F462826
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 290 | 553 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100023317|Ga0070708_1000233172 |
| Length | 268 |
| Sequence | VPPLSGSKEAESGGVAAALQKSRRLARAANTTEELLAKHGKKYRASAAKVEQRPYQLDEAVQLLKQIAYAKFNETVELSMLLGVDPKHADQMVRGTTVLPHGTGKSKRVLVIAGGDKQKEAQEAGADFVGGDDMVQKIQEGWVDFDAVIATPDMMRSVGKLGKVLGPRGLMPNPKTGTVTFDVTKALQEIKAGKVEFRVDKTSIIHVPVGKIQFTAEQLRDNASAIINAVRKAKPPAAKGKYVRTMYISSTMSPSIQLDPALAEVKEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 2 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 109 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 188 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 213 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 214 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 215 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 216 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 217 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.65 |
| Metatranscriptomes | 2.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.44 |
| Rhizosphere | 93.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1019576 | 3300002076 | Bacteria | 956 |
| 2 | JGI26145J50221_1002425 | 3300003371 | Bacteria | 1468 |
| 3 | Ga0065704_10007935 | 3300005289 | Bacteria | 2439 |
| 4 | Ga0065715_10142197 | 3300005293 | Bacteria | 1837 |
| 5 | Ga0065715_10151325 | 3300005293 | Bacteria | 1725 |
| 6 | Ga0065715_10213728 | 3300005293 | Bacteria | 1302 |
| 7 | Ga0065707_10035388 | 3300005295 | Bacteria | 1139 |
| 8 | Ga0065707_10168329 | 3300005295 | Bacteria | 1501 |
| 9 | Ga0070658_10020602 | 3300005327 | Bacteria | 5285 |
| 10 | Ga0070676_10023017 | 3300005328 | Bacteria | 3499 |
| 11 | Ga0070676_10172489 | 3300005328 | Bacteria | 1400 |
| 12 | Ga0070683_100000118 | 3300005329 | Bacteria | 51816 |
| 13 | Ga0070690_100000715 | 3300005330 | Bacteria | 17046 |
| 14 | Ga0070670_100005117 | 3300005331 | Bacteria | 11035 |
| 15 | Ga0070670_100104615 | 3300005331 | Bacteria | 2438 |
| 16 | Ga0070677_10000509 | 3300005333 | Bacteria | 13392 |
| 17 | Ga0068869_100030964 | 3300005334 | Bacteria | 3761 |
| 18 | Ga0068869_100043571 | 3300005334 | Bacteria | 3224 |
| 19 | Ga0068869_100164420 | 3300005334 | Bacteria | 1729 |
| 20 | Ga0070666_10007087 | 3300005335 | Bacteria | 6912 |
| 21 | Ga0070666_10024889 | 3300005335 | Bacteria | 3901 |
| 22 | Ga0070680_100114817 | 3300005336 | Bacteria | 2243 |
| 23 | Ga0070682_100000004 | 3300005337 | Bacteria | 388780 |
| 24 | Ga0070682_100160991 | 3300005337 | Bacteria | 1550 |
| 25 | Ga0068868_100000927 | 3300005338 | Bacteria | 19963 |
| 26 | Ga0068868_100006109 | 3300005338 | Bacteria | 8509 |
| 27 | Ga0068868_100091473 | 3300005338 | Bacteria | 2451 |
| 28 | Ga0068868_100445305 | 3300005338 | Bacteria | 1126 |
| 29 | Ga0070687_100075125 | 3300005343 | Bacteria | 1826 |
| 30 | Ga0070687_100237025 | 3300005343 | Bacteria | 1126 |
| 31 | Ga0070687_100279441 | 3300005343 | Bacteria | 1050 |
| 32 | Ga0070661_100135339 | 3300005344 | Bacteria | 1854 |
| 33 | Ga0070661_100422374 | 3300005344 | Bacteria | 1057 |
| 34 | Ga0070692_10001894 | 3300005345 | Bacteria | 7889 |
| 35 | Ga0070692_10003744 | 3300005345 | Bacteria | 6248 |
| 36 | Ga0070692_10084075 | 3300005345 | Bacteria | 1720 |
| 37 | Ga0070692_10084192 | 3300005345 | Bacteria | 1718 |
| 38 | Ga0070675_100000019 | 3300005354 | Bacteria | 173624 |
| 39 | Ga0070675_100032065 | 3300005354 | Bacteria | 4250 |
| 40 | Ga0070675_100063190 | 3300005354 | Bacteria | 3060 |
| 41 | Ga0070671_100018596 | 3300005355 | Bacteria | 5646 |
| 42 | Ga0070671_100064281 | 3300005355 | Bacteria | 3056 |
| 43 | Ga0070671_100131995 | 3300005355 | Bacteria | 2104 |
| 44 | Ga0070674_100011990 | 3300005356 | Bacteria | 5306 |
| 45 | Ga0070674_100141971 | 3300005356 | Bacteria | 1803 |
| 46 | Ga0070673_100036810 | 3300005364 | Bacteria | 3724 |
| 47 | Ga0070673_100041919 | 3300005364 | Bacteria | 3525 |
| 48 | Ga0070667_100010865 | 3300005367 | Bacteria | 7528 |
| 49 | Ga0070667_100029890 | 3300005367 | Bacteria | 4542 |
| 50 | Ga0070667_100271420 | 3300005367 | Bacteria | 1521 |
| 51 | Ga0070703_10000669 | 3300005406 | Bacteria | 11859 |
| 52 | Ga0070714_100028589 | 3300005435 | Bacteria | 4628 |
| 53 | Ga0070713_100020740 | 3300005436 | Bacteria | 5044 |
| 54 | Ga0070701_10001087 | 3300005438 | Bacteria | 9928 |
| 55 | Ga0070705_100479465 | 3300005440 | Bacteria | 940 |
| 56 | Ga0070700_100000023 | 3300005441 | Bacteria | 129791 |
| 57 | Ga0070694_100001347 | 3300005444 | Bacteria | 14324 |
| 58 | Ga0070694_100013152 | 3300005444 | Bacteria | 5164 |
| 59 | Ga0070694_100016002 | 3300005444 | Bacteria | 4720 |
| 60 | Ga0070694_100050865 | 3300005444 | Bacteria | 2795 |
| 61 | Ga0070694_100117297 | 3300005444 | Bacteria | 1905 |
| 62 | Ga0070694_100276159 | 3300005444 | Bacteria | 1279 |
| 63 | Ga0070694_100291713 | 3300005444 | Bacteria | 1247 |
| 64 | Ga0070694_100486631 | 3300005444 | Bacteria | 980 |
| 65 | Ga0070708_100008735 | 3300005445 | Bacteria | 8143 |
| 66 | Ga0070708_100023317 | 3300005445 | Bacteria | 5262 |
| 67 | Ga0070708_100099202 | 3300005445 | Bacteria | 2664 |
| 68 | Ga0070708_100369829 | 3300005445 | Bacteria | 1351 |
| 69 | Ga0070708_100548058 | 3300005445 | Bacteria | 1091 |
| 70 | Ga0070663_100043942 | 3300005455 | Bacteria | 3147 |
| 71 | Ga0070663_100057999 | 3300005455 | Bacteria | 2779 |
| 72 | Ga0070663_100067244 | 3300005455 | Bacteria | 2599 |
| 73 | Ga0070663_100430826 | 3300005455 | Bacteria | 1083 |
| 74 | Ga0070678_100005784 | 3300005456 | Bacteria | 7194 |
| 75 | Ga0070678_100352952 | 3300005456 | Bacteria | 1265 |
| 76 | Ga0068867_100028469 | 3300005459 | Bacteria | 4023 |
| 77 | Ga0068867_100273427 | 3300005459 | Bacteria | 1382 |
| 78 | Ga0070685_10026972 | 3300005466 | Bacteria | 3171 |
| 79 | Ga0070706_100024463 | 3300005467 | Bacteria | 5560 |
| 80 | Ga0070706_100042452 | 3300005467 | Bacteria | 4201 |
| 81 | Ga0070706_100047280 | 3300005467 | Bacteria | 3970 |
| 82 | Ga0070706_100077441 | 3300005467 | Bacteria | 3078 |
| 83 | Ga0070706_100098251 | 3300005467 | Bacteria | 2720 |
| 84 | Ga0070706_100386484 | 3300005467 | Bacteria | 1303 |
| 85 | Ga0070707_100077037 | 3300005468 | Bacteria | 3217 |
| 86 | Ga0070707_100122006 | 3300005468 | Bacteria | 2530 |
| 87 | Ga0070707_100233630 | 3300005468 | Bacteria | 1789 |
| 88 | Ga0070698_100029948 | 3300005471 | Bacteria | 5648 |
| 89 | Ga0070698_100100026 | 3300005471 | Bacteria | 2873 |
| 90 | Ga0070698_100173503 | 3300005471 | Bacteria | 2096 |
| 91 | Ga0070699_100174109 | 3300005518 | Bacteria | 1907 |
| 92 | Ga0070699_100455157 | 3300005518 | Bacteria | 1161 |
| 93 | Ga0070684_100004380 | 3300005535 | Bacteria | 10734 |
| 94 | Ga0070684_100135642 | 3300005535 | Bacteria | 2223 |
| 95 | Ga0070684_100225836 | 3300005535 | Bacteria | 1709 |
| 96 | Ga0070697_100010304 | 3300005536 | Bacteria | 7286 |
| 97 | Ga0070697_100056398 | 3300005536 | Bacteria | 3196 |
| 98 | Ga0070697_100072171 | 3300005536 | Bacteria | 2832 |
| 99 | Ga0070697_100159513 | 3300005536 | Bacteria | 1905 |
| 100 | Ga0070697_100222181 | 3300005536 | Bacteria | 1610 |
| 101 | Ga0070697_100245185 | 3300005536 | Bacteria | 1531 |
| 102 | Ga0070697_100287442 | 3300005536 | Bacteria | 1412 |
| 103 | Ga0068853_100078497 | 3300005539 | Bacteria | 2885 |
| 104 | Ga0070672_100000645 | 3300005543 | Bacteria | 20439 |
| 105 | Ga0070672_100009524 | 3300005543 | Bacteria | 6703 |
| 106 | Ga0070672_100440940 | 3300005543 | Bacteria | 1121 |
| 107 | Ga0070686_100117370 | 3300005544 | Bacteria | 1822 |
| 108 | Ga0070695_100219880 | 3300005545 | Bacteria | 1368 |
| 109 | Ga0070695_100370983 | 3300005545 | Bacteria | 1077 |
| 110 | Ga0070695_100391313 | 3300005545 | Bacteria | 1051 |
| 111 | Ga0070695_100465121 | 3300005545 | Bacteria | 972 |
| 112 | Ga0070696_100013240 | 3300005546 | Bacteria | 5535 |
| 113 | Ga0070696_100057640 | 3300005546 | Bacteria | 2711 |
| 114 | Ga0070696_100082185 | 3300005546 | Bacteria | 2283 |
| 115 | Ga0070696_100085798 | 3300005546 | Bacteria | 2235 |
| 116 | Ga0070696_100192349 | 3300005546 | Bacteria | 1519 |
| 117 | Ga0070696_100369671 | 3300005546 | Bacteria | 1115 |
| 118 | Ga0070696_100585324 | 3300005546 | Bacteria | 898 |
| 119 | Ga0070665_100031052 | 3300005548 | Bacteria | 5376 |
| 120 | Ga0070665_100057140 | 3300005548 | Bacteria | 3912 |
| 121 | Ga0070665_100080240 | 3300005548 | Bacteria | 3268 |
| 122 | Ga0070704_100024986 | 3300005549 | Bacteria | 3927 |
| 123 | Ga0070704_100135448 | 3300005549 | Bacteria | 1915 |
| 124 | Ga0070704_100146613 | 3300005549 | Bacteria | 1850 |
| 125 | Ga0070704_100157809 | 3300005549 | Bacteria | 1791 |
| 126 | Ga0070704_100234866 | 3300005549 | Bacteria | 1498 |
| 127 | Ga0070704_100287416 | 3300005549 | Bacteria | 1365 |
| 128 | Ga0070704_100593210 | 3300005549 | Bacteria | 973 |
| 129 | Ga0068855_100898123 | 3300005563 | Bacteria | 936 |
| 130 | Ga0070664_100029833 | 3300005564 | Bacteria | 4547 |
| 131 | Ga0070664_100105624 | 3300005564 | Bacteria | 2453 |
| 132 | Ga0070664_100208778 | 3300005564 | Bacteria | 1745 |
| 133 | Ga0068857_100085364 | 3300005577 | Bacteria | 2821 |
| 134 | Ga0068857_100151752 | 3300005577 | Bacteria | 2099 |
| 135 | Ga0068854_100233583 | 3300005578 | Bacteria | 1461 |
| 136 | Ga0068856_100011643 | 3300005614 | Bacteria | 8532 |
| 137 | Ga0070702_100016630 | 3300005615 | Bacteria | 3777 |
| 138 | Ga0070702_100087415 | 3300005615 | Bacteria | 1882 |
| 139 | Ga0068852_100642814 | 3300005616 | Bacteria | 1068 |
| 140 | Ga0068859_100003783 | 3300005617 | Bacteria | 15437 |
| 141 | Ga0068859_100155418 | 3300005617 | Bacteria | 2364 |
| 142 | Ga0068864_100009374 | 3300005618 | Bacteria | 8076 |
| 143 | Ga0068864_100052072 | 3300005618 | Bacteria | 3528 |
| 144 | Ga0068864_100093789 | 3300005618 | Bacteria | 2652 |
| 145 | Ga0068864_100394802 | 3300005618 | Bacteria | 1314 |
| 146 | Ga0068866_10033142 | 3300005718 | Bacteria | 2503 |
| 147 | Ga0068866_10434369 | 3300005718 | Bacteria | 855 |
| 148 | Ga0068861_100078892 | 3300005719 | Bacteria | 2573 |
| 149 | Ga0068861_100261401 | 3300005719 | Bacteria | 1482 |
| 150 | Ga0068861_100488495 | 3300005719 | Bacteria | 1111 |
| 151 | Ga0068851_10345870 | 3300005834 | Bacteria | 864 |
| 152 | Ga0068870_10046539 | 3300005840 | Bacteria | 2275 |
| 153 | Ga0068870_10057287 | 3300005840 | Bacteria | 2083 |
| 154 | Ga0068863_100032041 | 3300005841 | Bacteria | 5013 |
| 155 | Ga0068863_100036843 | 3300005841 | Bacteria | 4658 |
| 156 | Ga0068863_100178518 | 3300005841 | Bacteria | 2038 |
| 157 | Ga0068863_100360149 | 3300005841 | Bacteria | 1418 |
| 158 | Ga0068858_100000126 | 3300005842 | Bacteria | 79740 |
| 159 | Ga0068858_100465033 | 3300005842 | Bacteria | 1220 |
| 160 | Ga0068860_100006092 | 3300005843 | Bacteria | 12136 |
| 161 | Ga0068860_100019789 | 3300005843 | Bacteria | 6526 |
| 162 | Ga0068860_100434822 | 3300005843 | Bacteria | 1303 |
| 163 | Ga0068862_100002514 | 3300005844 | Bacteria | 16227 |
| 164 | Ga0068862_100009052 | 3300005844 | Bacteria | 8243 |
| 165 | Ga0081455_10015825 | 3300005937 | Bacteria | 7305 |
| 166 | Ga0070717_10000358 | 3300006028 | Bacteria | 29359 |
| 167 | Ga0070717_10089781 | 3300006028 | Bacteria | 2592 |
| 168 | Ga0070717_10270617 | 3300006028 | Bacteria | 1505 |
| 169 | Ga0070716_100096127 | 3300006173 | Bacteria | 1805 |
| 170 | Ga0070716_100185537 | 3300006173 | Bacteria | 1370 |
| 171 | Ga0097621_100145181 | 3300006237 | Bacteria | 2031 |
| 172 | Ga0097621_100231444 | 3300006237 | Bacteria | 1613 |
| 173 | Ga0097621_100614068 | 3300006237 | Bacteria | 995 |
| 174 | Ga0068871_100080654 | 3300006358 | Bacteria | 2694 |
| 175 | Ga0068871_100486559 | 3300006358 | Bacteria | 1111 |
| 176 | Ga0075428_100025919 | 3300006844 | Bacteria | 6493 |
| 177 | Ga0075428_100040925 | 3300006844 | Bacteria | 5096 |
| 178 | Ga0075428_100281334 | 3300006844 | Bacteria | 1790 |
| 179 | Ga0075428_100303669 | 3300006844 | Bacteria | 1716 |
| 180 | Ga0075428_100816333 | 3300006844 | Bacteria | 991 |
| 181 | Ga0075430_100091926 | 3300006846 | Bacteria | 2537 |
| 182 | Ga0075431_100001900 | 3300006847 | Bacteria | 19822 |
| 183 | Ga0075431_100061605 | 3300006847 | Bacteria | 3871 |
| 184 | Ga0075431_100067235 | 3300006847 | Bacteria | 3699 |
| 185 | Ga0075431_100251750 | 3300006847 | Bacteria | 1795 |
| 186 | Ga0075433_10045513 | 3300006852 | Bacteria | 3815 |
| 187 | Ga0075433_10144724 | 3300006852 | Bacteria | 2113 |
| 188 | Ga0075433_10329303 | 3300006852 | Bacteria | 1351 |
| 189 | Ga0075434_100097085 | 3300006871 | Bacteria | 2951 |
| 190 | Ga0075434_100172980 | 3300006871 | Bacteria | 2179 |
| 191 | Ga0075434_100246534 | 3300006871 | Bacteria | 1806 |
| 192 | Ga0075429_100000951 | 3300006880 | Bacteria | 22943 |
| 193 | Ga0068865_100292266 | 3300006881 | Bacteria | 1301 |
| 194 | Ga0075436_100015219 | 3300006914 | Bacteria | 5268 |
| 195 | Ga0097620_100003783 | 3300006931 | Bacteria | 15437 |
| 196 | Ga0097620_100155408 | 3300006931 | Bacteria | 2364 |
| 197 | Ga0075435_100019811 | 3300007076 | Bacteria | 5145 |
| 198 | Ga0075435_100048622 | 3300007076 | Bacteria | 3408 |
| 199 | Ga0099794_10162664 | 3300007265 | Bacteria | 1136 |
| 200 | Ga0099795_10181296 | 3300007788 | Bacteria | 880 |
| 201 | Ga0105244_10033985 | 3300009036 | Bacteria | 2686 |
| 202 | Ga0111539_10000004 | 3300009094 | Bacteria | 751278 |
| 203 | Ga0111539_10023336 | 3300009094 | Bacteria | 7601 |
| 204 | Ga0111539_10386172 | 3300009094 | Bacteria | 1630 |
| 205 | Ga0111539_10503875 | 3300009094 | Bacteria | 1410 |
| 206 | Ga0105245_10002811 | 3300009098 | Bacteria | 15656 |
| 207 | Ga0105245_10003274 | 3300009098 | Bacteria | 14536 |
| 208 | Ga0105245_10089609 | 3300009098 | Bacteria | 2828 |
| 209 | Ga0105245_10300186 | 3300009098 | Bacteria | 1576 |
| 210 | Ga0105245_10698338 | 3300009098 | Bacteria | 1048 |
| 211 | Ga0114129_10006614 | 3300009147 | Bacteria | 16457 |
| 212 | Ga0114129_10007335 | 3300009147 | Bacteria | 15696 |
| 213 | Ga0114129_10024295 | 3300009147 | Bacteria | 8586 |
| 214 | Ga0114129_10280809 | 3300009147 | Bacteria | 2225 |
| 215 | Ga0114129_10315790 | 3300009147 | Bacteria | 2078 |
| 216 | Ga0114129_10397700 | 3300009147 | Bacteria | 1816 |
| 217 | Ga0114129_10441641 | 3300009147 | Bacteria | 1708 |
| 218 | Ga0105241_10253614 | 3300009174 | Bacteria | 1493 |
| 219 | Ga0105242_10007796 | 3300009176 | Bacteria | 8240 |
| 220 | Ga0105248_10003883 | 3300009177 | Bacteria | 16522 |
| 221 | Ga0105238_10000002 | 3300009551 | Bacteria | 772711 |
| 222 | Ga0105249_10033683 | 3300009553 | Bacteria | 4639 |
| 223 | Ga0099796_10083304 | 3300010159 | Bacteria | 1176 |
| 224 | Ga0157371_10613965 | 3300013102 | Bacteria | 810 |
| 225 | Ga0157369_10000363 | 3300013105 | Bacteria | 60464 |
| 226 | Ga0157374_10000016 | 3300013296 | Bacteria | 293656 |
| 227 | Ga0157374_10053860 | 3300013296 | Bacteria | 3752 |
| 228 | Ga0157378_10044976 | 3300013297 | Bacteria | 3922 |
| 229 | Ga0157378_10055531 | 3300013297 | Bacteria | 3528 |
| 230 | Ga0157378_10059344 | 3300013297 | Bacteria | 3413 |
| 231 | Ga0157378_10616354 | 3300013297 | Bacteria | 1098 |
| 232 | Ga0163162_10009455 | 3300013306 | Bacteria | 9479 |
| 233 | Ga0163162_10024906 | 3300013306 | Bacteria | 5912 |
| 234 | Ga0163162_10027719 | 3300013306 | Bacteria | 5603 |
| 235 | Ga0163162_10425776 | 3300013306 | Bacteria | 1459 |
| 236 | Ga0157372_10637722 | 3300013307 | Bacteria | 1241 |
| 237 | Ga0157375_10001186 | 3300013308 | Bacteria | 22482 |
| 238 | Ga0157375_10004506 | 3300013308 | Bacteria | 12112 |
| 239 | Ga0157375_10017011 | 3300013308 | Bacteria | 6550 |
| 240 | Ga0157375_10038879 | 3300013308 | Bacteria | 4572 |
| 241 | Ga0157375_10061602 | 3300013308 | Bacteria | 3726 |
| 242 | Ga0157375_10442167 | 3300013308 | Bacteria | 1466 |
| 243 | Ga0163163_10082481 | 3300014325 | Bacteria | 3219 |
| 244 | Ga0157380_10023433 | 3300014326 | Bacteria | 4657 |
| 245 | Ga0157380_10055375 | 3300014326 | Bacteria | 3150 |
| 246 | Ga0157377_10000026 | 3300014745 | Bacteria | 138648 |
| 247 | Ga0157377_10000370 | 3300014745 | Bacteria | 20086 |
| 248 | Ga0157377_10140469 | 3300014745 | Bacteria | 1484 |
| 249 | Ga0157379_10037586 | 3300014968 | Bacteria | 4318 |
| 250 | Ga0157379_10737783 | 3300014968 | Unclassified | 926 |
| 251 | Ga0157376_10000018 | 3300014969 | Bacteria | 259397 |
| 252 | Ga0157376_10112587 | 3300014969 | Bacteria | 2398 |
| 253 | Ga0157376_10332419 | 3300014969 | Bacteria | 1448 |
| 254 | Ga0157376_11054556 | 3300014969 | Bacteria | 837 |
| 255 | Ga0163161_10127156 | 3300017792 | Bacteria | 1920 |
| 256 | Ga0197907_10017840 | 3300020069 | Bacteria | 1135 |
| 257 | Ga0206355_1085075 | 3300020076 | Bacteria | 746 |
| 258 | Ga0206352_10233347 | 3300020078 | Bacteria | 2872 |
| 259 | Ga0206350_11532297 | 3300020080 | Bacteria | 1047 |
| 260 | Ga0206354_11262369 | 3300020081 | Bacteria | 1100 |
| 261 | Ga0213873_10000001 | 3300021358 | Bacteria | 1657979 |
| 262 | Ga0213876_10000009 | 3300021384 | Bacteria | 496136 |
| 263 | Ga0213876_10000037 | 3300021384 | Bacteria | 185653 |
| 264 | Ga0213876_10117650 | 3300021384 | Bacteria | 1410 |
| 265 | Ga0224712_10007473 | 3300022467 | Bacteria | 3185 |
| 266 | Ga0224712_10116476 | 3300022467 | Bacteria | 1152 |
| 267 | Ga0207697_10004944 | 3300025315 | Bacteria | 6284 |
| 268 | Ga0207655_1031667 | 3300025728 | Bacteria | 2432 |
| 269 | Ga0207682_10007123 | 3300025893 | Bacteria | 4477 |
| 270 | Ga0207642_10008709 | 3300025899 | Bacteria | 3497 |
| 271 | Ga0207688_10023503 | 3300025901 | Bacteria | 3376 |
| 272 | Ga0207680_10009869 | 3300025903 | Bacteria | 4754 |
| 273 | Ga0207647_10041680 | 3300025904 | Bacteria | 2885 |
| 274 | Ga0207647_10118962 | 3300025904 | Bacteria | 1558 |
| 275 | Ga0207645_10004788 | 3300025907 | Bacteria | 9949 |
| 276 | Ga0207645_10128356 | 3300025907 | Bacteria | 1649 |
| 277 | Ga0207643_10021848 | 3300025908 | Bacteria | 3520 |
| 278 | Ga0207705_10037305 | 3300025909 | Bacteria | 3478 |
| 279 | Ga0207684_10028407 | 3300025910 | Bacteria | 4766 |
| 280 | Ga0207684_10033979 | 3300025910 | Bacteria | 4336 |
| 281 | Ga0207684_10038141 | 3300025910 | Bacteria | 4078 |
| 282 | Ga0207684_10097226 | 3300025910 | Bacteria | 2514 |
| 283 | Ga0207684_10124856 | 3300025910 | Bacteria | 2208 |
| 284 | Ga0207684_10314851 | 3300025910 | Bacteria | 1349 |
| 285 | Ga0207684_10348474 | 3300025910 | Bacteria | 1275 |
| 286 | Ga0207654_10195966 | 3300025911 | Bacteria | 1327 |
| 287 | Ga0207695_10061631 | 3300025913 | Bacteria | 3876 |
| 288 | Ga0207660_10061956 | 3300025917 | Bacteria | 2694 |
| 289 | Ga0207662_10148898 | 3300025918 | Bacteria | 1487 |
| 290 | Ga0207649_10172390 | 3300025920 | Bacteria | 1508 |
| 291 | Ga0207646_10051275 | 3300025922 | Bacteria | 3693 |
| 292 | Ga0207646_10065243 | 3300025922 | Bacteria | 3250 |
| 293 | Ga0207646_10118003 | 3300025922 | Bacteria | 2383 |
| 294 | Ga0207646_10225698 | 3300025922 | Bacteria | 1692 |
| 295 | Ga0207646_10358592 | 3300025922 | Bacteria | 1317 |
| 296 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 297 | Ga0207650_10001851 | 3300025925 | Bacteria | 14917 |
| 298 | Ga0207650_10032454 | 3300025925 | Bacteria | 3777 |
| 299 | Ga0207659_10000001 | 3300025926 | Bacteria | 660958 |
| 300 | Ga0207659_10043446 | 3300025926 | Bacteria | 3156 |
| 301 | Ga0207659_10217814 | 3300025926 | Bacteria | 1533 |
| 302 | Ga0207687_10000009 | 3300025927 | Bacteria | 443946 |
| 303 | Ga0207687_10002004 | 3300025927 | Bacteria | 14005 |
| 304 | Ga0207687_10004933 | 3300025927 | Bacteria | 8859 |
| 305 | Ga0207700_10014828 | 3300025928 | Bacteria | 5119 |
| 306 | Ga0207644_10001615 | 3300025931 | Bacteria | 14550 |
| 307 | Ga0207706_10024888 | 3300025933 | Bacteria | 5366 |
| 308 | Ga0207686_10024337 | 3300025934 | Bacteria | 3508 |
| 309 | Ga0207670_10001935 | 3300025936 | Bacteria | 10844 |
| 310 | Ga0207669_10010324 | 3300025937 | Bacteria | 4491 |
| 311 | Ga0207669_10611716 | 3300025937 | Bacteria | 887 |
| 312 | Ga0207704_10099350 | 3300025938 | Bacteria | 1936 |
| 313 | Ga0207704_10183341 | 3300025938 | Bacteria | 1515 |
| 314 | Ga0207691_10002406 | 3300025940 | Bacteria | 18319 |
| 315 | Ga0207691_10188850 | 3300025940 | Bacteria | 1798 |
| 316 | Ga0207711_10002464 | 3300025941 | Bacteria | 16513 |
| 317 | Ga0207711_10102821 | 3300025941 | Bacteria | 2529 |
| 318 | Ga0207711_10717118 | 3300025941 | Bacteria | 933 |
| 319 | Ga0207689_10016588 | 3300025942 | Bacteria | 6232 |
| 320 | Ga0207689_10059495 | 3300025942 | Bacteria | 3142 |
| 321 | Ga0207689_10067634 | 3300025942 | Bacteria | 2936 |
| 322 | Ga0207661_10000015 | 3300025944 | Bacteria | 318960 |
| 323 | Ga0207679_10070562 | 3300025945 | Bacteria | 2632 |
| 324 | Ga0207679_10406642 | 3300025945 | Bacteria | 1198 |
| 325 | Ga0207667_10921217 | 3300025949 | Bacteria | 865 |
| 326 | Ga0207651_10003479 | 3300025960 | Bacteria | 7737 |
| 327 | Ga0207651_10034634 | 3300025960 | Bacteria | 3273 |
| 328 | Ga0207712_10159659 | 3300025961 | Bacteria | 1751 |
| 329 | Ga0207640_10082778 | 3300025981 | Bacteria | 2198 |
| 330 | Ga0207658_10020060 | 3300025986 | Bacteria | 4627 |
| 331 | Ga0207658_10078118 | 3300025986 | Bacteria | 2528 |
| 332 | Ga0207677_10000017 | 3300026023 | Bacteria | 140155 |
| 333 | Ga0207677_10000366 | 3300026023 | Bacteria | 31484 |
| 334 | Ga0207703_10000653 | 3300026035 | Bacteria | 34790 |
| 335 | Ga0207703_10002877 | 3300026035 | Bacteria | 14648 |
| 336 | Ga0207703_10219138 | 3300026035 | Bacteria | 1700 |
| 337 | Ga0207639_10000013 | 3300026041 | Bacteria | 293084 |
| 338 | Ga0207678_10029933 | 3300026067 | Bacteria | 4753 |
| 339 | Ga0207678_10071984 | 3300026067 | Bacteria | 2963 |
| 340 | Ga0207678_10730180 | 3300026067 | Bacteria | 873 |
| 341 | Ga0207708_10000022 | 3300026075 | Bacteria | 181216 |
| 342 | Ga0207708_10006421 | 3300026075 | Bacteria | 8710 |
| 343 | Ga0207702_10008952 | 3300026078 | Bacteria | 8435 |
| 344 | Ga0207702_10380259 | 3300026078 | Bacteria | 1358 |
| 345 | Ga0207641_10044698 | 3300026088 | Bacteria | 3725 |
| 346 | Ga0207641_10106298 | 3300026088 | Bacteria | 2480 |
| 347 | Ga0207641_10156827 | 3300026088 | Bacteria | 2066 |
| 348 | Ga0207648_10008001 | 3300026089 | Bacteria | 10310 |
| 349 | Ga0207648_10025661 | 3300026089 | Bacteria | 5246 |
| 350 | Ga0207648_10395134 | 3300026089 | Bacteria | 1252 |
| 351 | Ga0207676_10000002 | 3300026095 | Bacteria | 1198607 |
| 352 | Ga0207676_10017667 | 3300026095 | Bacteria | 5173 |
| 353 | Ga0207676_10077878 | 3300026095 | Bacteria | 2683 |
| 354 | Ga0207674_10029202 | 3300026116 | Bacteria | 5808 |
| 355 | Ga0207675_100010263 | 3300026118 | Bacteria | 8776 |
| 356 | Ga0207675_100269826 | 3300026118 | Bacteria | 1651 |
| 357 | Ga0207675_100271865 | 3300026118 | Bacteria | 1645 |
| 358 | Ga0207683_10008562 | 3300026121 | Bacteria | 8755 |
| 359 | Ga0207683_10033221 | 3300026121 | Bacteria | 4481 |
| 360 | Ga0207683_10057109 | 3300026121 | Bacteria | 3426 |
| 361 | Ga0207698_10210744 | 3300026142 | Bacteria | 1748 |
| 362 | Ga0209969_1012877 | 3300027360 | Bacteria | 1208 |
| 363 | Ga0209967_1004046 | 3300027364 | Bacteria | 1939 |
| 364 | Ga0209981_1014621 | 3300027378 | Bacteria | 1096 |
| 365 | Ga0209996_1003510 | 3300027395 | Bacteria | 1978 |
| 366 | Ga0209968_1000569 | 3300027526 | Bacteria | 5714 |
| 367 | Ga0209999_1000991 | 3300027543 | Bacteria | 4800 |
| 368 | Ga0209970_1000622 | 3300027614 | Bacteria | 6138 |
| 369 | Ga0209983_1002684 | 3300027665 | Bacteria | 3861 |
| 370 | Ga0209971_1000924 | 3300027682 | Bacteria | 7567 |
| 371 | Ga0209998_10002526 | 3300027717 | Bacteria | 4167 |
| 372 | Ga0209974_10000553 | 3300027876 | Bacteria | 12476 |
| 373 | Ga0209974_10173738 | 3300027876 | Bacteria | 786 |
| 374 | Ga0207428_10000006 | 3300027907 | Bacteria | 491716 |
| 375 | Ga0268266_10024065 | 3300028379 | Bacteria | 5183 |
| 376 | Ga0268266_10048431 | 3300028379 | Bacteria | 3643 |
| 377 | Ga0268266_10265949 | 3300028379 | Bacteria | 1590 |
| 378 | Ga0268265_10012616 | 3300028380 | Bacteria | 5730 |
| 379 | Ga0268264_10002139 | 3300028381 | Bacteria | 17627 |
| 380 | Ga0268264_10108473 | 3300028381 | Bacteria | 2427 |
| 381 | Ga0268264_10127834 | 3300028381 | Bacteria | 2248 |
| 382 | Ga0307511_10009343 | 3300030521 | Bacteria | 9771 |
| 383 | Ga0265328_10054782 | 3300031239 | Bacteria | 1464 |
| 384 | Ga0265328_10132279 | 3300031239 | Bacteria | 934 |
| 385 | Ga0265331_10086642 | 3300031250 | Bacteria | 1451 |
| 386 | Ga0265316_10070150 | 3300031344 | Bacteria | 2703 |
| 387 | Ga0307408_100167894 | 3300031548 | Bacteria | 1750 |
| 388 | Ga0265342_10196129 | 3300031712 | Bacteria | 1100 |
| 389 | Ga0316576_10031748 | 3300031727 | Bacteria | 3750 |
| 390 | Ga0316576_10105538 | 3300031727 | Bacteria | 2109 |
| 391 | Ga0316578_10142429 | 3300031728 | Bacteria | 1444 |
| 392 | Ga0307405_10274484 | 3300031731 | Bacteria | 1266 |
| 393 | Ga0307410_10436834 | 3300031852 | Bacteria | 1065 |
| 394 | Ga0307412_10510246 | 3300031911 | Bacteria | 1003 |
| 395 | Ga0307409_100935141 | 3300031995 | Unclassified | 882 |
| 396 | Ga0316593_10001612 | 3300032168 | Bacteria | 5043 |
| 397 | Ga0316592_1001061 | 3300033524 | Bacteria | 4289 |
| 398 | Ga0316588_1001368 | 3300033528 | Bacteria | 3965 |
| 399 | Ga0316596_1001657 | 3300033541 | Bacteria | 4585 |
| 400 | Ga0373926_0065784 | 3300035083 | Bacteria | 1327 |
| 401 | Ga0373932_0000892 | 3300035112 | Bacteria | 8739 |
| 402 | Ga0373954_0153240 | 3300035118 | Bacteria | 1126 |
| 403 | Ga0373943_0005573 | 3300035170 | Bacteria | 5653 |
| 404 | Ga0373943_0024063 | 3300035170 | Bacteria | 2838 |
| 405 | Ga0373943_0026247 | 3300035170 | Bacteria | 2729 |
| 406 | Ga0373943_0038288 | 3300035170 | Bacteria | 2305 |
| 407 | Ga0373946_0039005 | 3300035171 | Bacteria | 1937 |
| 408 | Ga0373955_0165806 | 3300035172 | Bacteria | 1306 |
| 409 | Ga0316574_0083150 | 3300035398 | Bacteria | 2035 |
| 410 | Ga0373924_0102490 | 3300035410 | Bacteria | 1232 |
| 411 | Ga0373935_0047294 | 3300035692 | Bacteria | 2720 |
| 412 | Ga0373933_0014123 | 3300035724 | Bacteria | 4435 |
| 413 | Ga0373937_0209302 | 3300036401 | Bacteria | 1835 |
| 414 | Ga0373937_0340483 | 3300036401 | Bacteria | 1420 |
| 415 | Ga0316582_0033233 | 3300036647 | Bacteria | 3167 |
| 416 | Ga0316584_0078949 | 3300036712 | Bacteria | 2465 |
| 417 | Ga0316584_0271881 | 3300036712 | Bacteria | 1233 |
| 418 | Ga0373925_0003459 | 3300037068 | Bacteria | 12209 |
| 419 | Ga0373925_0092687 | 3300037068 | Bacteria | 2311 |
| 420 | Ga0373925_0267593 | 3300037068 | Bacteria | 1374 |
| 421 | Ga0436364_0202057 | 3300037853 | Bacteria | 1371 |
| 422 | Ga0400490_38000 | 3300038726 | Bacteria | 15835 |
| 423 | Ga0400485_14986 | 3300038735 | Bacteria | 15723 |
| 424 | Ga0400488_13418 | 3300038741 | Bacteria | 8755 |
| 425 | Ga0400486_05790 | 3300038742 | Bacteria | 15744 |
| 426 | Ga0400483_018255 | 3300039062 | Bacteria | 9505 |
| 427 | Ga0400487_02246 | 3300039110 | Bacteria | 22294 |
| 428 | Ga0400487_32123 | 3300039110 | Bacteria | 15704 |
| 429 | Ga0436365_0269205 | 3300039437 | Bacteria | 10103 |
| 430 | Ga0436365_0605606 | 3300039437 | Bacteria | 64934 |
| 431 | Ga0436365_1657599 | 3300039437 | Bacteria | 4704 |
| 432 | Ga0436363_0743676 | 3300039450 | Bacteria | 1197 |
| 433 | Ga0436362_0309166 | 3300039453 | Bacteria | 15196 |
| 434 | Ga0436362_0969073 | 3300039453 | Bacteria | 64846 |
| 435 | Ga0451789_0814512 | 3300041443 | Bacteria | 1488 |
| 436 | Ga0451802_1441562 | 3300041460 | Bacteria | 1545 |
| 437 | Ga0451804_0934213 | 3300041463 | Bacteria | 973 |
| 438 | Ga0451839_0501607 | 3300041496 | Bacteria | 2990 |
| 439 | Ga0451577_0026601 | 3300042876 | Bacteria | 5239 |
| 440 | Ga0451577_0148364 | 3300042876 | Bacteria | 2109 |
| 441 | Ga0453683_0149410 | 3300044673 | Bacteria | 1476 |
| 442 | Ga0453683_0243930 | 3300044673 | Bacteria | 1144 |
| 443 | Ga0453684_0001061 | 3300044712 | Bacteria | 87486 |
| 444 | Ga0453684_0747054 | 3300044712 | Bacteria | 1059 |
| 445 | Ga0453684_1181783 | 3300044712 | Bacteria | 804 |
| 446 | Ga0466959_0389225 | 3300045049 | Bacteria | 948 |
| 447 | Ga0451576_0044159 | 3300045051 | Bacteria | 4700 |
| 448 | Ga0451576_0138339 | 3300045051 | Bacteria | 2540 |
| 449 | Ga0451576_0154747 | 3300045051 | Bacteria | 2391 |
| 450 | Ga0495629_0000007 | 3300046459 | Bacteria | 358693 |
| 451 | Ga0495629_0016450 | 3300046459 | Bacteria | 5310 |
| 452 | Ga0495629_0223763 | 3300046459 | Bacteria | 1298 |
| 453 | Ga0495629_0365968 | 3300046459 | Bacteria | 982 |
| 454 | Ga0495653_0339957 | 3300046463 | Bacteria | 968 |
| 455 | Ga0495580_0003149 | 3300046472 | Bacteria | 14135 |
| 456 | Ga0495580_0060566 | 3300046472 | Bacteria | 2659 |
| 457 | Ga0495580_0188197 | 3300046472 | Bacteria | 1424 |
| 458 | Ga0495580_0538645 | 3300046472 | Bacteria | 776 |
| 459 | Ga0495582_0142354 | 3300046473 | Bacteria | 1359 |
| 460 | Ga0495639_0000121 | 3300046475 | Bacteria | 39571 |
| 461 | Ga0495585_0035611 | 3300046492 | Bacteria | 2811 |
| 462 | Ga0495620_0004391 | 3300046515 | Bacteria | 7958 |
| 463 | Ga0495666_0002494 | 3300046526 | Bacteria | 9137 |
| 464 | Ga0495665_0098255 | 3300046531 | Unclassified | 1537 |
| 465 | Ga0495665_0099484 | 3300046531 | Bacteria | 1527 |
| 466 | Ga0495640_0080883 | 3300046533 | Bacteria | 2160 |
| 467 | Ga0495640_0403724 | 3300046533 | Bacteria | 839 |
| 468 | Ga0495586_0001107 | 3300046535 | Bacteria | 15235 |
| 469 | Ga0495586_0237474 | 3300046535 | Bacteria | 1038 |
| 470 | Ga0495598_0088932 | 3300046537 | Bacteria | 1004 |
| 471 | Ga0495635_0001256 | 3300046663 | Bacteria | 16963 |
| 472 | Ga0495588_0346445 | 3300046674 | Bacteria | 781 |
| 473 | Ga0495623_0104610 | 3300046679 | Bacteria | 1721 |
| 474 | Ga0495647_0010500 | 3300046681 | Bacteria | 3155 |
| 475 | Ga0495647_0017709 | 3300046681 | Bacteria | 2524 |
| 476 | Ga0495647_0018329 | 3300046681 | Bacteria | 2491 |
| 477 | Ga0495658_0070176 | 3300046683 | Bacteria | 2032 |
| 478 | Ga0495658_0139845 | 3300046683 | Bacteria | 1480 |
| 479 | Ga0495613_0093343 | 3300046689 | Bacteria | 2179 |
| 480 | Ga0495613_0164981 | 3300046689 | Bacteria | 1574 |
| 481 | Ga0495613_0285713 | 3300046689 | Bacteria | 1145 |
| 482 | Ga0495624_0257744 | 3300046690 | Bacteria | 1054 |
| 483 | Ga0495600_0039531 | 3300046809 | Bacteria | 3072 |
| 484 | Ga0495581_0015277 | 3300047315 | Bacteria | 4457 |
| 485 | Ga0495581_0124314 | 3300047315 | Bacteria | 1502 |
| 486 | Ga0495674_0241997 | 3300047319 | Bacteria | 1487 |
| 487 | Ga0495676_0004533 | 3300047321 | Bacteria | 12711 |
| 488 | Ga0495680_0003482 | 3300047322 | Bacteria | 15463 |
| 489 | Ga0495675_0147887 | 3300047444 | Bacteria | 1453 |
| 490 | Ga0495679_023095 | 3300047446 | Bacteria | 2116 |
| 491 | Ga0495684_0022313 | 3300047471 | Bacteria | 4873 |
| 492 | Ga0495684_0062544 | 3300047471 | Bacteria | 2831 |
| 493 | Ga0495684_0063429 | 3300047471 | Bacteria | 2809 |
| 494 | Ga0495602_0195739 | 3300048088 | Bacteria | 1546 |
| 495 | Ga0496101_0003778 | 3300048904 | Bacteria | 9460 |
| 496 | Ga0496102_0005621 | 3300048905 | Bacteria | 10640 |
| 497 | Ga0496103_0051555 | 3300048906 | Bacteria | 2547 |
| 498 | Ga0496103_0063254 | 3300048906 | Bacteria | 2305 |
| 499 | Ga0496104_0316229 | 3300048907 | Bacteria | 1474 |
| 500 | Ga0496106_0000888 | 3300048909 | Bacteria | 21827 |
| 501 | Ga0496106_0092000 | 3300048909 | Bacteria | 2342 |
| 502 | Ga0496106_0742919 | 3300048909 | Bacteria | 780 |
| 503 | Ga0496107_0001018 | 3300048910 | Bacteria | 16746 |
| 504 | Ga0496108_0088766 | 3300048911 | Bacteria | 2627 |
| 505 | Ga0496108_0117399 | 3300048911 | Bacteria | 2280 |
| 506 | Ga0496111_0020441 | 3300048914 | Bacteria | 4609 |
| 507 | Ga0496112_0202003 | 3300048915 | Bacteria | 1947 |
| 508 | Ga0496112_0531527 | 3300048915 | Bacteria | 1110 |
| 509 | Ga0496113_0064340 | 3300048916 | Bacteria | 2773 |
| 510 | Ga0496115_0021093 | 3300048918 | Bacteria | 5028 |
| 511 | Ga0501070_0343264 | 3300049586 | Bacteria | 1213 |
| 512 | Ga0501073_0001571 | 3300049589 | Bacteria | 16936 |
| 513 | Ga0501074_0214188 | 3300049590 | Bacteria | 1372 |
| 514 | Ga0501076_0294718 | 3300049592 | Bacteria | 1329 |
| 515 | Ga0501080_0070589 | 3300049742 | Bacteria | 3249 |
| 516 | Ga0501080_0212868 | 3300049742 | Bacteria | 1771 |
| 517 | Ga0501081_0086410 | 3300049743 | Bacteria | 2202 |
| 518 | nmdc:mga05p37_13942_c1 | 3300050507 | Bacteria | 9636 |
| 519 | nmdc:mga05p37_145535_c1 | 3300050507 | Bacteria | 2902 |
| 520 | nmdc:mga05p37_335068_c2 | 3300050507 | Bacteria | 1284 |
| 521 | nmdc:mga05p37_3917_c1 | 3300050507 | Bacteria | 17431 |
| 522 | nmdc:mga05p37_6359_c1 | 3300050507 | Bacteria | 13919 |
| 523 | nmdc:mga09592_182465_c1 | 3300050508 | Bacteria | 1816 |
| 524 | nmdc:mga09592_3044_c1 | 3300050508 | Bacteria | 13603 |
| 525 | nmdc:mga0qj67_65344_c1 | 3300050509 | Bacteria | 2896 |
| 526 | nmdc:mga06r32_159630_c1 | 3300050510 | Bacteria | 2237 |
| 527 | nmdc:mga06r32_1776_c2 | 3300050510 | Bacteria | 18602 |
| 528 | nmdc:mga06r32_232301_c1 | 3300050510 | Bacteria | 1832 |
| 529 | nmdc:mga06r32_239593_c1 | 3300050510 | Bacteria | 1802 |
| 530 | nmdc:mga06r32_307540_c1 | 3300050510 | Bacteria | 1570 |
| 531 | nmdc:mga08y16_501543_c1 | 3300050511 | Bacteria | 1233 |
| 532 | nmdc:mga08y16_5_c1 | 3300050511 | Bacteria | 751284 |
| 533 | nmdc:mga08y16_6976_c1 | 3300050511 | Bacteria | 11845 |
| 534 | nmdc:mga0n895_246816_c1 | 3300050512 | Bacteria | 1812 |
| 535 | nmdc:mga0n895_281252_c1 | 3300050512 | Bacteria | 1687 |
| 536 | nmdc:mga0n895_319650_c1 | 3300050512 | Bacteria | 1573 |
| 537 | nmdc:mga0n895_823283_c1 | 3300050512 | Bacteria | 917 |
| 538 | nmdc:mga0n895_84154_c1 | 3300050512 | Bacteria | 3174 |
| 539 | nmdc:mga0rr50_151479_c1 | 3300050513 | Bacteria | 1874 |
| 540 | nmdc:mga0rr50_161_c1 | 3300050513 | Bacteria | 36290 |
| 541 | nmdc:mga0rr50_425628_c1 | 3300050513 | Bacteria | 1123 |
| 542 | nmdc:mga08x19_12478_c1 | 3300050514 | Bacteria | 5121 |
| 543 | nmdc:mga08x19_279707_c1 | 3300050514 | Bacteria | 1156 |
| 544 | nmdc:mga0a205_135125_c1 | 3300050515 | Bacteria | 2367 |
| 545 | nmdc:mga0a205_217771_c1 | 3300050515 | Bacteria | 1796 |
| 546 | nmdc:mga0a205_6528_c1 | 3300050515 | Bacteria | 10547 |
| 547 | Ga0495655_0000225 | 3300053083 | Bacteria | 10607 |
| 548 | Ga0495619_0009510 | 3300053085 | Bacteria | 6133 |
| 549 | Ga0501084_0130004 | 3300054114 | Bacteria | 2120 |
| 550 | Ga0587101_033132 | 3300059623 | Bacteria | 816 |
| 551 | Ga0587076_029326 | 3300059645 | Bacteria | 965 |
| 552 | Ga0501082_0204266 | 3300060353 | Bacteria | 1719 |
| 553 | Ga0530510_0235344 | 3300061734 | Bacteria | 1363 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005293 | Ga0065715_10142197 | Ga0065715_101421972 | 206 |
| 2 | 3300005295 | Ga0065707_10035388 | Ga0065707_100353882 | 206 |
| 3 | 3300005336 | Ga0070680_100114817 | Ga0070680_1001148172 | 206 |
| 4 | 3300005338 | Ga0068868_100091473 | Ga0068868_1000914733 | 206 |
| 5 | 3300005343 | Ga0070687_100075125 | Ga0070687_1000751253 | 206 |
| 6 | 3300005345 | Ga0070692_10084075 | Ga0070692_100840751 | 206 |
| 7 | 3300005345 | Ga0070692_10084192 | Ga0070692_100841921 | 206 |
| 8 | 3300005406 | Ga0070703_10000669 | Ga0070703_100006694 | 206 |
| 9 | 3300005444 | Ga0070694_100016002 | Ga0070694_1000160021 | 206 |
| 10 | 3300005444 | Ga0070694_100117297 | Ga0070694_1001172973 | 206 |
| 11 | 3300005445 | Ga0070708_100369829 | Ga0070708_1003698291 | 206 |
| 12 | 3300005467 | Ga0070706_100047280 | Ga0070706_1000472803 | 206 |
| 13 | 3300005471 | Ga0070698_100100026 | Ga0070698_1001000262 | 206 |
| 14 | 3300005545 | Ga0070695_100391313 | Ga0070695_1003913131 | 206 |
| 15 | 3300005546 | Ga0070696_100057640 | Ga0070696_1000576403 | 206 |
| 16 | 3300005546 | Ga0070696_100082185 | Ga0070696_1000821852 | 206 |
| 17 | 3300005549 | Ga0070704_100135448 | Ga0070704_1001354481 | 206 |
| 18 | 3300005549 | Ga0070704_100146613 | Ga0070704_1001466131 | 206 |
| 19 | 3300005577 | Ga0068857_100151752 | Ga0068857_1001517522 | 206 |
| 20 | 3300005719 | Ga0068861_100488495 | Ga0068861_1004884952 | 206 |
| 21 | 3300005840 | Ga0068870_10046539 | Ga0068870_100465392 | 206 |
| 22 | 3300006852 | Ga0075433_10329303 | Ga0075433_103293032 | 206 |
| 23 | 3300009094 | Ga0111539_10503875 | Ga0111539_105038752 | 206 |
| 24 | 3300009098 | Ga0105245_10698338 | Ga0105245_106983382 | 206 |
| 25 | 3300025910 | Ga0207684_10038141 | Ga0207684_100381415 | 206 |
| 26 | 3300027360 | Ga0209969_1012877 | Ga0209969_10128772 | 215 |
| 27 | 3300005329 | Ga0070683_100000118 | Ga0070683_10000011834 | 216 |
| 28 | 3300005331 | Ga0070670_100005117 | Ga0070670_10000511718 | 216 |
| 29 | 3300005338 | Ga0068868_100000927 | Ga0068868_10000092725 | 216 |
| 30 | 3300005445 | Ga0070708_100008735 | Ga0070708_1000087355 | 216 |
| 31 | 3300005535 | Ga0070684_100004380 | Ga0070684_1000043804 | 216 |
| 32 | 3300005549 | Ga0070704_100234866 | Ga0070704_1002348662 | 216 |
| 33 | 3300005618 | Ga0068864_100394802 | Ga0068864_1003948022 | 216 |
| 34 | 3300006847 | Ga0075431_100067235 | Ga0075431_1000672353 | 216 |
| 35 | 3300006880 | Ga0075429_100000951 | Ga0075429_1000009517 | 216 |
| 36 | 3300009098 | Ga0105245_10002811 | Ga0105245_100028114 | 216 |
| 37 | 3300009147 | Ga0114129_10024295 | Ga0114129_100242955 | 216 |
| 38 | 3300009147 | Ga0114129_10280809 | Ga0114129_102808092 | 216 |
| 39 | 3300009551 | Ga0105238_10000002 | Ga0105238_10000002369 | 216 |
| 40 | 3300013105 | Ga0157369_10000363 | Ga0157369_100003636 | 216 |
| 41 | 3300013296 | Ga0157374_10000016 | Ga0157374_1000001642 | 216 |
| 42 | 3300013308 | Ga0157375_10061602 | Ga0157375_100616025 | 216 |
| 43 | 3300014745 | Ga0157377_10000026 | Ga0157377_100000263 | 216 |
| 44 | 3300014969 | Ga0157376_10000018 | Ga0157376_1000001822 | 216 |
| 45 | 3300021384 | Ga0213876_10000009 | Ga0213876_1000000982 | 216 |
| 46 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001370 | 216 |
| 47 | 3300025925 | Ga0207650_10001851 | Ga0207650_1000185114 | 216 |
| 48 | 3300025927 | Ga0207687_10000009 | Ga0207687_10000009182 | 216 |
| 49 | 3300025944 | Ga0207661_10000015 | Ga0207661_10000015218 | 216 |
| 50 | 3300026023 | Ga0207677_10000017 | Ga0207677_10000017127 | 216 |
| 51 | 3300039437 | Ga0436365_0605606 | Ga0436365_0605606_56030_56737 | 216 |
| 52 | 3300039453 | Ga0436362_0309166 | Ga0436362_0309166_11512_12219 | 216 |
| 53 | 3300050507 | nmdc:mga05p37_6359_c1 | nmdc:mga05p37_6359_c1_2105_2827 | 216 |
| 54 | 3300050508 | nmdc:mga09592_3044_c1 | nmdc:mga09592_3044_c1_10749_11471 | 216 |
| 55 | 3300050510 | nmdc:mga06r32_159630_c1 | nmdc:mga06r32_159630_c1_933_1655 | 216 |
| 56 | 3300036401 | Ga0373937_0340483 | Ga0373937_0340483_315_1022 | 217 |
| 57 | 3300046463 | Ga0495653_0339957 | Ga0495653_0339957_186_893 | 217 |
| 58 | 3300046679 | Ga0495623_0104610 | Ga0495623_0104610_203_910 | 217 |
| 59 | 3300048088 | Ga0495602_0195739 | Ga0495602_0195739_294_1001 | 217 |
| 60 | 3300005440 | Ga0070705_100479465 | Ga0070705_1004794651 | 218 |
| 61 | 3300005444 | Ga0070694_100486631 | Ga0070694_1004866312 | 218 |
| 62 | 3300005536 | Ga0070697_100287442 | Ga0070697_1002874421 | 218 |
| 63 | 3300014325 | Ga0163163_10082481 | Ga0163163_100824814 | 218 |
| 64 | 3300025945 | Ga0207679_10406642 | Ga0207679_104066422 | 218 |
| 65 | 3300005328 | Ga0070676_10172489 | Ga0070676_101724892 | 220 |
| 66 | 3300005466 | Ga0070685_10026972 | Ga0070685_100269721 | 220 |
| 67 | 3300014745 | Ga0157377_10000370 | Ga0157377_100003705 | 220 |
| 68 | 3300025907 | Ga0207645_10128356 | Ga0207645_101283563 | 220 |
| 69 | 3300025942 | Ga0207689_10067634 | Ga0207689_100676342 | 220 |
| 70 | 3300026118 | Ga0207675_100271865 | Ga0207675_1002718653 | 220 |
| 71 | 3300031852 | Ga0307410_10436834 | Ga0307410_104368342 | 220 |
| 72 | 3300030521 | Ga0307511_10009343 | Ga0307511_100093436 | 221 |
| 73 | 3300041496 | Ga0451839_0501607 | Ga0451839_0501607_409_1116 | 221 |
| 74 | 3300005468 | Ga0070707_100122006 | Ga0070707_1001220061 | 226 |
| 75 | 3300021358 | Ga0213873_10000001 | Ga0213873_1000000152 | 226 |
| 76 | 3300021384 | Ga0213876_10000037 | Ga0213876_1000003752 | 226 |
| 77 | 3300039437 | Ga0436365_0269205 | Ga0436365_0269205_2389_3090 | 226 |
| 78 | 3300039453 | Ga0436362_0969073 | Ga0436362_0969073_55998_56699 | 226 |
| 79 | 3300059623 | Ga0587101_033132 | Ga0587101_033132_83_784 | 226 |
| 80 | 3300031995 | Ga0307409_100935141 | Ga0307409_1009351411 | 228 |
| 81 | 3300033528 | Ga0316588_1001368 | Ga0316588_10013684 | 228 |
| 82 | 3300005435 | Ga0070714_100028589 | Ga0070714_1000285896 | 229 |
| 83 | 3300031239 | Ga0265328_10132279 | Ga0265328_101322791 | 229 |
| 84 | 3300031344 | Ga0265316_10070150 | Ga0265316_100701503 | 229 |
| 85 | 3300031727 | Ga0316576_10031748 | Ga0316576_100317484 | 229 |
| 86 | 3300035118 | Ga0373954_0153240 | Ga0373954_0153240_15_707 | 229 |
| 87 | 3300035724 | Ga0373933_0014123 | Ga0373933_0014123_2841_3533 | 229 |
| 88 | 3300036401 | Ga0373937_0209302 | Ga0373937_0209302_976_1668 | 229 |
| 89 | 3300041463 | Ga0451804_0934213 | Ga0451804_0934213_46_738 | 229 |
| 90 | 3300047444 | Ga0495675_0147887 | Ga0495675_0147887_288_980 | 229 |
| 91 | 3300005455 | Ga0070663_100430826 | Ga0070663_1004308262 | 230 |
| 92 | 3300031727 | Ga0316576_10105538 | Ga0316576_101055383 | 230 |
| 93 | 3300031728 | Ga0316578_10142429 | Ga0316578_101424291 | 230 |
| 94 | 3300032168 | Ga0316593_10001612 | Ga0316593_100016123 | 230 |
| 95 | 3300033524 | Ga0316592_1001061 | Ga0316592_10010616 | 230 |
| 96 | 3300033541 | Ga0316596_1001657 | Ga0316596_10016574 | 230 |
| 97 | 3300035398 | Ga0316574_0083150 | Ga0316574_0083150_1024_1719 | 230 |
| 98 | 3300036647 | Ga0316582_0033233 | Ga0316582_0033233_629_1324 | 230 |
| 99 | 3300036712 | Ga0316584_0078949 | Ga0316584_0078949_1136_1831 | 230 |
| 100 | 3300036712 | Ga0316584_0271881 | Ga0316584_0271881_107_814 | 230 |
| 101 | 3300038726 | Ga0400490_38000 | Ga0400490_38000_13297_13992 | 230 |
| 102 | 3300038735 | Ga0400485_14986 | Ga0400485_14986_13213_13929 | 230 |
| 103 | 3300038741 | Ga0400488_13418 | Ga0400488_13418_6439_7134 | 230 |
| 104 | 3300038742 | Ga0400486_05790 | Ga0400486_05790_13234_13950 | 230 |
| 105 | 3300039062 | Ga0400483_018255 | Ga0400483_018255_5678_6373 | 230 |
| 106 | 3300039110 | Ga0400487_02246 | Ga0400487_02246_1781_2497 | 230 |
| 107 | 3300039110 | Ga0400487_32123 | Ga0400487_32123_1782_2477 | 230 |
| 108 | 3300041443 | Ga0451789_0814512 | Ga0451789_0814512_473_1171 | 230 |
| 109 | 3300041460 | Ga0451802_1441562 | Ga0451802_1441562_661_1359 | 230 |
| 110 | 3300002076 | JGI24749J21850_1019576 | JGI24749J21850_10195762 | 231 |
| 111 | 3300003371 | JGI26145J50221_1002425 | JGI26145J50221_10024253 | 231 |
| 112 | 3300005289 | Ga0065704_10007935 | Ga0065704_100079352 | 231 |
| 113 | 3300005293 | Ga0065715_10151325 | Ga0065715_101513252 | 231 |
| 114 | 3300005293 | Ga0065715_10213728 | Ga0065715_102137282 | 231 |
| 115 | 3300005295 | Ga0065707_10168329 | Ga0065707_101683292 | 231 |
| 116 | 3300005327 | Ga0070658_10020602 | Ga0070658_1002060211 | 231 |
| 117 | 3300005328 | Ga0070676_10023017 | Ga0070676_100230174 | 231 |
| 118 | 3300005330 | Ga0070690_100000715 | Ga0070690_1000007157 | 231 |
| 119 | 3300005331 | Ga0070670_100104615 | Ga0070670_1001046154 | 231 |
| 120 | 3300005333 | Ga0070677_10000509 | Ga0070677_100005096 | 231 |
| 121 | 3300005334 | Ga0068869_100030964 | Ga0068869_1000309644 | 231 |
| 122 | 3300005334 | Ga0068869_100043571 | Ga0068869_1000435712 | 231 |
| 123 | 3300005334 | Ga0068869_100164420 | Ga0068869_1001644202 | 231 |
| 124 | 3300005335 | Ga0070666_10007087 | Ga0070666_100070874 | 231 |
| 125 | 3300005335 | Ga0070666_10024889 | Ga0070666_100248897 | 231 |
| 126 | 3300005337 | Ga0070682_100000004 | Ga0070682_1000000048 | 231 |
| 127 | 3300005337 | Ga0070682_100160991 | Ga0070682_1001609913 | 231 |
| 128 | 3300005338 | Ga0068868_100006109 | Ga0068868_10000610912 | 231 |
| 129 | 3300005338 | Ga0068868_100445305 | Ga0068868_1004453052 | 231 |
| 130 | 3300005343 | Ga0070687_100237025 | Ga0070687_1002370252 | 231 |
| 131 | 3300005343 | Ga0070687_100279441 | Ga0070687_1002794411 | 231 |
| 132 | 3300005344 | Ga0070661_100135339 | Ga0070661_1001353392 | 231 |
| 133 | 3300005344 | Ga0070661_100422374 | Ga0070661_1004223742 | 231 |
| 134 | 3300005345 | Ga0070692_10001894 | Ga0070692_100018942 | 231 |
| 135 | 3300005345 | Ga0070692_10003744 | Ga0070692_100037442 | 231 |
| 136 | 3300005354 | Ga0070675_100000019 | Ga0070675_100000019139 | 231 |
| 137 | 3300005354 | Ga0070675_100032065 | Ga0070675_1000320654 | 231 |
| 138 | 3300005354 | Ga0070675_100063190 | Ga0070675_1000631904 | 231 |
| 139 | 3300005355 | Ga0070671_100018596 | Ga0070671_1000185964 | 231 |
| 140 | 3300005355 | Ga0070671_100064281 | Ga0070671_1000642813 | 231 |
| 141 | 3300005355 | Ga0070671_100131995 | Ga0070671_1001319953 | 231 |
| 142 | 3300005356 | Ga0070674_100011990 | Ga0070674_1000119905 | 231 |
| 143 | 3300005356 | Ga0070674_100141971 | Ga0070674_1001419713 | 231 |
| 144 | 3300005364 | Ga0070673_100036810 | Ga0070673_1000368104 | 231 |
| 145 | 3300005364 | Ga0070673_100041919 | Ga0070673_1000419194 | 231 |
| 146 | 3300005367 | Ga0070667_100010865 | Ga0070667_1000108657 | 231 |
| 147 | 3300005367 | Ga0070667_100029890 | Ga0070667_1000298903 | 231 |
| 148 | 3300005367 | Ga0070667_100271420 | Ga0070667_1002714202 | 231 |
| 149 | 3300005436 | Ga0070713_100020740 | Ga0070713_10002074011 | 231 |
| 150 | 3300005438 | Ga0070701_10001087 | Ga0070701_1000108714 | 231 |
| 151 | 3300005441 | Ga0070700_100000023 | Ga0070700_1000000237 | 231 |
| 152 | 3300005444 | Ga0070694_100001347 | Ga0070694_1000013471 | 231 |
| 153 | 3300005444 | Ga0070694_100013152 | Ga0070694_1000131524 | 231 |
| 154 | 3300005444 | Ga0070694_100050865 | Ga0070694_1000508655 | 231 |
| 155 | 3300005444 | Ga0070694_100276159 | Ga0070694_1002761591 | 231 |
| 156 | 3300005444 | Ga0070694_100291713 | Ga0070694_1002917132 | 231 |
| 157 | 3300005445 | Ga0070708_100023317 | Ga0070708_1000233172 | 231 |
| 158 | 3300005445 | Ga0070708_100099202 | Ga0070708_1000992022 | 231 |
| 159 | 3300005445 | Ga0070708_100548058 | Ga0070708_1005480582 | 231 |
| 160 | 3300005455 | Ga0070663_100043942 | Ga0070663_1000439424 | 231 |
| 161 | 3300005455 | Ga0070663_100057999 | Ga0070663_1000579994 | 231 |
| 162 | 3300005455 | Ga0070663_100067244 | Ga0070663_1000672442 | 231 |
| 163 | 3300005456 | Ga0070678_100005784 | Ga0070678_1000057845 | 231 |
| 164 | 3300005456 | Ga0070678_100352952 | Ga0070678_1003529522 | 231 |
| 165 | 3300005459 | Ga0068867_100028469 | Ga0068867_1000284694 | 231 |
| 166 | 3300005459 | Ga0068867_100273427 | Ga0068867_1002734272 | 231 |
| 167 | 3300005467 | Ga0070706_100024463 | Ga0070706_1000244633 | 231 |
| 168 | 3300005467 | Ga0070706_100042452 | Ga0070706_1000424524 | 231 |
| 169 | 3300005467 | Ga0070706_100077441 | Ga0070706_1000774414 | 231 |
| 170 | 3300005467 | Ga0070706_100098251 | Ga0070706_1000982514 | 231 |
| 171 | 3300005467 | Ga0070706_100386484 | Ga0070706_1003864842 | 231 |
| 172 | 3300005468 | Ga0070707_100077037 | Ga0070707_1000770372 | 231 |
| 173 | 3300005468 | Ga0070707_100233630 | Ga0070707_1002336302 | 231 |
| 174 | 3300005471 | Ga0070698_100029948 | Ga0070698_1000299484 | 231 |
| 175 | 3300005471 | Ga0070698_100173503 | Ga0070698_1001735031 | 231 |
| 176 | 3300005518 | Ga0070699_100174109 | Ga0070699_1001741092 | 231 |
| 177 | 3300005518 | Ga0070699_100455157 | Ga0070699_1004551572 | 231 |
| 178 | 3300005535 | Ga0070684_100135642 | Ga0070684_1001356422 | 231 |
| 179 | 3300005535 | Ga0070684_100225836 | Ga0070684_1002258361 | 231 |
| 180 | 3300005536 | Ga0070697_100010304 | Ga0070697_1000103044 | 231 |
| 181 | 3300005536 | Ga0070697_100056398 | Ga0070697_1000563985 | 231 |
| 182 | 3300005536 | Ga0070697_100072171 | Ga0070697_1000721716 | 231 |
| 183 | 3300005536 | Ga0070697_100159513 | Ga0070697_1001595132 | 231 |
| 184 | 3300005536 | Ga0070697_100222181 | Ga0070697_1002221812 | 231 |
| 185 | 3300005536 | Ga0070697_100245185 | Ga0070697_1002451852 | 231 |
| 186 | 3300005539 | Ga0068853_100078497 | Ga0068853_1000784974 | 231 |
| 187 | 3300005543 | Ga0070672_100000645 | Ga0070672_1000006454 | 231 |
| 188 | 3300005543 | Ga0070672_100009524 | Ga0070672_1000095247 | 231 |
| 189 | 3300005543 | Ga0070672_100440940 | Ga0070672_1004409402 | 231 |
| 190 | 3300005544 | Ga0070686_100117370 | Ga0070686_1001173703 | 231 |
| 191 | 3300005545 | Ga0070695_100219880 | Ga0070695_1002198802 | 231 |
| 192 | 3300005545 | Ga0070695_100370983 | Ga0070695_1003709831 | 231 |
| 193 | 3300005545 | Ga0070695_100465121 | Ga0070695_1004651212 | 231 |
| 194 | 3300005546 | Ga0070696_100013240 | Ga0070696_1000132407 | 231 |
| 195 | 3300005546 | Ga0070696_100085798 | Ga0070696_1000857985 | 231 |
| 196 | 3300005546 | Ga0070696_100192349 | Ga0070696_1001923492 | 231 |
| 197 | 3300005546 | Ga0070696_100369671 | Ga0070696_1003696711 | 231 |
| 198 | 3300005546 | Ga0070696_100585324 | Ga0070696_1005853241 | 231 |
| 199 | 3300005548 | Ga0070665_100031052 | Ga0070665_1000310524 | 231 |
| 200 | 3300005548 | Ga0070665_100057140 | Ga0070665_1000571402 | 231 |
| 201 | 3300005548 | Ga0070665_100080240 | Ga0070665_1000802404 | 231 |
| 202 | 3300005549 | Ga0070704_100024986 | Ga0070704_1000249864 | 231 |
| 203 | 3300005549 | Ga0070704_100157809 | Ga0070704_1001578091 | 231 |
| 204 | 3300005549 | Ga0070704_100287416 | Ga0070704_1002874162 | 231 |
| 205 | 3300005549 | Ga0070704_100593210 | Ga0070704_1005932102 | 231 |
| 206 | 3300005563 | Ga0068855_100898123 | Ga0068855_1008981232 | 231 |
| 207 | 3300005564 | Ga0070664_100029833 | Ga0070664_1000298336 | 231 |
| 208 | 3300005564 | Ga0070664_100105624 | Ga0070664_1001056242 | 231 |
| 209 | 3300005564 | Ga0070664_100208778 | Ga0070664_1002087782 | 231 |
| 210 | 3300005577 | Ga0068857_100085364 | Ga0068857_1000853643 | 231 |
| 211 | 3300005578 | Ga0068854_100233583 | Ga0068854_1002335832 | 231 |
| 212 | 3300005614 | Ga0068856_100011643 | Ga0068856_1000116437 | 231 |
| 213 | 3300005615 | Ga0070702_100016630 | Ga0070702_1000166305 | 231 |
| 214 | 3300005615 | Ga0070702_100087415 | Ga0070702_1000874153 | 231 |
| 215 | 3300005616 | Ga0068852_100642814 | Ga0068852_1006428142 | 231 |
| 216 | 3300005617 | Ga0068859_100003783 | Ga0068859_1000037837 | 231 |
| 217 | 3300005617 | Ga0068859_100155418 | Ga0068859_1001554182 | 231 |
| 218 | 3300005618 | Ga0068864_100009374 | Ga0068864_10000937410 | 231 |
| 219 | 3300005618 | Ga0068864_100052072 | Ga0068864_1000520724 | 231 |
| 220 | 3300005618 | Ga0068864_100093789 | Ga0068864_1000937894 | 231 |
| 221 | 3300005718 | Ga0068866_10033142 | Ga0068866_100331424 | 231 |
| 222 | 3300005718 | Ga0068866_10434369 | Ga0068866_104343691 | 231 |
| 223 | 3300005719 | Ga0068861_100078892 | Ga0068861_1000788922 | 231 |
| 224 | 3300005719 | Ga0068861_100261401 | Ga0068861_1002614012 | 231 |
| 225 | 3300005834 | Ga0068851_10345870 | Ga0068851_103458701 | 231 |
| 226 | 3300005840 | Ga0068870_10057287 | Ga0068870_100572872 | 231 |
| 227 | 3300005841 | Ga0068863_100032041 | Ga0068863_1000320415 | 231 |
| 228 | 3300005841 | Ga0068863_100036843 | Ga0068863_1000368437 | 231 |
| 229 | 3300005841 | Ga0068863_100178518 | Ga0068863_1001785183 | 231 |
| 230 | 3300005841 | Ga0068863_100360149 | Ga0068863_1003601492 | 231 |
| 231 | 3300005842 | Ga0068858_100000126 | Ga0068858_10000012680 | 231 |
| 232 | 3300005842 | Ga0068858_100465033 | Ga0068858_1004650331 | 231 |
| 233 | 3300005843 | Ga0068860_100006092 | Ga0068860_1000060926 | 231 |
| 234 | 3300005843 | Ga0068860_100019789 | Ga0068860_1000197894 | 231 |
| 235 | 3300005843 | Ga0068860_100434822 | Ga0068860_1004348222 | 231 |
| 236 | 3300005844 | Ga0068862_100002514 | Ga0068862_10000251410 | 231 |
| 237 | 3300005844 | Ga0068862_100009052 | Ga0068862_1000090525 | 231 |
| 238 | 3300005937 | Ga0081455_10015825 | Ga0081455_100158254 | 231 |
| 239 | 3300006028 | Ga0070717_10000358 | Ga0070717_1000035826 | 231 |
| 240 | 3300006028 | Ga0070717_10089781 | Ga0070717_100897813 | 231 |
| 241 | 3300006028 | Ga0070717_10270617 | Ga0070717_102706172 | 231 |
| 242 | 3300006173 | Ga0070716_100096127 | Ga0070716_1000961272 | 231 |
| 243 | 3300006173 | Ga0070716_100185537 | Ga0070716_1001855372 | 231 |
| 244 | 3300006237 | Ga0097621_100145181 | Ga0097621_1001451812 | 231 |
| 245 | 3300006237 | Ga0097621_100231444 | Ga0097621_1002314443 | 231 |
| 246 | 3300006237 | Ga0097621_100614068 | Ga0097621_1006140681 | 231 |
| 247 | 3300006358 | Ga0068871_100080654 | Ga0068871_1000806546 | 231 |
| 248 | 3300006358 | Ga0068871_100486559 | Ga0068871_1004865592 | 231 |
| 249 | 3300006844 | Ga0075428_100025919 | Ga0075428_1000259197 | 231 |
| 250 | 3300006844 | Ga0075428_100040925 | Ga0075428_1000409254 | 231 |
| 251 | 3300006844 | Ga0075428_100281334 | Ga0075428_1002813342 | 231 |
| 252 | 3300006844 | Ga0075428_100303669 | Ga0075428_1003036693 | 231 |
| 253 | 3300006844 | Ga0075428_100816333 | Ga0075428_1008163332 | 231 |
| 254 | 3300006846 | Ga0075430_100091926 | Ga0075430_1000919262 | 231 |
| 255 | 3300006847 | Ga0075431_100001900 | Ga0075431_10000190021 | 231 |
| 256 | 3300006847 | Ga0075431_100061605 | Ga0075431_1000616053 | 231 |
| 257 | 3300006847 | Ga0075431_100251750 | Ga0075431_1002517502 | 231 |
| 258 | 3300006852 | Ga0075433_10045513 | Ga0075433_100455135 | 231 |
| 259 | 3300006852 | Ga0075433_10144724 | Ga0075433_101447243 | 231 |
| 260 | 3300006871 | Ga0075434_100097085 | Ga0075434_1000970854 | 231 |
| 261 | 3300006871 | Ga0075434_100172980 | Ga0075434_1001729803 | 231 |
| 262 | 3300006871 | Ga0075434_100246534 | Ga0075434_1002465342 | 231 |
| 263 | 3300006881 | Ga0068865_100292266 | Ga0068865_1002922662 | 231 |
| 264 | 3300006914 | Ga0075436_100015219 | Ga0075436_1000152194 | 231 |
| 265 | 3300006931 | Ga0097620_100003783 | Ga0097620_1000037839 | 231 |
| 266 | 3300006931 | Ga0097620_100155408 | Ga0097620_1001554082 | 231 |
| 267 | 3300007076 | Ga0075435_100019811 | Ga0075435_1000198114 | 231 |
| 268 | 3300007076 | Ga0075435_100048622 | Ga0075435_1000486224 | 231 |
| 269 | 3300007265 | Ga0099794_10162664 | Ga0099794_101626641 | 231 |
| 270 | 3300007788 | Ga0099795_10181296 | Ga0099795_101812961 | 231 |
| 271 | 3300009036 | Ga0105244_10033985 | Ga0105244_100339853 | 231 |
| 272 | 3300009094 | Ga0111539_10000004 | Ga0111539_1000000484 | 231 |
| 273 | 3300009094 | Ga0111539_10023336 | Ga0111539_100233367 | 231 |
| 274 | 3300009094 | Ga0111539_10386172 | Ga0111539_103861723 | 231 |
| 275 | 3300009098 | Ga0105245_10003274 | Ga0105245_1000327414 | 231 |
| 276 | 3300009098 | Ga0105245_10089609 | Ga0105245_100896094 | 231 |
| 277 | 3300009098 | Ga0105245_10300186 | Ga0105245_103001862 | 231 |
| 278 | 3300009147 | Ga0114129_10006614 | Ga0114129_1000661410 | 231 |
| 279 | 3300009147 | Ga0114129_10007335 | Ga0114129_100073359 | 231 |
| 280 | 3300009147 | Ga0114129_10315790 | Ga0114129_103157903 | 231 |
| 281 | 3300009147 | Ga0114129_10397700 | Ga0114129_103977003 | 231 |
| 282 | 3300009147 | Ga0114129_10441641 | Ga0114129_104416412 | 231 |
| 283 | 3300009174 | Ga0105241_10253614 | Ga0105241_102536142 | 231 |
| 284 | 3300009176 | Ga0105242_10007796 | Ga0105242_1000779615 | 231 |
| 285 | 3300009177 | Ga0105248_10003883 | Ga0105248_100038837 | 231 |
| 286 | 3300009553 | Ga0105249_10033683 | Ga0105249_100336834 | 231 |
| 287 | 3300010159 | Ga0099796_10083304 | Ga0099796_100833042 | 231 |
| 288 | 3300013102 | Ga0157371_10613965 | Ga0157371_106139651 | 231 |
| 289 | 3300013296 | Ga0157374_10053860 | Ga0157374_100538606 | 231 |
| 290 | 3300013297 | Ga0157378_10044976 | Ga0157378_100449764 | 231 |
| 291 | 3300013297 | Ga0157378_10055531 | Ga0157378_100555314 | 231 |
| 292 | 3300013297 | Ga0157378_10059344 | Ga0157378_100593443 | 231 |
| 293 | 3300013297 | Ga0157378_10616354 | Ga0157378_106163542 | 231 |
| 294 | 3300013306 | Ga0163162_10009455 | Ga0163162_100094553 | 231 |
| 295 | 3300013306 | Ga0163162_10024906 | Ga0163162_100249064 | 231 |
| 296 | 3300013306 | Ga0163162_10027719 | Ga0163162_100277194 | 231 |
| 297 | 3300013306 | Ga0163162_10425776 | Ga0163162_104257763 | 231 |
| 298 | 3300013307 | Ga0157372_10637722 | Ga0157372_106377222 | 231 |
| 299 | 3300013308 | Ga0157375_10001186 | Ga0157375_100011866 | 231 |
| 300 | 3300013308 | Ga0157375_10004506 | Ga0157375_1000450619 | 231 |
| 301 | 3300013308 | Ga0157375_10017011 | Ga0157375_100170114 | 231 |
| 302 | 3300013308 | Ga0157375_10038879 | Ga0157375_100388793 | 231 |
| 303 | 3300013308 | Ga0157375_10442167 | Ga0157375_104421672 | 231 |
| 304 | 3300014326 | Ga0157380_10023433 | Ga0157380_100234334 | 231 |
| 305 | 3300014326 | Ga0157380_10055375 | Ga0157380_100553755 | 231 |
| 306 | 3300014745 | Ga0157377_10140469 | Ga0157377_101404692 | 231 |
| 307 | 3300014968 | Ga0157379_10037586 | Ga0157379_100375864 | 231 |
| 308 | 3300014968 | Ga0157379_10737783 | Ga0157379_107377831 | 231 |
| 309 | 3300014969 | Ga0157376_10112587 | Ga0157376_101125874 | 231 |
| 310 | 3300014969 | Ga0157376_10332419 | Ga0157376_103324192 | 231 |
| 311 | 3300014969 | Ga0157376_11054556 | Ga0157376_110545561 | 231 |
| 312 | 3300017792 | Ga0163161_10127156 | Ga0163161_101271562 | 231 |
| 313 | 3300020069 | Ga0197907_10017840 | Ga0197907_100178402 | 231 |
| 314 | 3300020076 | Ga0206355_1085075 | Ga0206355_10850751 | 231 |
| 315 | 3300020078 | Ga0206352_10233347 | Ga0206352_102333475 | 231 |
| 316 | 3300020080 | Ga0206350_11532297 | Ga0206350_115322971 | 231 |
| 317 | 3300020081 | Ga0206354_11262369 | Ga0206354_112623692 | 231 |
| 318 | 3300021384 | Ga0213876_10117650 | Ga0213876_101176502 | 231 |
| 319 | 3300022467 | Ga0224712_10007473 | Ga0224712_100074731 | 231 |
| 320 | 3300022467 | Ga0224712_10116476 | Ga0224712_101164762 | 231 |
| 321 | 3300025315 | Ga0207697_10004944 | Ga0207697_100049444 | 231 |
| 322 | 3300025728 | Ga0207655_1031667 | Ga0207655_10316673 | 231 |
| 323 | 3300025893 | Ga0207682_10007123 | Ga0207682_100071233 | 231 |
| 324 | 3300025899 | Ga0207642_10008709 | Ga0207642_100087091 | 231 |
| 325 | 3300025901 | Ga0207688_10023503 | Ga0207688_100235032 | 231 |
| 326 | 3300025903 | Ga0207680_10009869 | Ga0207680_100098697 | 231 |
| 327 | 3300025904 | Ga0207647_10041680 | Ga0207647_100416807 | 231 |
| 328 | 3300025904 | Ga0207647_10118962 | Ga0207647_101189623 | 231 |
| 329 | 3300025907 | Ga0207645_10004788 | Ga0207645_100047885 | 231 |
| 330 | 3300025908 | Ga0207643_10021848 | Ga0207643_100218484 | 231 |
| 331 | 3300025909 | Ga0207705_10037305 | Ga0207705_100373053 | 231 |
| 332 | 3300025910 | Ga0207684_10028407 | Ga0207684_1002840711 | 231 |
| 333 | 3300025910 | Ga0207684_10033979 | Ga0207684_100339797 | 231 |
| 334 | 3300025910 | Ga0207684_10097226 | Ga0207684_100972264 | 231 |
| 335 | 3300025910 | Ga0207684_10124856 | Ga0207684_101248563 | 231 |
| 336 | 3300025910 | Ga0207684_10314851 | Ga0207684_103148512 | 231 |
| 337 | 3300025910 | Ga0207684_10348474 | Ga0207684_103484742 | 231 |
| 338 | 3300025911 | Ga0207654_10195966 | Ga0207654_101959662 | 231 |
| 339 | 3300025913 | Ga0207695_10061631 | Ga0207695_100616314 | 231 |
| 340 | 3300025917 | Ga0207660_10061956 | Ga0207660_100619564 | 231 |
| 341 | 3300025918 | Ga0207662_10148898 | Ga0207662_101488981 | 231 |
| 342 | 3300025920 | Ga0207649_10172390 | Ga0207649_101723903 | 231 |
| 343 | 3300025922 | Ga0207646_10051275 | Ga0207646_100512756 | 231 |
| 344 | 3300025922 | Ga0207646_10065243 | Ga0207646_100652432 | 231 |
| 345 | 3300025922 | Ga0207646_10118003 | Ga0207646_101180034 | 231 |
| 346 | 3300025922 | Ga0207646_10225698 | Ga0207646_102256982 | 231 |
| 347 | 3300025922 | Ga0207646_10358592 | Ga0207646_103585922 | 231 |
| 348 | 3300025925 | Ga0207650_10032454 | Ga0207650_100324543 | 231 |
| 349 | 3300025926 | Ga0207659_10000001 | Ga0207659_1000000150 | 231 |
| 350 | 3300025926 | Ga0207659_10043446 | Ga0207659_100434464 | 231 |
| 351 | 3300025926 | Ga0207659_10217814 | Ga0207659_102178142 | 231 |
| 352 | 3300025927 | Ga0207687_10002004 | Ga0207687_100020045 | 231 |
| 353 | 3300025927 | Ga0207687_10004933 | Ga0207687_1000493313 | 231 |
| 354 | 3300025928 | Ga0207700_10014828 | Ga0207700_100148284 | 231 |
| 355 | 3300025931 | Ga0207644_10001615 | Ga0207644_100016154 | 231 |
| 356 | 3300025933 | Ga0207706_10024888 | Ga0207706_100248884 | 231 |
| 357 | 3300025934 | Ga0207686_10024337 | Ga0207686_100243373 | 231 |
| 358 | 3300025936 | Ga0207670_10001935 | Ga0207670_100019354 | 231 |
| 359 | 3300025937 | Ga0207669_10010324 | Ga0207669_100103245 | 231 |
| 360 | 3300025937 | Ga0207669_10611716 | Ga0207669_106117162 | 231 |
| 361 | 3300025938 | Ga0207704_10099350 | Ga0207704_100993503 | 231 |
| 362 | 3300025938 | Ga0207704_10183341 | Ga0207704_101833412 | 231 |
| 363 | 3300025940 | Ga0207691_10002406 | Ga0207691_100024067 | 231 |
| 364 | 3300025940 | Ga0207691_10188850 | Ga0207691_101888502 | 231 |
| 365 | 3300025941 | Ga0207711_10002464 | Ga0207711_1000246410 | 231 |
| 366 | 3300025941 | Ga0207711_10102821 | Ga0207711_101028213 | 231 |
| 367 | 3300025941 | Ga0207711_10717118 | Ga0207711_107171182 | 231 |
| 368 | 3300025942 | Ga0207689_10016588 | Ga0207689_100165884 | 231 |
| 369 | 3300025942 | Ga0207689_10059495 | Ga0207689_100594954 | 231 |
| 370 | 3300025945 | Ga0207679_10070562 | Ga0207679_100705626 | 231 |
| 371 | 3300025949 | Ga0207667_10921217 | Ga0207667_109212171 | 231 |
| 372 | 3300025960 | Ga0207651_10003479 | Ga0207651_100034794 | 231 |
| 373 | 3300025960 | Ga0207651_10034634 | Ga0207651_100346341 | 231 |
| 374 | 3300025961 | Ga0207712_10159659 | Ga0207712_101596592 | 231 |
| 375 | 3300025981 | Ga0207640_10082778 | Ga0207640_100827782 | 231 |
| 376 | 3300025986 | Ga0207658_10020060 | Ga0207658_100200607 | 231 |
| 377 | 3300025986 | Ga0207658_10078118 | Ga0207658_100781184 | 231 |
| 378 | 3300026023 | Ga0207677_10000366 | Ga0207677_1000036637 | 231 |
| 379 | 3300026035 | Ga0207703_10000653 | Ga0207703_100006536 | 231 |
| 380 | 3300026035 | Ga0207703_10002877 | Ga0207703_1000287715 | 231 |
| 381 | 3300026035 | Ga0207703_10219138 | Ga0207703_102191382 | 231 |
| 382 | 3300026041 | Ga0207639_10000013 | Ga0207639_10000013129 | 231 |
| 383 | 3300026067 | Ga0207678_10029933 | Ga0207678_100299337 | 231 |
| 384 | 3300026067 | Ga0207678_10071984 | Ga0207678_100719842 | 231 |
| 385 | 3300026067 | Ga0207678_10730180 | Ga0207678_107301802 | 231 |
| 386 | 3300026075 | Ga0207708_10000022 | Ga0207708_1000002260 | 231 |
| 387 | 3300026075 | Ga0207708_10006421 | Ga0207708_100064214 | 231 |
| 388 | 3300026078 | Ga0207702_10008952 | Ga0207702_100089527 | 231 |
| 389 | 3300026078 | Ga0207702_10380259 | Ga0207702_103802591 | 231 |
| 390 | 3300026088 | Ga0207641_10044698 | Ga0207641_100446984 | 231 |
| 391 | 3300026088 | Ga0207641_10106298 | Ga0207641_101062983 | 231 |
| 392 | 3300026088 | Ga0207641_10156827 | Ga0207641_101568272 | 231 |
| 393 | 3300026089 | Ga0207648_10008001 | Ga0207648_100080014 | 231 |
| 394 | 3300026089 | Ga0207648_10025661 | Ga0207648_100256614 | 231 |
| 395 | 3300026089 | Ga0207648_10395134 | Ga0207648_103951342 | 231 |
| 396 | 3300026095 | Ga0207676_10000002 | Ga0207676_100000021074 | 231 |
| 397 | 3300026095 | Ga0207676_10017667 | Ga0207676_100176677 | 231 |
| 398 | 3300026095 | Ga0207676_10077878 | Ga0207676_100778785 | 231 |
| 399 | 3300026116 | Ga0207674_10029202 | Ga0207674_100292024 | 231 |
| 400 | 3300026118 | Ga0207675_100010263 | Ga0207675_1000102634 | 231 |
| 401 | 3300026118 | Ga0207675_100269826 | Ga0207675_1002698262 | 231 |
| 402 | 3300026121 | Ga0207683_10008562 | Ga0207683_100085625 | 231 |
| 403 | 3300026121 | Ga0207683_10033221 | Ga0207683_100332214 | 231 |
| 404 | 3300026121 | Ga0207683_10057109 | Ga0207683_100571093 | 231 |
| 405 | 3300026142 | Ga0207698_10210744 | Ga0207698_102107442 | 231 |
| 406 | 3300027364 | Ga0209967_1004046 | Ga0209967_10040462 | 231 |
| 407 | 3300027378 | Ga0209981_1014621 | Ga0209981_10146212 | 231 |
| 408 | 3300027395 | Ga0209996_1003510 | Ga0209996_10035102 | 231 |
| 409 | 3300027526 | Ga0209968_1000569 | Ga0209968_10005694 | 231 |
| 410 | 3300027543 | Ga0209999_1000991 | Ga0209999_10009912 | 231 |
| 411 | 3300027614 | Ga0209970_1000622 | Ga0209970_10006225 | 231 |
| 412 | 3300027665 | Ga0209983_1002684 | Ga0209983_10026847 | 231 |
| 413 | 3300027682 | Ga0209971_1000924 | Ga0209971_10009247 | 231 |
| 414 | 3300027717 | Ga0209998_10002526 | Ga0209998_100025263 | 231 |
| 415 | 3300027876 | Ga0209974_10000553 | Ga0209974_100005536 | 231 |
| 416 | 3300027876 | Ga0209974_10173738 | Ga0209974_101737381 | 231 |
| 417 | 3300027907 | Ga0207428_10000006 | Ga0207428_1000000684 | 231 |
| 418 | 3300028379 | Ga0268266_10024065 | Ga0268266_100240659 | 231 |
| 419 | 3300028379 | Ga0268266_10048431 | Ga0268266_100484312 | 231 |
| 420 | 3300028379 | Ga0268266_10265949 | Ga0268266_102659492 | 231 |
| 421 | 3300028380 | Ga0268265_10012616 | Ga0268265_100126163 | 231 |
| 422 | 3300028381 | Ga0268264_10002139 | Ga0268264_1000213913 | 231 |
| 423 | 3300028381 | Ga0268264_10108473 | Ga0268264_101084733 | 231 |
| 424 | 3300028381 | Ga0268264_10127834 | Ga0268264_101278343 | 231 |
| 425 | 3300031239 | Ga0265328_10054782 | Ga0265328_100547822 | 231 |
| 426 | 3300031250 | Ga0265331_10086642 | Ga0265331_100866421 | 231 |
| 427 | 3300031548 | Ga0307408_100167894 | Ga0307408_1001678942 | 231 |
| 428 | 3300031712 | Ga0265342_10196129 | Ga0265342_101961291 | 231 |
| 429 | 3300031731 | Ga0307405_10274484 | Ga0307405_102744842 | 231 |
| 430 | 3300031911 | Ga0307412_10510246 | Ga0307412_105102461 | 231 |
| 431 | 3300035083 | Ga0373926_0065784 | Ga0373926_0065784_431_1129 | 231 |
| 432 | 3300035112 | Ga0373932_0000892 | Ga0373932_0000892_2283_2984 | 231 |
| 433 | 3300035170 | Ga0373943_0005573 | Ga0373943_0005573_4922_5620 | 231 |
| 434 | 3300035170 | Ga0373943_0024063 | Ga0373943_0024063_1076_1783 | 231 |
| 435 | 3300035170 | Ga0373943_0026247 | Ga0373943_0026247_606_1301 | 231 |
| 436 | 3300035170 | Ga0373943_0038288 | Ga0373943_0038288_15_719 | 231 |
| 437 | 3300035171 | Ga0373946_0039005 | Ga0373946_0039005_389_1087 | 231 |
| 438 | 3300035172 | Ga0373955_0165806 | Ga0373955_0165806_562_1260 | 231 |
| 439 | 3300035410 | Ga0373924_0102490 | Ga0373924_0102490_242_949 | 231 |
| 440 | 3300035692 | Ga0373935_0047294 | Ga0373935_0047294_1271_1978 | 231 |
| 441 | 3300037068 | Ga0373925_0003459 | Ga0373925_0003459_2273_2971 | 231 |
| 442 | 3300037068 | Ga0373925_0092687 | Ga0373925_0092687_221_928 | 231 |
| 443 | 3300037068 | Ga0373925_0267593 | Ga0373925_0267593_339_1037 | 231 |
| 444 | 3300037853 | Ga0436364_0202057 | Ga0436364_0202057_273_980 | 231 |
| 445 | 3300039437 | Ga0436365_1657599 | Ga0436365_1657599_256_957 | 231 |
| 446 | 3300039450 | Ga0436363_0743676 | Ga0436363_0743676_178_879 | 231 |
| 447 | 3300042876 | Ga0451577_0026601 | Ga0451577_0026601_4374_5081 | 231 |
| 448 | 3300042876 | Ga0451577_0148364 | Ga0451577_0148364_1022_1723 | 231 |
| 449 | 3300044673 | Ga0453683_0149410 | Ga0453683_0149410_299_1006 | 231 |
| 450 | 3300044673 | Ga0453683_0243930 | Ga0453683_0243930_218_919 | 231 |
| 451 | 3300044712 | Ga0453684_0001061 | Ga0453684_0001061_43607_44314 | 231 |
| 452 | 3300044712 | Ga0453684_0747054 | Ga0453684_0747054_270_965 | 231 |
| 453 | 3300044712 | Ga0453684_1181783 | Ga0453684_1181783_44_751 | 231 |
| 454 | 3300045049 | Ga0466959_0389225 | Ga0466959_0389225_86_793 | 231 |
| 455 | 3300045051 | Ga0451576_0044159 | Ga0451576_0044159_3309_4016 | 231 |
| 456 | 3300045051 | Ga0451576_0138339 | Ga0451576_0138339_1503_2204 | 231 |
| 457 | 3300045051 | Ga0451576_0154747 | Ga0451576_0154747_603_1298 | 231 |
| 458 | 3300046459 | Ga0495629_0000007 | Ga0495629_0000007_264720_265418 | 231 |
| 459 | 3300046459 | Ga0495629_0016450 | Ga0495629_0016450_2857_3552 | 231 |
| 460 | 3300046459 | Ga0495629_0223763 | Ga0495629_0223763_535_1230 | 231 |
| 461 | 3300046459 | Ga0495629_0365968 | Ga0495629_0365968_236_931 | 231 |
| 462 | 3300046472 | Ga0495580_0003149 | Ga0495580_0003149_11596_12291 | 231 |
| 463 | 3300046472 | Ga0495580_0060566 | Ga0495580_0060566_1015_1710 | 231 |
| 464 | 3300046472 | Ga0495580_0188197 | Ga0495580_0188197_96_791 | 231 |
| 465 | 3300046472 | Ga0495580_0538645 | Ga0495580_0538645_33_731 | 231 |
| 466 | 3300046473 | Ga0495582_0142354 | Ga0495582_0142354_286_981 | 231 |
| 467 | 3300046475 | Ga0495639_0000121 | Ga0495639_0000121_37224_37922 | 231 |
| 468 | 3300046492 | Ga0495585_0035611 | Ga0495585_0035611_35_733 | 231 |
| 469 | 3300046515 | Ga0495620_0004391 | Ga0495620_0004391_1044_1748 | 231 |
| 470 | 3300046526 | Ga0495666_0002494 | Ga0495666_0002494_6808_7506 | 231 |
| 471 | 3300046531 | Ga0495665_0098255 | Ga0495665_0098255_116_811 | 231 |
| 472 | 3300046531 | Ga0495665_0099484 | Ga0495665_0099484_194_889 | 231 |
| 473 | 3300046533 | Ga0495640_0080883 | Ga0495640_0080883_910_1608 | 231 |
| 474 | 3300046533 | Ga0495640_0403724 | Ga0495640_0403724_73_771 | 231 |
| 475 | 3300046535 | Ga0495586_0001107 | Ga0495586_0001107_1625_2323 | 231 |
| 476 | 3300046535 | Ga0495586_0237474 | Ga0495586_0237474_76_774 | 231 |
| 477 | 3300046537 | Ga0495598_0088932 | Ga0495598_0088932_38_739 | 231 |
| 478 | 3300046663 | Ga0495635_0001256 | Ga0495635_0001256_3127_3825 | 231 |
| 479 | 3300046674 | Ga0495588_0346445 | Ga0495588_0346445_61_768 | 231 |
| 480 | 3300046681 | Ga0495647_0010500 | Ga0495647_0010500_122_817 | 231 |
| 481 | 3300046681 | Ga0495647_0017709 | Ga0495647_0017709_226_933 | 231 |
| 482 | 3300046681 | Ga0495647_0018329 | Ga0495647_0018329_734_1432 | 231 |
| 483 | 3300046683 | Ga0495658_0070176 | Ga0495658_0070176_1232_1927 | 231 |
| 484 | 3300046683 | Ga0495658_0139845 | Ga0495658_0139845_350_1045 | 231 |
| 485 | 3300046689 | Ga0495613_0093343 | Ga0495613_0093343_968_1666 | 231 |
| 486 | 3300046689 | Ga0495613_0164981 | Ga0495613_0164981_108_806 | 231 |
| 487 | 3300046689 | Ga0495613_0285713 | Ga0495613_0285713_284_982 | 231 |
| 488 | 3300046690 | Ga0495624_0257744 | Ga0495624_0257744_10_708 | 231 |
| 489 | 3300046809 | Ga0495600_0039531 | Ga0495600_0039531_2239_2937 | 231 |
| 490 | 3300047315 | Ga0495581_0015277 | Ga0495581_0015277_2740_3438 | 231 |
| 491 | 3300047315 | Ga0495581_0124314 | Ga0495581_0124314_272_970 | 231 |
| 492 | 3300047319 | Ga0495674_0241997 | Ga0495674_0241997_596_1303 | 231 |
| 493 | 3300047321 | Ga0495676_0004533 | Ga0495676_0004533_10366_11064 | 231 |
| 494 | 3300047322 | Ga0495680_0003482 | Ga0495680_0003482_13132_13830 | 231 |
| 495 | 3300047446 | Ga0495679_023095 | Ga0495679_023095_1287_1988 | 231 |
| 496 | 3300047471 | Ga0495684_0022313 | Ga0495684_0022313_1930_2625 | 231 |
| 497 | 3300047471 | Ga0495684_0062544 | Ga0495684_0062544_537_1235 | 231 |
| 498 | 3300047471 | Ga0495684_0063429 | Ga0495684_0063429_472_1170 | 231 |
| 499 | 3300048904 | Ga0496101_0003778 | Ga0496101_0003778_6901_7596 | 231 |
| 500 | 3300048905 | Ga0496102_0005621 | Ga0496102_0005621_2941_3636 | 231 |
| 501 | 3300048906 | Ga0496103_0051555 | Ga0496103_0051555_550_1245 | 231 |
| 502 | 3300048906 | Ga0496103_0063254 | Ga0496103_0063254_1287_1982 | 231 |
| 503 | 3300048907 | Ga0496104_0316229 | Ga0496104_0316229_181_876 | 231 |
| 504 | 3300048909 | Ga0496106_0000888 | Ga0496106_0000888_19454_20149 | 231 |
| 505 | 3300048909 | Ga0496106_0092000 | Ga0496106_0092000_661_1356 | 231 |
| 506 | 3300048909 | Ga0496106_0742919 | Ga0496106_0742919_63_770 | 231 |
| 507 | 3300048910 | Ga0496107_0001018 | Ga0496107_0001018_1688_2383 | 231 |
| 508 | 3300048911 | Ga0496108_0088766 | Ga0496108_0088766_927_1622 | 231 |
| 509 | 3300048911 | Ga0496108_0117399 | Ga0496108_0117399_103_798 | 231 |
| 510 | 3300048914 | Ga0496111_0020441 | Ga0496111_0020441_1760_2455 | 231 |
| 511 | 3300048915 | Ga0496112_0202003 | Ga0496112_0202003_32_730 | 231 |
| 512 | 3300048915 | Ga0496112_0531527 | Ga0496112_0531527_131_826 | 231 |
| 513 | 3300048916 | Ga0496113_0064340 | Ga0496113_0064340_32_727 | 231 |
| 514 | 3300048918 | Ga0496115_0021093 | Ga0496115_0021093_2611_3324 | 231 |
| 515 | 3300049586 | Ga0501070_0343264 | Ga0501070_0343264_10_705 | 231 |
| 516 | 3300049589 | Ga0501073_0001571 | Ga0501073_0001571_15183_15893 | 231 |
| 517 | 3300049590 | Ga0501074_0214188 | Ga0501074_0214188_50_745 | 231 |
| 518 | 3300049592 | Ga0501076_0294718 | Ga0501076_0294718_299_994 | 231 |
| 519 | 3300049742 | Ga0501080_0070589 | Ga0501080_0070589_547_1257 | 231 |
| 520 | 3300049742 | Ga0501080_0212868 | Ga0501080_0212868_505_1200 | 231 |
| 521 | 3300049743 | Ga0501081_0086410 | Ga0501081_0086410_532_1227 | 231 |
| 522 | 3300050507 | nmdc:mga05p37_13942_c1 | nmdc:mga05p37_13942_c1_8546_9244 | 231 |
| 523 | 3300050507 | nmdc:mga05p37_145535_c1 | nmdc:mga05p37_145535_c1_1576_2277 | 231 |
| 524 | 3300050507 | nmdc:mga05p37_335068_c2 | nmdc:mga05p37_335068_c2_241_936 | 231 |
| 525 | 3300050507 | nmdc:mga05p37_3917_c1 | nmdc:mga05p37_3917_c1_13915_14610 | 231 |
| 526 | 3300050508 | nmdc:mga09592_182465_c1 | nmdc:mga09592_182465_c1_961_1674 | 231 |
| 527 | 3300050509 | nmdc:mga0qj67_65344_c1 | nmdc:mga0qj67_65344_c1_584_1282 | 231 |
| 528 | 3300050510 | nmdc:mga06r32_1776_c2 | nmdc:mga06r32_1776_c2_5245_5946 | 231 |
| 529 | 3300050510 | nmdc:mga06r32_232301_c1 | nmdc:mga06r32_232301_c1_123_824 | 231 |
| 530 | 3300050510 | nmdc:mga06r32_239593_c1 | nmdc:mga06r32_239593_c1_699_1397 | 231 |
| 531 | 3300050510 | nmdc:mga06r32_307540_c1 | nmdc:mga06r32_307540_c1_271_984 | 231 |
| 532 | 3300050511 | nmdc:mga08y16_501543_c1 | nmdc:mga08y16_501543_c1_409_1110 | 231 |
| 533 | 3300050511 | nmdc:mga08y16_5_c1 | nmdc:mga08y16_5_c1_676765_677466 | 231 |
| 534 | 3300050511 | nmdc:mga08y16_6976_c1 | nmdc:mga08y16_6976_c1_11083_11781 | 231 |
| 535 | 3300050512 | nmdc:mga0n895_246816_c1 | nmdc:mga0n895_246816_c1_213_908 | 231 |
| 536 | 3300050512 | nmdc:mga0n895_281252_c1 | nmdc:mga0n895_281252_c1_794_1495 | 231 |
| 537 | 3300050512 | nmdc:mga0n895_319650_c1 | nmdc:mga0n895_319650_c1_737_1438 | 231 |
| 538 | 3300050512 | nmdc:mga0n895_823283_c1 | nmdc:mga0n895_823283_c1_125_826 | 231 |
| 539 | 3300050512 | nmdc:mga0n895_84154_c1 | nmdc:mga0n895_84154_c1_1121_1816 | 231 |
| 540 | 3300050513 | nmdc:mga0rr50_151479_c1 | nmdc:mga0rr50_151479_c1_388_1101 | 231 |
| 541 | 3300050513 | nmdc:mga0rr50_161_c1 | nmdc:mga0rr50_161_c1_5350_6069 | 231 |
| 542 | 3300050513 | nmdc:mga0rr50_425628_c1 | nmdc:mga0rr50_425628_c1_222_917 | 231 |
| 543 | 3300050514 | nmdc:mga08x19_12478_c1 | nmdc:mga08x19_12478_c1_3172_3891 | 231 |
| 544 | 3300050514 | nmdc:mga08x19_279707_c1 | nmdc:mga08x19_279707_c1_314_1012 | 231 |
| 545 | 3300050515 | nmdc:mga0a205_135125_c1 | nmdc:mga0a205_135125_c1_772_1467 | 231 |
| 546 | 3300050515 | nmdc:mga0a205_217771_c1 | nmdc:mga0a205_217771_c1_516_1229 | 231 |
| 547 | 3300050515 | nmdc:mga0a205_6528_c1 | nmdc:mga0a205_6528_c1_9597_10292 | 231 |
| 548 | 3300053083 | Ga0495655_0000225 | Ga0495655_0000225_9393_10094 | 231 |
| 549 | 3300053085 | Ga0495619_0009510 | Ga0495619_0009510_3002_3700 | 231 |
| 550 | 3300054114 | Ga0501084_0130004 | Ga0501084_0130004_444_1139 | 231 |
| 551 | 3300059645 | Ga0587076_029326 | Ga0587076_029326_234_935 | 231 |
| 552 | 3300060353 | Ga0501082_0204266 | Ga0501082_0204266_758_1453 | 231 |
| 553 | 3300061734 | Ga0530510_0235344 | Ga0530510_0235344_122_817 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5npm-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus | 0.972 | 18 | 224 |
| 2hw8-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9718 | 2 | 224 |
| 7p7t-assembly1.cif.gz_F | poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii | 0.9672 | 5 | 226 |
| 4v5f-assembly1.cif.gz_BC | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9635 | 5 | 224 |
| 4qg3-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus | 0.9633 | 5 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9886 | 73 | 158 | 3.40.50.790 |
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9752 | 18 | 224 | 3.30.190.20 |
| 2wrrC01 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9714 | 18 | 224 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9664 | 73 | 158 | 3.40.50.790 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9645 | 18 | 231 | 3.30.190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0R701-F1-model_v4 | Ribosomal protein | 0.9882 | 54 | 228 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A6A5L9H4-F1-model_v4 | deleted | 0.9867 | 29 | 219 |
|
| AF-A0A6A5L9E3-F1-model_v4 | deleted | 0.9842 | 34 | 224 |
|
| AF-A0A099DCT0-F1-model_v4 | deleted | 0.9841 | 67 | 205 |
|
| AF-A0A172MJZ5-F1-model_v4 | Ribosomal protein | 0.984 | 33 | 190 |
GO:0003735
GO:0006412 GO:0006417 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar