 226
80 3300031995 Ga0307409_100935141 Ga0307409_1009351411 228
81 3300033528 Ga0316588_1001368 Ga0316588_10013684 228
82 3300005435 Ga0070714_100028589 Ga0070714_1000285896 229
83 3300031239 Ga0265328_10132279 Ga0265328_101322791 229
84 3300031344 Ga0265316_10070150 Ga0265316_100701503 229
85 3300031727 Ga0316576_10031748 Ga0316576_100317484 229
86 3300035118 Ga0373954_0153240 Ga0373954_0153240_15_707 229
87 3300035724 Ga0373933_0014123 Ga0373933_0014123_2841_3533 229
88 3300036401 Ga0373937_0209302 Ga0373937_0209302_976_1668 229
89 3300041463 Ga0451804_0934213 Ga0451804_0934213_46_738 229
90 3300047444 Ga0495675_0147887 Ga0495675_0147887_288_980 229
91 3300005455 Ga0070663_100430826 Ga0070663_1004308262 230
92 3300031727 Ga0316576_10105538 Ga0316576_101055383 230
93 3300031728 Ga0316578_10142429 Ga0316578_101424291 230
94 3300032168 Ga0316593_10001612 Ga0316593_100016123 230
95 3300033524 Ga0316592_1001061 Ga0316592_10010616 230
96 3300033541 Ga0316596_1001657 Ga0316596_10016574 230
97 3300035398 Ga0316574_0083150 Ga0316574_0083150_1024_1719 230
98 3300036647 Ga0316582_0033233 Ga0316582_0033233_629_1324 230
99 3300036712 Ga0316584_0078949 Ga0316584_0078949_1136_1831 230
100 3300036712 Ga0316584_0271881 Ga0316584_0271881_107_814 230
101 3300038726 Ga0400490_38000 Ga0400490_38000_13297_13992 230
102 3300038735 Ga0400485_14986 Ga0400485_14986_13213_13929 230
103 3300038741 Ga0400488_13418 Ga0400488_13418_6439_7134 230
104 3300038742 Ga0400486_05790 Ga0400486_05790_13234_13950 230
105 3300039062 Ga0400483_018255 Ga0400483_018255_5678_6373 230
106 3300039110 Ga0400487_02246 Ga0400487_02246_1781_2497 230
107 3300039110 Ga0400487_32123 Ga0400487_32123_1782_2477 230
108 3300041443 Ga0451789_0814512 Ga0451789_0814512_473_1171 230
109 3300041460 Ga0451802_1441562 Ga0451802_1441562_661_1359 230
110 3300002076 JGI24749J21850_1019576 JGI24749J21850_10195762 231
111 3300003371 JGI26145J50221_1002425 JGI26145J50221_10024253 231
112 3300005289 Ga0065704_10007935 Ga0065704_100079352 231
113 3300005293 Ga0065715_10151325 Ga0065715_101513252 231
114 3300005293 Ga0065715_10213728 Ga0065715_102137282 231
115 3300005295 Ga0065707_10168329 Ga0065707_101683292 231
116 3300005327 Ga0070658_10020602 Ga0070658_1002060211 231
117 3300005328 Ga0070676_10023017 Ga0070676_100230174 231
118 3300005330 Ga0070690_100000715 Ga0070690_1000007157 231
119 3300005331 Ga0070670_100104615 Ga0070670_1001046154 231
120 3300005333 Ga0070677_10000509 Ga0070677_100005096 231
121 3300005334 Ga0068869_100030964 Ga0068869_1000309644 231
122 3300005334 Ga0068869_100043571 Ga0068869_1000435712 231
123 3300005334 Ga0068869_100164420 Ga0068869_1001644202 231
124 3300005335 Ga0070666_10007087 Ga0070666_100070874 231
125 3300005335 Ga0070666_10024889 Ga0070666_100248897 231
126 3300005337 Ga0070682_100000004 Ga0070682_1000000048 231
127 3300005337 Ga0070682_100160991 Ga0070682_1001609913 231
128 3300005338 Ga0068868_100006109 Ga0068868_10000610912 231
129 3300005338 Ga0068868_100445305 Ga0068868_1004453052 231
130 3300005343 Ga0070687_100237025 Ga0070687_1002370252 231
131 3300005343 Ga0070687_100279441 Ga0070687_1002794411 231
132 3300005344 Ga0070661_100135339 Ga0070661_1001353392 231
133 3300005344 Ga0070661_100422374 Ga0070661_1004223742 231
134 3300005345 Ga0070692_10001894 Ga0070692_100018942 231
135 3300005345 Ga0070692_10003744 Ga0070692_100037442 231
136 3300005354 Ga0070675_100000019 Ga0070675_100000019139 231
137 3300005354 Ga0070675_100032065 Ga0070675_1000320654 231
138 3300005354 Ga0070675_100063190 Ga0070675_1000631904 231
139 3300005355 Ga0070671_100018596 Ga0070671_1000185964 231
140 3300005355 Ga0070671_100064281 Ga0070671_1000642813 231
141 3300005355 Ga0070671_100131995 Ga0070671_1001319953 231
142 3300005356 Ga0070674_100011990 Ga0070674_1000119905 231
143 3300005356 Ga0070674_100141971 Ga0070674_1001419713 231
144 3300005364 Ga0070673_100036810 Ga0070673_1000368104 231
145 3300005364 Ga0070673_100041919 Ga0070673_1000419194 231
146 3300005367 Ga0070667_100010865 Ga0070667_1000108657 231
147 3300005367 Ga0070667_100029890 Ga0070667_1000298903 231
148 3300005367 Ga0070667_100271420 Ga0070667_1002714202 231
149 3300005436 Ga0070713_100020740 Ga0070713_10002074011 231
150 3300005438 Ga0070701_10001087 Ga0070701_1000108714 231
151 3300005441 Ga0070700_100000023 Ga0070700_1000000237 231
152 3300005444 Ga0070694_100001347 Ga0070694_1000013471 231
153 3300005444 Ga0070694_100013152 Ga0070694_1000131524 231
154 3300005444 Ga0070694_100050865 Ga0070694_1000508655 231
155 3300005444 Ga0070694_100276159 Ga0070694_1002761591 231
156 3300005444 Ga0070694_100291713 Ga0070694_1002917132 231
157 3300005445 Ga0070708_100023317 Ga0070708_1000233172 231
158 3300005445 Ga0070708_100099202 Ga0070708_1000992022 231
159 3300005445 Ga0070708_100548058 Ga0070708_1005480582 231
160 3300005455 Ga0070663_100043942 Ga0070663_1000439424 231
161 3300005455 Ga0070663_100057999 Ga0070663_1000579994 231
162 3300005455 Ga0070663_100067244 Ga0070663_1000672442 231
163 3300005456 Ga0070678_100005784 Ga0070678_1000057845 231
164 3300005456 Ga0070678_100352952 Ga0070678_1003529522 231
165 3300005459 Ga0068867_100028469 Ga0068867_1000284694 231
166 3300005459 Ga0068867_100273427 Ga0068867_1002734272 231
167 3300005467 Ga0070706_100024463 Ga0070706_1000244633 231
168 3300005467 Ga0070706_100042452 Ga0070706_1000424524 231
169 3300005467 Ga0070706_100077441 Ga0070706_1000774414 231
170 3300005467 Ga0070706_100098251 Ga0070706_1000982514 231
171 3300005467 Ga0070706_100386484 Ga0070706_1003864842 231
172 3300005468 Ga0070707_100077037 Ga0070707_1000770372 231
173 3300005468 Ga0070707_100233630 Ga0070707_1002336302 231
174 3300005471 Ga0070698_100029948 Ga0070698_1000299484 231
175 3300005471 Ga0070698_100173503 Ga0070698_1001735031 231
176 3300005518 Ga0070699_100174109 Ga0070699_1001741092 231
177 3300005518 Ga0070699_100455157 Ga0070699_1004551572 231
178 3300005535 Ga0070684_100135642 Ga0070684_1001356422 231
179 3300005535 Ga0070684_100225836 Ga0070684_1002258361 231
180 3300005536 Ga0070697_100010304 Ga0070697_1000103044 231
181 3300005536 Ga0070697_100056398 Ga0070697_1000563985 231
182 3300005536 Ga0070697_100072171 Ga0070697_1000721716 231
183 3300005536 Ga0070697_100159513 Ga0070697_1001595132 231
184 3300005536 Ga0070697_100222181 Ga0070697_1002221812 231
185 3300005536 Ga0070697_100245185 Ga0070697_1002451852 231
186 3300005539 Ga0068853_100078497 Ga0068853_1000784974 231
187 3300005543 Ga0070672_100000645 Ga0070672_1000006454 231
188 3300005543 Ga0070672_100009524 Ga0070672_1000095247 231
189 3300005543 Ga0070672_100440940 Ga0070672_1004409402 231
190 3300005544 Ga0070686_100117370 Ga0070686_1001173703 231
191 3300005545 Ga0070695_100219880 Ga0070695_1002198802 231
192 3300005545 Ga0070695_100370983 Ga0070695_1003709831 231
193 3300005545 Ga0070695_100465121 Ga0070695_1004651212 231
194 3300005546 Ga0070696_100013240 Ga0070696_1000132407 231
195 3300005546 Ga0070696_100085798 Ga0070696_1000857985 231
196 3300005546 Ga0070696_100192349 Ga0070696_1001923492 231
197 3300005546 Ga0070696_100369671 Ga0070696_1003696711 231
198 3300005546 Ga0070696_100585324 Ga0070696_1005853241 231
199 3300005548 Ga0070665_100031052 Ga0070665_1000310524 231
200 3300005548 Ga0070665_100057140 Ga0070665_1000571402 231
201 3300005548 Ga0070665_100080240 Ga0070665_1000802404 231
202 3300005549 Ga0070704_100024986 Ga0070704_1000249864 231
203 3300005549 Ga0070704_100157809 Ga0070704_1001578091 231
204 3300005549 Ga0070704_100287416 Ga0070704_1002874162 231
205 3300005549 Ga0070704_100593210 Ga0070704_1005932102 231
206 3300005563 Ga0068855_100898123 Ga0068855_1008981232 231
207 3300005564 Ga0070664_100029833 Ga0070664_1000298336 231
208 3300005564 Ga0070664_100105624 Ga0070664_1001056242 231
209 3300005564 Ga0070664_100208778 Ga0070664_1002087782 231
210 3300005577 Ga0068857_100085364 Ga0068857_1000853643 231
211 3300005578 Ga0068854_100233583 Ga0068854_1002335832 231
212 3300005614 Ga0068856_100011643 Ga0068856_1000116437 231
213 3300005615 Ga0070702_100016630 Ga0070702_1000166305 231
214 3300005615 Ga0070702_100087415 Ga0070702_1000874153 231
215 3300005616 Ga0068852_100642814 Ga0068852_1006428142 231
216 3300005617 Ga0068859_100003783 Ga0068859_1000037837 231
217 3300005617 Ga0068859_100155418 Ga0068859_1001554182 231
218 3300005618 Ga0068864_100009374 Ga0068864_10000937410 231
219 3300005618 Ga0068864_100052072 Ga0068864_1000520724 231
220 3300005618 Ga0068864_100093789 Ga0068864_1000937894 231
221 3300005718 Ga0068866_10033142 Ga0068866_100331424 231
222 3300005718 Ga0068866_10434369 Ga0068866_104343691 231
223 3300005719 Ga0068861_100078892 Ga0068861_1000788922 231
224 3300005719 Ga0068861_100261401 Ga0068861_1002614012 231
225 3300005834 Ga0068851_10345870 Ga0068851_103458701 231
226 3300005840 Ga0068870_10057287 Ga0068870_100572872 231
227 3300005841 Ga0068863_100032041 Ga0068863_1000320415 231
228 3300005841 Ga0068863_100036843 Ga0068863_1000368437 231
229 3300005841 Ga0068863_100178518 Ga0068863_1001785183 231
230 3300005841 Ga0068863_100360149 Ga0068863_1003601492 231
231 3300005842 Ga0068858_100000126 Ga0068858_10000012680 231
232 3300005842 Ga0068858_100465033 Ga0068858_1004650331 231
233 3300005843 Ga0068860_100006092 Ga0068860_1000060926 231
234 3300005843 Ga0068860_100019789 Ga0068860_1000197894 231
235 3300005843 Ga0068860_100434822 Ga0068860_1004348222 231
236 3300005844 Ga0068862_100002514 Ga0068862_10000251410 231
237 3300005844 Ga0068862_100009052 Ga0068862_1000090525 231
238 3300005937 Ga0081455_10015825 Ga0081455_100158254 231
239 3300006028 Ga0070717_10000358 Ga0070717_1000035826 231
240 3300006028 Ga0070717_10089781 Ga0070717_100897813 231
241 3300006028 Ga0070717_10270617 Ga0070717_102706172 231
242 3300006173 Ga0070716_100096127 Ga0070716_1000961272 231
243 3300006173 Ga0070716_100185537 Ga0070716_1001855372 231
244 3300006237 Ga0097621_100145181 Ga0097621_1001451812 231
245 3300006237 Ga0097621_100231444 Ga0097621_1002314443 231
246 3300006237 Ga0097621_100614068 Ga0097621_1006140681 231
247 3300006358 Ga0068871_100080654 Ga0068871_1000806546 231
248 3300006358 Ga0068871_100486559 Ga0068871_1004865592 231
249 3300006844 Ga0075428_100025919 Ga0075428_1000259197 231
250 3300006844 Ga0075428_100040925 Ga0075428_1000409254 231
251 3300006844 Ga0075428_100281334 Ga0075428_1002813342 231
252 3300006844 Ga0075428_100303669 Ga0075428_1003036693 231
253 3300006844 Ga0075428_100816333 Ga0075428_1008163332 231
254 3300006846 Ga0075430_100091926 Ga0075430_1000919262 231
255 3300006847 Ga0075431_100001900 Ga0075431_10000190021 231
256 3300006847 Ga0075431_100061605 Ga0075431_1000616053 231
257 3300006847 Ga0075431_100251750 Ga0075431_1002517502 231
258 3300006852 Ga0075433_10045513 Ga0075433_100455135 231
259 3300006852 Ga0075433_10144724 Ga0075433_101447243 231
260 3300006871 Ga0075434_100097085 Ga0075434_1000970854 231
261 3300006871 Ga0075434_100172980 Ga0075434_1001729803 231
262 3300006871 Ga0075434_100246534 Ga0075434_1002465342 231
263 3300006881 Ga0068865_100292266 Ga0068865_1002922662 231
264 3300006914 Ga0075436_100015219 Ga0075436_1000152194 231
265 3300006931 Ga0097620_100003783 Ga0097620_1000037839 231
266 3300006931 Ga0097620_100155408 Ga0097620_1001554082 231
267 3300007076 Ga0075435_100019811 Ga0075435_1000198114 231
268 3300007076 Ga0075435_100048622 Ga0075435_1000486224 231
269 3300007265 Ga0099794_10162664 Ga0099794_101626641 231
270 3300007788 Ga0099795_10181296 Ga0099795_101812961 231
271 3300009036 Ga0105244_10033985 Ga0105244_100339853 231
272 3300009094 Ga0111539_10000004 Ga0111539_1000000484 231
273 3300009094 Ga0111539_10023336 Ga0111539_100233367 231
274 3300009094 Ga0111539_10386172 Ga0111539_103861723 231
275 3300009098 Ga0105245_10003274 Ga0105245_1000327414 231
276 3300009098 Ga0105245_10089609 Ga0105245_100896094 231
277 3300009098 Ga0105245_10300186 Ga0105245_103001862 231
278 3300009147 Ga0114129_10006614 Ga0114129_1000661410 231
279 3300009147 Ga0114129_10007335 Ga0114129_100073359 231
280 3300009147 Ga0114129_10315790 Ga0114129_103157903 231
281 3300009147 Ga0114129_10397700 Ga0114129_103977003 231
282 3300009147 Ga0114129_10441641 Ga0114129_104416412 231
283 3300009174 Ga0105241_10253614 Ga0105241_102536142 231
284 3300009176 Ga0105242_10007796 Ga0105242_1000779615 231
285 3300009177 Ga0105248_10003883 Ga0105248_100038837 231
286 3300009553 Ga0105249_10033683 Ga0105249_100336834 231
287 3300010159 Ga0099796_10083304 Ga0099796_100833042 231
288 3300013102 Ga0157371_10613965 Ga0157371_106139651 231
289 3300013296 Ga0157374_10053860 Ga0157374_100538606 231
290 3300013297 Ga0157378_10044976 Ga0157378_100449764 231
291 3300013297 Ga0157378_10055531 Ga0157378_100555314 231
292 3300013297 Ga0157378_10059344 Ga0157378_100593443 231
293 3300013297 Ga0157378_10616354 Ga0157378_106163542 231
294 3300013306 Ga0163162_10009455 Ga0163162_100094553 231
295 3300013306 Ga0163162_10024906 Ga0163162_100249064 231
296 3300013306 Ga0163162_10027719 Ga0163162_100277194 231
297 3300013306 Ga0163162_10425776 Ga0163162_104257763 231
298 3300013307 Ga0157372_10637722 Ga0157372_106377222 231
299 3300013308 Ga0157375_10001186 Ga0157375_100011866 231
300 3300013308 Ga0157375_10004506 Ga0157375_1000450619 231
301 3300013308 Ga0157375_10017011 Ga0157375_100170114 231
302 3300013308 Ga0157375_10038879 Ga0157375_100388793 231
303 3300013308 Ga0157375_10442167 Ga0157375_104421672 231
304 3300014326 Ga0157380_10023433 Ga0157380_100234334 231
305 3300014326 Ga0157380_10055375 Ga0157380_100553755 231
306 3300014745 Ga0157377_10140469 Ga0157377_101404692 231
307 3300014968 Ga0157379_10037586 Ga0157379_100375864 231
308 3300014968 Ga0157379_10737783 Ga0157379_107377831 231
309 3300014969 Ga0157376_10112587 Ga0157376_101125874 231
310 3300014969 Ga0157376_10332419 Ga0157376_103324192 231
311 3300014969 Ga0157376_11054556 Ga0157376_110545561 231
312 3300017792 Ga0163161_10127156 Ga0163161_101271562 231
313 3300020069 Ga0197907_10017840 Ga0197907_100178402 231
314 3300020076 Ga0206355_1085075 Ga0206355_10850751 231
315 3300020078 Ga0206352_10233347 Ga0206352_102333475 231
316 3300020080 Ga0206350_11532297 Ga0206350_115322971 231
317 3300020081 Ga0206354_11262369 Ga0206354_112623692 231
318 3300021384 Ga0213876_10117650 Ga0213876_101176502 231
319 3300022467 Ga0224712_10007473 Ga0224712_100074731 231
320 3300022467 Ga0224712_10116476 Ga0224712_101164762 231
321 3300025315 Ga0207697_10004944 Ga0207697_100049444 231
322 3300025728 Ga0207655_1031667 Ga0207655_10316673 231
323 3300025893 Ga0207682_10007123 Ga0207682_100071233 231
324 3300025899 Ga0207642_10008709 Ga0207642_100087091 231
325 3300025901 Ga0207688_10023503 Ga0207688_100235032 231
326 3300025903 Ga0207680_10009869 Ga0207680_100098697 231
327 3300025904 Ga0207647_10041680 Ga0207647_100416807 231
328 3300025904 Ga0207647_10118962 Ga0207647_101189623 231
329 3300025907 Ga0207645_10004788 Ga0207645_100047885 231
330 3300025908 Ga0207643_10021848 Ga0207643_100218484 231
331 3300025909 Ga0207705_10037305 Ga0207705_100373053 231
332 3300025910 Ga0207684_10028407 Ga0207684_1002840711 231
333 3300025910 Ga0207684_10033979 Ga0207684_100339797 231
334 3300025910 Ga0207684_10097226 Ga0207684_100972264 231
335 3300025910 Ga0207684_10124856 Ga0207684_101248563 231
336 3300025910 Ga0207684_10314851 Ga0207684_103148512 231
337 3300025910 Ga0207684_10348474 Ga0207684_103484742 231
338 3300025911 Ga0207654_10195966 Ga0207654_101959662 231
339 3300025913 Ga0207695_10061631 Ga0207695_100616314 231
340 3300025917 Ga0207660_10061956 Ga0207660_100619564 231
341 3300025918 Ga0207662_10148898 Ga0207662_101488981 231
342 3300025920 Ga0207649_10172390 Ga0207649_101723903 231
343 3300025922 Ga0207646_10051275 Ga0207646_100512756 231
344 3300025922 Ga0207646_10065243 Ga0207646_100652432 231
345 3300025922 Ga0207646_10118003 Ga0207646_101180034 231
346 3300025922 Ga0207646_10225698 Ga0207646_102256982 231
347 3300025922 Ga0207646_10358592 Ga0207646_103585922 231
348 3300025925 Ga0207650_10032454 Ga0207650_100324543 231
349 3300025926 Ga0207659_10000001 Ga0207659_1000000150 231
350 3300025926 Ga0207659_10043446 Ga0207659_100434464 231
351 3300025926 Ga0207659_10217814 Ga0207659_102178142 231
352 3300025927 Ga0207687_10002004 Ga0207687_100020045 231
353 3300025927 Ga0207687_10004933 Ga0207687_1000493313 231
354 3300025928 Ga0207700_10014828 Ga0207700_100148284 231
355 3300025931 Ga0207644_10001615 Ga0207644_100016154 231
356 3300025933 Ga0207706_10024888 Ga0207706_100248884 231
357 3300025934 Ga0207686_10024337 Ga0207686_100243373 231
358 3300025936 Ga0207670_10001935 Ga0207670_100019354 231
359 3300025937 Ga0207669_10010324 Ga0207669_100103245 231
360 3300025937 Ga0207669_10611716 Ga0207669_106117162 231
361 3300025938 Ga0207704_10099350 Ga0207704_100993503 231
362 3300025938 Ga0207704_10183341 Ga0207704_101833412 231
363 3300025940 Ga0207691_10002406 Ga0207691_100024067 231
364 3300025940 Ga0207691_10188850 Ga0207691_101888502 231
365 3300025941 Ga0207711_10002464 Ga0207711_1000246410 231
366 3300025941 Ga0207711_10102821 Ga0207711_101028213 231
367 3300025941 Ga0207711_10717118 Ga0207711_107171182 231
368 3300025942 Ga0207689_10016588 Ga0207689_100165884 231
369 3300025942 Ga0207689_10059495 Ga0207689_100594954 231
370 3300025945 Ga0207679_10070562 Ga0207679_100705626 231
371 3300025949 Ga0207667_10921217 Ga0207667_109212171 231
372 3300025960 Ga0207651_10003479 Ga0207651_100034794 231
373 3300025960 Ga0207651_10034634 Ga0207651_100346341 231
374 3300025961 Ga0207712_10159659 Ga0207712_101596592 231
375 3300025981 Ga0207640_10082778 Ga0207640_100827782 231
376 3300025986 Ga0207658_10020060 Ga0207658_100200607 231
377 3300025986 Ga0207658_10078118 Ga0207658_100781184 231
378 3300026023 Ga0207677_10000366 Ga0207677_1000036637 231
379 3300026035 Ga0207703_10000653 Ga0207703_100006536 231
380 3300026035 Ga0207703_10002877 Ga0207703_1000287715 231
381 3300026035 Ga0207703_10219138 Ga0207703_102191382 231
382 3300026041 Ga0207639_10000013 Ga0207639_10000013129 231
383 3300026067 Ga0207678_10029933 Ga0207678_100299337 231
384 3300026067 Ga0207678_10071984 Ga0207678_100719842 231
385 3300026067 Ga0207678_10730180 Ga0207678_107301802 231
386 3300026075 Ga0207708_10000022 Ga0207708_1000002260 231
387 3300026075 Ga0207708_10006421 Ga0207708_100064214 231
388 3300026078 Ga0207702_10008952 Ga0207702_100089527 231
389 3300026078 Ga0207702_10380259 Ga0207702_103802591 231
390 3300026088 Ga0207641_10044698 Ga0207641_100446984 231
391 3300026088 Ga0207641_10106298 Ga0207641_101062983 231
392 3300026088 Ga0207641_10156827 Ga0207641_101568272 231
393 3300026089 Ga0207648_10008001 Ga0207648_100080014 231
394 3300026089 Ga0207648_10025661 Ga0207648_100256614 231
395 3300026089 Ga0207648_10395134 Ga0207648_103951342 231
396 3300026095 Ga0207676_10000002 Ga0207676_100000021074 231
397 3300026095 Ga0207676_10017667 Ga0207676_100176677 231
398 3300026095 Ga0207676_10077878 Ga0207676_100778785 231
399 3300026116 Ga0207674_10029202 Ga0207674_100292024 231
400 3300026118 Ga0207675_100010263 Ga0207675_1000102634 231
401 3300026118 Ga0207675_100269826 Ga0207675_1002698262 231
402 3300026121 Ga0207683_10008562 Ga0207683_100085625 231
403 3300026121 Ga0207683_10033221 Ga0207683_100332214 231
404 3300026121 Ga0207683_10057109 Ga0207683_100571093 231
405 3300026142 Ga0207698_10210744 Ga0207698_102107442 231
406 3300027364 Ga0209967_1004046 Ga0209967_10040462 231
407 3300027378 Ga0209981_1014621 Ga0209981_10146212 231
408 3300027395 Ga0209996_1003510 Ga0209996_10035102 231
409 3300027526 Ga0209968_1000569 Ga0209968_10005694 231
410 3300027543 Ga0209999_1000991 Ga0209999_10009912 231
411 3300027614 Ga0209970_1000622 Ga0209970_10006225 231
412 3300027665 Ga0209983_1002684 Ga0209983_10026847 231
413 3300027682 Ga0209971_1000924 Ga0209971_10009247 231
414 3300027717 Ga0209998_10002526 Ga0209998_100025263 231
415 3300027876 Ga0209974_10000553 Ga0209974_100005536 231
416 3300027876 Ga0209974_10173738 Ga0209974_101737381 231
417 3300027907 Ga0207428_10000006 Ga0207428_1000000684 231
418 3300028379 Ga0268266_10024065 Ga0268266_100240659 231
419 3300028379 Ga0268266_10048431 Ga0268266_100484312 231
420 3300028379 Ga0268266_10265949 Ga0268266_102659492 231
421 3300028380 Ga0268265_10012616 Ga0268265_100126163 231
422 3300028381 Ga0268264_10002139 Ga0268264_1000213913 231
423 3300028381 Ga0268264_10108473 Ga0268264_101084733 231
424 3300028381 Ga0268264_10127834 Ga0268264_101278343 231
425 3300031239 Ga0265328_10054782 Ga0265328_100547822 231
426 3300031250 Ga0265331_10086642 Ga0265331_100866421 231
427 3300031548 Ga0307408_100167894 Ga0307408_1001678942 231
428 3300031712 Ga0265342_10196129 Ga0265342_101961291 231
429 3300031731 Ga0307405_10274484 Ga0307405_102744842 231
430 3300031911 Ga0307412_10510246 Ga0307412_105102461 231
431 3300035083 Ga0373926_0065784 Ga0373926_0065784_431_1129 231
432 3300035112 Ga0373932_0000892 Ga0373932_0000892_2283_2984 231
433 3300035170 Ga0373943_0005573 Ga0373943_0005573_4922_5620 231
434 3300035170 Ga0373943_0024063 Ga0373943_0024063_1076_1783 231
435 3300035170 Ga0373943_0026247 Ga0373943_0026247_606_1301 231
436 3300035170 Ga0373943_0038288 Ga0373943_0038288_15_719 231
437 3300035171 Ga0373946_0039005 Ga0373946_0039005_389_1087 231
438 3300035172 Ga0373955_0165806 Ga0373955_0165806_562_1260 231
439 3300035410 Ga0373924_0102490 Ga0373924_0102490_242_949 231
440 3300035692 Ga0373935_0047294 Ga0373935_0047294_1271_1978 231
441 3300037068 Ga0373925_0003459 Ga0373925_0003459_2273_2971 231
442 3300037068 Ga0373925_0092687 Ga0373925_0092687_221_928 231
443 3300037068 Ga0373925_0267593 Ga0373925_0267593_339_1037 231
444 3300037853 Ga0436364_0202057 Ga0436364_0202057_273_980 231
445 3300039437 Ga0436365_1657599 Ga0436365_1657599_256_957 231
446 3300039450 Ga0436363_0743676 Ga0436363_0743676_178_879 231
447 3300042876 Ga0451577_0026601 Ga0451577_0026601_4374_5081 231
448 3300042876 Ga0451577_0148364 Ga0451577_0148364_1022_1723 231
449 3300044673 Ga0453683_0149410 Ga0453683_0149410_299_1006 231
450 3300044673 Ga0453683_0243930 Ga0453683_0243930_218_919 231
451 3300044712 Ga0453684_0001061 Ga0453684_0001061_43607_44314 231
452 3300044712 Ga0453684_0747054 Ga0453684_0747054_270_965 231
453 3300044712 Ga0453684_1181783 Ga0453684_1181783_44_751 231
454 3300045049 Ga0466959_0389225 Ga0466959_0389225_86_793 231
455 3300045051 Ga0451576_0044159 Ga0451576_0044159_3309_4016 231
456 3300045051 Ga0451576_0138339 Ga0451576_0138339_1503_2204 231
457 3300045051 Ga0451576_0154747 Ga0451576_0154747_603_1298 231
458 3300046459 Ga0495629_0000007 Ga0495629_0000007_264720_265418 231
459 3300046459 Ga0495629_0016450 Ga0495629_0016450_2857_3552 231
460 3300046459 Ga0495629_0223763 Ga0495629_0223763_535_1230 231
461 3300046459 Ga0495629_0365968 Ga0495629_0365968_236_931 231
462 3300046472 Ga0495580_0003149 Ga0495580_0003149_11596_12291 231
463 3300046472 Ga0495580_0060566 Ga0495580_0060566_1015_1710 231
464 3300046472 Ga0495580_0188197 Ga0495580_0188197_96_791 231
465 3300046472 Ga0495580_0538645 Ga0495580_0538645_33_731 231
466 3300046473 Ga0495582_0142354 Ga0495582_0142354_286_981 231
467 3300046475 Ga0495639_0000121 Ga0495639_0000121_37224_37922 231
468 3300046492 Ga0495585_0035611 Ga0495585_0035611_35_733 231
469 3300046515 Ga0495620_0004391 Ga0495620_0004391_1044_1748 231
470 3300046526 Ga0495666_0002494 Ga0495666_0002494_6808_7506 231
471 3300046531 Ga0495665_0098255 Ga0495665_0098255_116_811 231
472 3300046531 Ga0495665_0099484 Ga0495665_0099484_194_889 231
473 3300046533 Ga0495640_0080883 Ga0495640_0080883_910_1608 231
474 3300046533 Ga0495640_0403724 Ga0495640_0403724_73_771 231
475 3300046535 Ga0495586_0001107 Ga0495586_0001107_1625_2323 231
476 3300046535 Ga0495586_0237474 Ga0495586_0237474_76_774 231
477 3300046537 Ga0495598_0088932 Ga0495598_0088932_38_739 231
478 3300046663 Ga0495635_0001256 Ga0495635_0001256_3127_3825 231
479 3300046674 Ga0495588_0346445 Ga0495588_0346445_61_768 231
480 3300046681 Ga0495647_0010500 Ga0495647_0010500_122_817 231
481 3300046681 Ga0495647_0017709 Ga0495647_0017709_226_933 231
482 3300046681 Ga0495647_0018329 Ga0495647_0018329_734_1432 231
483 3300046683 Ga0495658_0070176 Ga0495658_0070176_1232_1927 231
484 3300046683 Ga0495658_0139845 Ga0495658_0139845_350_1045 231
485 3300046689 Ga0495613_0093343 Ga0495613_0093343_968_1666 231
486 3300046689 Ga0495613_0164981 Ga0495613_0164981_108_806 231
487 3300046689 Ga0495613_0285713 Ga0495613_0285713_284_982 231
488 3300046690 Ga0495624_0257744 Ga0495624_0257744_10_708 231
489 3300046809 Ga0495600_0039531 Ga0495600_0039531_2239_2937 231
490 3300047315 Ga0495581_0015277 Ga0495581_0015277_2740_3438 231
491 3300047315 Ga0495581_0124314 Ga0495581_0124314_272_970 231
492 3300047319 Ga0495674_0241997 Ga0495674_0241997_596_1303 231
493 3300047321 Ga0495676_0004533 Ga0495676_0004533_10366_11064 231
494 3300047322 Ga0495680_0003482 Ga0495680_0003482_13132_13830 231
495 3300047446 Ga0495679_023095 Ga0495679_023095_1287_1988 231
496 3300047471 Ga0495684_0022313 Ga0495684_0022313_1930_2625 231
497 3300047471 Ga0495684_0062544 Ga0495684_0062544_537_1235 231
498 3300047471 Ga0495684_0063429 Ga0495684_0063429_472_1170 231
499 3300048904 Ga0496101_0003778 Ga0496101_0003778_6901_7596 231
500 3300048905 Ga0496102_0005621 Ga0496102_0005621_2941_3636 231
501 3300048906 Ga0496103_0051555 Ga0496103_0051555_550_1245 231
502 3300048906 Ga0496103_0063254 Ga0496103_0063254_1287_1982 231
503 3300048907 Ga0496104_0316229 Ga0496104_0316229_181_876 231
504 3300048909 Ga0496106_0000888 Ga0496106_0000888_19454_20149 231
505 3300048909 Ga0496106_0092000 Ga0496106_0092000_661_1356 231
506 3300048909 Ga0496106_0742919 Ga0496106_0742919_63_770 231
507 3300048910 Ga0496107_0001018 Ga0496107_0001018_1688_2383 231
508 3300048911 Ga0496108_0088766 Ga0496108_0088766_927_1622 231
509 3300048911 Ga0496108_0117399 Ga0496108_0117399_103_798 231
510 3300048914 Ga0496111_0020441 Ga0496111_0020441_1760_2455 231
511 3300048915 Ga0496112_0202003 Ga0496112_0202003_32_730 231
512 3300048915 Ga0496112_0531527 Ga0496112_0531527_131_826 231
513 3300048916 Ga0496113_0064340 Ga0496113_0064340_32_727 231
514 3300048918 Ga0496115_0021093 Ga0496115_0021093_2611_3324 231
515 3300049586 Ga0501070_0343264 Ga0501070_0343264_10_705 231
516 3300049589 Ga0501073_0001571 Ga0501073_0001571_15183_15893 231
517 3300049590 Ga0501074_0214188 Ga0501074_0214188_50_745 231
518 3300049592 Ga0501076_0294718 Ga0501076_0294718_299_994 231
519 3300049742 Ga0501080_0070589 Ga0501080_0070589_547_1257 231
520 3300049742 Ga0501080_0212868 Ga0501080_0212868_505_1200 231
521 3300049743 Ga0501081_0086410 Ga0501081_0086410_532_1227 231
522 3300050507 nmdc:mga05p37_13942_c1 nmdc:mga05p37_13942_c1_8546_9244 231
523 3300050507 nmdc:mga05p37_145535_c1 nmdc:mga05p37_145535_c1_1576_2277 231
524 3300050507 nmdc:mga05p37_335068_c2 nmdc:mga05p37_335068_c2_241_936 231
525 3300050507 nmdc:mga05p37_3917_c1 nmdc:mga05p37_3917_c1_13915_14610 231
526 3300050508 nmdc:mga09592_182465_c1 nmdc:mga09592_182465_c1_961_1674 231
527 3300050509 nmdc:mga0qj67_65344_c1 nmdc:mga0qj67_65344_c1_584_1282 231
528 3300050510 nmdc:mga06r32_1776_c2 nmdc:mga06r32_1776_c2_5245_5946 231
529 3300050510 nmdc:mga06r32_232301_c1 nmdc:mga06r32_232301_c1_123_824 231
530 3300050510 nmdc:mga06r32_239593_c1 nmdc:mga06r32_239593_c1_699_1397 231
531 3300050510 nmdc:mga06r32_307540_c1 nmdc:mga06r32_307540_c1_271_984 231
532 3300050511 nmdc:mga08y16_501543_c1 nmdc:mga08y16_501543_c1_409_1110 231
533 3300050511 nmdc:mga08y16_5_c1 nmdc:mga08y16_5_c1_676765_677466 231
534 3300050511 nmdc:mga08y16_6976_c1 nmdc:mga08y16_6976_c1_11083_11781 231
535 3300050512 nmdc:mga0n895_246816_c1 nmdc:mga0n895_246816_c1_213_908 231
536 3300050512 nmdc:mga0n895_281252_c1 nmdc:mga0n895_281252_c1_794_1495 231
537 3300050512 nmdc:mga0n895_319650_c1 nmdc:mga0n895_319650_c1_737_1438 231
538 3300050512 nmdc:mga0n895_823283_c1 nmdc:mga0n895_823283_c1_125_826 231
539 3300050512 nmdc:mga0n895_84154_c1 nmdc:mga0n895_84154_c1_1121_1816 231
540 3300050513 nmdc:mga0rr50_151479_c1 nmdc:mga0rr50_151479_c1_388_1101 231
541 3300050513 nmdc:mga0rr50_161_c1 nmdc:mga0rr50_161_c1_5350_6069 231
542 3300050513 nmdc:mga0rr50_425628_c1 nmdc:mga0rr50_425628_c1_222_917 231
543 3300050514 nmdc:mga08x19_12478_c1 nmdc:mga08x19_12478_c1_3172_3891 231
544 3300050514 nmdc:mga08x19_279707_c1 nmdc:mga08x19_279707_c1_314_1012 231
545 3300050515 nmdc:mga0a205_135125_c1 nmdc:mga0a205_135125_c1_772_1467 231
546 3300050515 nmdc:mga0a205_217771_c1 nmdc:mga0a205_217771_c1_516_1229 231
547 3300050515 nmdc:mga0a205_6528_c1 nmdc:mga0a205_6528_c1_9597_10292 231
548 3300053083 Ga0495655_0000225 Ga0495655_0000225_9393_10094 231
549 3300053085 Ga0495619_0009510 Ga0495619_0009510_3002_3700 231
550 3300054114 Ga0501084_0130004 Ga0501084_0130004_444_1139 231
551 3300059645 Ga0587076_029326 Ga0587076_029326_234_935 231
552 3300060353 Ga0501082_0204266 Ga0501082_0204266_758_1453 231
553 3300061734 Ga0530510_0235344 Ga0530510_0235344_122_817 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

64

254

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5npm-assembly1.cif.gz_A crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus 0.972 18 224
2hw8-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9718 2 224
7p7t-assembly1.cif.gz_F poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii 0.9672 5 226
4v5f-assembly1.cif.gz_BC error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9635 5 224
4qg3-assembly1.cif.gz_A crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus 0.9633 5 224
ID Description Score Start End Superfamily
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9886 73 158 3.40.50.790
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9752 18 224 3.30.190.20
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9714 18 224 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9664 73 158 3.40.50.790
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9645 18 231 3.30.190.20
ID Description Score Start End GO Terms
AF-A0A3C0R701-F1-model_v4 Ribosomal protein 0.9882 54 228 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A6A5L9H4-F1-model_v4 deleted 0.9867 29 219
AF-A0A6A5L9E3-F1-model_v4 deleted 0.9842 34 224
AF-A0A099DCT0-F1-model_v4 deleted 0.9841 67 205
AF-A0A172MJZ5-F1-model_v4 Ribosomal protein 0.984 33 190 GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
84.46 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map