F462618

General Info

Members Datasets Scaffolds Average Seq Length
551 229 1102 98

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10501647|Ga0207686_105016471
Length 119
Sequence VDRRFVPRRPLRRGAFDATLAAMFVIELVYKSDLVEIDAHMAAHVRFLKKYYAAGNFLVSGRKIPRDGGIILAVGKSRREIEAIVKEDPFYEHGLADFRIIEFRASQRADDIQKRIETR

Samples

Sample ID Description Type Environment
1 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
165 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
166 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
167 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
168 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
190 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
191 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
202 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
203 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
204 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
205 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
208 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
222 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 2
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 24.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207686_10501647 3300025934 Bacteria 942
2 JGI25406J46586_10003113 3300003203 Bacteria 7798
3 Ga0065714_10430296 3300005288 Unclassified 568
4 Ga0065704_10236000 3300005289 Bacteria 1029
5 Ga0065704_10563344 3300005289 Unclassified 628
6 Ga0065715_10005736 3300005293 Bacteria 3775
7 Ga0065707_10229963 3300005295 Unclassified 1192
8 Ga0065707_10386437 3300005295 Unclassified 870
9 Ga0070676_10043015 3300005328 Bacteria 2624
10 Ga0070676_10140572 3300005328 Unclassified 1536
11 Ga0070676_10148161 3300005328 Bacteria 1500
12 Ga0070676_10541464 3300005328 Bacteria 832
13 Ga0070676_10619251 3300005328 Bacteria 782
14 Ga0070683_100801770 3300005329 Bacteria 903
15 Ga0070690_100039941 3300005330 Bacteria 2966
16 Ga0070690_100268820 3300005330 Unclassified 1212
17 Ga0070670_100028658 3300005331 Bacteria 4792
18 Ga0070677_10006527 3300005333 Bacteria 3877
19 Ga0070677_10088982 3300005333 Bacteria 1339
20 Ga0070677_10219855 3300005333 Unclassified 927
21 Ga0070677_10233109 3300005333 Bacteria 905
22 Ga0068869_100003353 3300005334 Bacteria 9776
23 Ga0068869_100139956 3300005334 Bacteria 1868
24 Ga0068869_101125969 3300005334 Bacteria 687
25 Ga0068869_101326837 3300005334 Unclassified 635
26 Ga0070666_10550076 3300005335 Bacteria 839
27 Ga0070680_100602371 3300005336 Unclassified 943
28 Ga0070680_101602302 3300005336 Bacteria 564
29 Ga0070682_100505747 3300005337 Bacteria 937
30 Ga0070682_100655494 3300005337 Bacteria 836
31 Ga0068868_100054587 3300005338 Unclassified 3149
32 Ga0068868_100105873 3300005338 Bacteria 2281
33 Ga0068868_102147064 3300005338 Unclassified 531
34 Ga0070660_100854798 3300005339 Unclassified 766
35 Ga0070689_100000024 3300005340 Bacteria 115762
36 Ga0070689_100055279 3300005340 Bacteria 3076
37 Ga0070689_100682658 3300005340 Unclassified 895
38 Ga0070661_100010587 3300005344 Bacteria 6414
39 Ga0070668_100006686 3300005347 Bacteria 8546
40 Ga0070668_100102387 3300005347 Bacteria 2270
41 Ga0070668_100659286 3300005347 Bacteria 920
42 Ga0070669_100005903 3300005353 Bacteria 8835
43 Ga0070669_100036189 3300005353 Unclassified 3576
44 Ga0070669_100054927 3300005353 Bacteria 2918
45 Ga0070669_100312320 3300005353 Unclassified 1267
46 Ga0070669_100503852 3300005353 Bacteria 1004
47 Ga0070675_100005541 3300005354 Bacteria 9664
48 Ga0070675_100057609 3300005354 Bacteria 3204
49 Ga0070675_100774161 3300005354 Bacteria 876
50 Ga0070675_100816902 3300005354 Unclassified 852
51 Ga0070671_100000744 3300005355 Bacteria 23345
52 Ga0070671_100126685 3300005355 Unclassified 2150
53 Ga0070671_100999955 3300005355 Bacteria 733
54 Ga0070674_100026696 3300005356 Bacteria 3775
55 Ga0070674_100108634 3300005356 Bacteria 2033
56 Ga0070674_100927763 3300005356 Bacteria 760
57 Ga0070673_100022878 3300005364 Bacteria 4558
58 Ga0070673_100067242 3300005364 Bacteria 2865
59 Ga0070673_100816818 3300005364 Unclassified 861
60 Ga0070688_100002318 3300005365 Bacteria 9620
61 Ga0070688_100011253 3300005365 Bacteria 4967
62 Ga0070688_100892694 3300005365 Bacteria 700
63 Ga0070688_101477971 3300005365 Unclassified 552
64 Ga0070659_100142696 3300005366 Bacteria 1950
65 Ga0070659_100148850 3300005366 Unclassified 1909
66 Ga0070667_100003685 3300005367 Bacteria 13042
67 Ga0070667_100192833 3300005367 Bacteria 1805
68 Ga0070667_101897288 3300005367 Bacteria 561
69 Ga0070701_10026197 3300005438 Bacteria 2841
70 Ga0070701_10133331 3300005438 Bacteria 1413
71 Ga0070701_10510167 3300005438 Bacteria 782
72 Ga0070701_10636585 3300005438 Unclassified 710
73 Ga0070705_100045570 3300005440 Bacteria 2523
74 Ga0070700_100045154 3300005441 Bacteria 2717
75 Ga0070700_100048565 3300005441 Unclassified 2630
76 Ga0070700_100070257 3300005441 Bacteria 2232
77 Ga0070700_100163389 3300005441 Bacteria 1535
78 Ga0070700_100697162 3300005441 Bacteria 807
79 Ga0070700_101895098 3300005441 Unclassified 515
80 Ga0070694_100082722 3300005444 Bacteria 2236
81 Ga0070663_100499951 3300005455 Bacteria 1009
82 Ga0070678_100061141 3300005456 Unclassified 2775
83 Ga0070662_100021862 3300005457 Bacteria 4372
84 Ga0070662_100089718 3300005457 Unclassified 2306
85 Ga0070662_100090064 3300005457 Bacteria 2302
86 Ga0070662_100274378 3300005457 Bacteria 1362
87 Ga0070681_10369801 3300005458 Bacteria 1344
88 Ga0070681_11104623 3300005458 Bacteria 714
89 Ga0068867_100042851 3300005459 Bacteria 3312
90 Ga0068867_100167998 3300005459 Unclassified 1735
91 Ga0068867_100668889 3300005459 Unclassified 913
92 Ga0070685_10006396 3300005466 Bacteria 6004
93 Ga0070685_10006452 3300005466 Bacteria 5985
94 Ga0070685_10551897 3300005466 Unclassified 822
95 Ga0070698_100283445 3300005471 Bacteria 1588
96 Ga0070679_100228954 3300005530 Bacteria 1818
97 Ga0070684_100095052 3300005535 Bacteria 2655
98 Ga0070672_100026489 3300005543 Bacteria 4315
99 Ga0070672_100189022 3300005543 Bacteria 1718
100 Ga0070672_100725029 3300005543 Unclassified 871
101 Ga0070672_100930802 3300005543 Bacteria 768
102 Ga0070686_100002263 3300005544 Bacteria 10617
103 Ga0070686_100024446 3300005544 Bacteria 3621
104 Ga0070686_100058829 3300005544 Unclassified 2474
105 Ga0070686_101898884 3300005544 Unclassified 508
106 Ga0070695_101204175 3300005545 Bacteria 623
107 Ga0070693_100215123 3300005547 Bacteria 1256
108 Ga0070693_100394991 3300005547 Bacteria 957
109 Ga0070665_100049909 3300005548 Bacteria 4198
110 Ga0070665_100198523 3300005548 Bacteria 2007
111 Ga0070665_100201187 3300005548 Unclassified 1992
112 Ga0070704_100148963 3300005549 Bacteria 1837
113 Ga0070704_100397557 3300005549 Bacteria 1175
114 Ga0070704_100818303 3300005549 Bacteria 833
115 Ga0070704_102218117 3300005549 Unclassified 511
116 Ga0070664_100003417 3300005564 Bacteria 12825
117 Ga0070664_100008808 3300005564 Bacteria 8177
118 Ga0070664_100470253 3300005564 Bacteria 1156
119 Ga0068857_100021441 3300005577 Bacteria 5687
120 Ga0068857_100047158 3300005577 Bacteria 3825
121 Ga0068857_100151859 3300005577 Bacteria 2099
122 Ga0068857_100485064 3300005577 Unclassified 1159
123 Ga0068854_100415563 3300005578 Bacteria 1116
124 Ga0068854_101586548 3300005578 Unclassified 596
125 Ga0068854_101663237 3300005578 Bacteria 583
126 Ga0068856_100262358 3300005614 Bacteria 1743
127 Ga0070702_100006564 3300005615 Bacteria 5516
128 Ga0070702_100085817 3300005615 Bacteria 1897
129 Ga0070702_100473916 3300005615 Bacteria 913
130 Ga0068859_100000817 3300005617 Bacteria 31690
131 Ga0068859_100023631 3300005617 Bacteria 6169
132 Ga0068859_100097830 3300005617 Bacteria 2988
133 Ga0068864_100012316 3300005618 Bacteria 7069
134 Ga0068864_101509162 3300005618 Unclassified 675
135 Ga0068866_10027161 3300005718 Bacteria 2711
136 Ga0068866_10882733 3300005718 Bacteria 628
137 Ga0068861_100021309 3300005719 Bacteria 4658
138 Ga0068861_100044359 3300005719 Bacteria 3343
139 Ga0068861_100071126 3300005719 Unclassified 2696
140 Ga0068861_101116248 3300005719 Unclassified 758
141 Ga0068870_10020491 3300005840 Bacteria 3221
142 Ga0068870_10446185 3300005840 Bacteria 852
143 Ga0068870_11194450 3300005840 Unclassified 550
144 Ga0068863_100010005 3300005841 Bacteria 9231
145 Ga0068863_100015735 3300005841 Bacteria 7264
146 Ga0068863_101257508 3300005841 Bacteria 746
147 Ga0068858_100021535 3300005842 Bacteria 6024
148 Ga0068858_100267645 3300005842 Unclassified 1625
149 Ga0068858_100331045 3300005842 Bacteria 1457
150 Ga0068860_100028173 3300005843 Bacteria 5407
151 Ga0068860_100048644 3300005843 Bacteria 4041
152 Ga0068860_100100045 3300005843 Unclassified 2766
153 Ga0068860_100224823 3300005843 Bacteria 1823
154 Ga0068860_102138892 3300005843 Unclassified 581
155 Ga0068862_100001775 3300005844 Bacteria 19501
156 Ga0068862_100009798 3300005844 Bacteria 7919
157 Ga0068862_100057829 3300005844 Bacteria 3326
158 Ga0068862_100110315 3300005844 Bacteria 2414
159 Ga0068862_100593686 3300005844 Bacteria 1062
160 Ga0068862_100656459 3300005844 Unclassified 1012
161 Ga0068862_101206790 3300005844 Bacteria 755
162 Ga0068862_101838702 3300005844 Unclassified 615
163 Ga0081455_10156505 3300005937 Bacteria 1751
164 Ga0081539_10000114 3300005985 Bacteria 188734
165 Ga0097621_100274775 3300006237 Bacteria 1482
166 Ga0097621_100376645 3300006237 Unclassified 1267
167 Ga0097621_100719563 3300006237 Unclassified 920
168 Ga0068871_100029442 3300006358 Bacteria 4313
169 Ga0068871_100362452 3300006358 Unclassified 1284
170 Ga0068871_101568114 3300006358 Bacteria 623
171 Ga0075428_100003247 3300006844 Bacteria 17798
172 Ga0075428_100024949 3300006844 Bacteria 6614
173 Ga0075428_100041922 3300006844 Bacteria 5033
174 Ga0075428_100060802 3300006844 Bacteria 4137
175 Ga0075428_100167323 3300006844 Bacteria 2384
176 Ga0075428_100965477 3300006844 Bacteria 903
177 Ga0075430_100015939 3300006846 Bacteria 6400
178 Ga0075430_100062872 3300006846 Bacteria 3118
179 Ga0075430_100073527 3300006846 Bacteria 2866
180 Ga0075430_100150088 3300006846 Unclassified 1941
181 Ga0075430_100446989 3300006846 Bacteria 1067
182 Ga0075431_100000006 3300006847 Bacteria 102881
183 Ga0075431_100007260 3300006847 Bacteria 11030
184 Ga0075431_100022975 3300006847 Bacteria 6374
185 Ga0075431_100044397 3300006847 Bacteria 4584
186 Ga0075431_100273551 3300006847 Bacteria 1711
187 Ga0075431_100327268 3300006847 Bacteria 1544
188 Ga0075431_100342131 3300006847 Bacteria 1505
189 Ga0075431_100867335 3300006847 Bacteria 873
190 Ga0075431_101841999 3300006847 Bacteria 561
191 Ga0075433_10484370 3300006852 Bacteria 1090
192 Ga0075434_100664469 3300006871 Bacteria 1060
193 Ga0075429_100002477 3300006880 Bacteria 15533
194 Ga0075429_100088123 3300006880 Bacteria 2705
195 Ga0075429_100111549 3300006880 Bacteria 2390
196 Ga0075429_100156454 3300006880 Bacteria 1996
197 Ga0075429_100278020 3300006880 Bacteria 1466
198 Ga0075429_100503776 3300006880 Bacteria 1061
199 Ga0075429_100854529 3300006880 Unclassified 797
200 Ga0068865_100005869 3300006881 Bacteria 7470
201 Ga0068865_100033253 3300006881 Bacteria 3451
202 Ga0097620_100000817 3300006931 Bacteria 31690
203 Ga0097620_100023631 3300006931 Bacteria 6169
204 Ga0097620_100097838 3300006931 Bacteria 2988
205 Ga0075435_100096978 3300007076 Unclassified 2439
206 Ga0105250_10022177 3300009092 Unclassified 2561
207 Ga0111539_10000553 3300009094 Bacteria 47851
208 Ga0111539_10001806 3300009094 Bacteria 28489
209 Ga0111539_10003272 3300009094 Bacteria 21415
210 Ga0111539_10017124 3300009094 Bacteria 8971
211 Ga0111539_10030245 3300009094 Bacteria 6585
212 Ga0111539_10070594 3300009094 Bacteria 4123
213 Ga0111539_10116274 3300009094 Bacteria 3136
214 Ga0111539_10257213 3300009094 Bacteria 2033
215 Ga0111539_10787648 3300009094 Bacteria 1106
216 Ga0111539_11980993 3300009094 Unclassified 675
217 Ga0105245_11079057 3300009098 Bacteria 849
218 Ga0105245_13037905 3300009098 Unclassified 520
219 Ga0105247_10000329 3300009101 Bacteria 41935
220 Ga0105247_10056446 3300009101 Bacteria 2425
221 Ga0114129_10002025 3300009147 Bacteria 27789
222 Ga0114129_10068569 3300009147 Bacteria 4945
223 Ga0114129_10081751 3300009147 Unclassified 4490
224 Ga0114129_10230945 3300009147 Bacteria 2492
225 Ga0114129_10404107 3300009147 Bacteria 1799
226 Ga0114129_10548144 3300009147 Bacteria 1504
227 Ga0114129_11661910 3300009147 Bacteria 780
228 Ga0114129_11765384 3300009147 Bacteria 753
229 Ga0105243_10029084 3300009148 Bacteria 4248
230 Ga0105243_10991874 3300009148 Unclassified 842
231 Ga0105242_10441279 3300009176 Unclassified 1225
232 Ga0105242_11703522 3300009176 Bacteria 667
233 Ga0105242_11891742 3300009176 Bacteria 637
234 Ga0105242_12283795 3300009176 Bacteria 587
235 Ga0105248_10020382 3300009177 Bacteria 7346
236 Ga0105248_10161455 3300009177 Bacteria 2528
237 Ga0105248_10337849 3300009177 Unclassified 1696
238 Ga0105248_10375280 3300009177 Unclassified 1601
239 Ga0105248_11557214 3300009177 Unclassified 748
240 Ga0105249_10001902 3300009553 Bacteria 18075
241 Ga0105249_10005393 3300009553 Bacteria 11040
242 Ga0105249_10010293 3300009553 Bacteria 8215
243 Ga0105249_10011012 3300009553 Bacteria 7946
244 Ga0105249_10015819 3300009553 Bacteria 6685
245 Ga0105249_10043362 3300009553 Bacteria 4091
246 Ga0105249_10098035 3300009553 Bacteria 2752
247 Ga0105249_12005037 3300009553 Unclassified 651
248 Ga0105249_12028274 3300009553 Unclassified 648
249 Ga0105239_10219959 3300010375 Bacteria 2130
250 Ga0105239_10590766 3300010375 Unclassified 1266
251 Ga0105239_12723314 3300010375 Bacteria 577
252 Ga0105246_10041928 3300011119 Bacteria 3097
253 Ga0105246_10341022 3300011119 Bacteria 1225
254 Ga0105246_10966669 3300011119 Bacteria 769
255 Ga0157374_11184643 3300013296 Bacteria 785
256 Ga0157378_10343067 3300013297 Bacteria 1457
257 Ga0163162_10164974 3300013306 Bacteria 2339
258 Ga0163162_10487115 3300013306 Bacteria 1364
259 Ga0163162_11172533 3300013306 Bacteria 871
260 Ga0163162_12882614 3300013306 Bacteria 553
261 Ga0157375_10936439 3300013308 Bacteria 1009
262 Ga0157375_11168046 3300013308 Bacteria 902
263 Ga0163163_10001274 3300014325 Bacteria 21300
264 Ga0163163_12438712 3300014325 Bacteria 581
265 Ga0157380_10270094 3300014326 Bacteria 1550
266 Ga0157380_10550114 3300014326 Bacteria 1132
267 Ga0157380_11387594 3300014326 Unclassified 753
268 Ga0157380_12137880 3300014326 Unclassified 623
269 Ga0157377_10033066 3300014745 Bacteria 2820
270 Ga0157377_10509140 3300014745 Unclassified 843
271 Ga0157377_11458335 3300014745 Unclassified 542
272 Ga0157379_10052176 3300014968 Bacteria 3652
273 Ga0157379_10268442 3300014968 Bacteria 1551
274 Ga0157376_10054043 3300014969 Unclassified 3347
275 Ga0157376_10115042 3300014969 Bacteria 2374
276 Ga0157376_10300360 3300014969 Unclassified 1520
277 Ga0163161_10647607 3300017792 Bacteria 875
278 Ga0163161_11602051 3300017792 Unclassified 574
279 Ga0207673_1003084 3300025290 Bacteria 1935
280 Ga0207697_10001877 3300025315 Bacteria 11222
281 Ga0207682_10010022 3300025893 Bacteria 3720
282 Ga0207682_10044185 3300025893 Bacteria 1826
283 Ga0207682_10250877 3300025893 Bacteria 824
284 Ga0207642_10537267 3300025899 Bacteria 720
285 Ga0207710_10000306 3300025900 Bacteria 38926
286 Ga0207688_10005219 3300025901 Bacteria 7060
287 Ga0207688_10500283 3300025901 Bacteria 761
288 Ga0207680_10473674 3300025903 Unclassified 890
289 Ga0207680_10556575 3300025903 Bacteria 819
290 Ga0207647_10412160 3300025904 Bacteria 760
291 Ga0207645_10006054 3300025907 Bacteria 8695
292 Ga0207645_10019423 3300025907 Bacteria 4454
293 Ga0207645_10057650 3300025907 Bacteria 2480
294 Ga0207645_10090131 3300025907 Bacteria 1972
295 Ga0207645_10508324 3300025907 Bacteria 816
296 Ga0207643_10000926 3300025908 Bacteria 17573
297 Ga0207643_10030555 3300025908 Bacteria 2999
298 Ga0207643_10044927 3300025908 Bacteria 2494
299 Ga0207643_10282338 3300025908 Bacteria 1030
300 Ga0207654_10519286 3300025911 Bacteria 843
301 Ga0207654_10864236 3300025911 Bacteria 655
302 Ga0207707_10326548 3300025912 Bacteria 1324
303 Ga0207660_10074160 3300025917 Bacteria 2483
304 Ga0207660_10573667 3300025917 Unclassified 918
305 Ga0207660_11357808 3300025917 Bacteria 576
306 Ga0207662_10000410 3300025918 Bacteria 18960
307 Ga0207662_10395441 3300025918 Bacteria 936
308 Ga0207649_10041233 3300025920 Bacteria 2810
309 Ga0207652_10259508 3300025921 Bacteria 1567
310 Ga0207681_10036941 3300025923 Bacteria 3225
311 Ga0207681_10190171 3300025923 Bacteria 1570
312 Ga0207681_10228046 3300025923 Unclassified 1444
313 Ga0207681_10410161 3300025923 Bacteria 1096
314 Ga0207659_10010710 3300025926 Bacteria 5765
315 Ga0207659_10232950 3300025926 Unclassified 1486
316 Ga0207687_10959141 3300025927 Unclassified 733
317 Ga0207687_11537554 3300025927 Bacteria 571
318 Ga0207644_10211321 3300025931 Bacteria 1534
319 Ga0207644_10457881 3300025931 Unclassified 1048
320 Ga0207690_10100667 3300025932 Bacteria 2063
321 Ga0207706_10011385 3300025933 Bacteria 8103
322 Ga0207706_10014414 3300025933 Bacteria 7164
323 Ga0207706_10016592 3300025933 Bacteria 6648
324 Ga0207686_11768470 3300025934 Unclassified 511
325 Ga0207670_10000030 3300025936 Bacteria 116237
326 Ga0207670_10096596 3300025936 Unclassified 2102
327 Ga0207670_10241698 3300025936 Bacteria 1391
328 Ga0207669_10193447 3300025937 Bacteria 1469
329 Ga0207669_10767555 3300025937 Bacteria 797
330 Ga0207669_11370998 3300025937 Unclassified 602
331 Ga0207704_10005414 3300025938 Bacteria 5886
332 Ga0207704_10061950 3300025938 Bacteria 2323
333 Ga0207704_10750857 3300025938 Bacteria 811
334 Ga0207704_10849286 3300025938 Unclassified 765
335 Ga0207691_10002214 3300025940 Bacteria 19006
336 Ga0207691_10017592 3300025940 Bacteria 6775
337 Ga0207691_10148934 3300025940 Bacteria 2059
338 Ga0207691_11140499 3300025940 Bacteria 648
339 Ga0207711_10064613 3300025941 Unclassified 3161
340 Ga0207711_10112975 3300025941 Bacteria 2418
341 Ga0207689_10737372 3300025942 Unclassified 831
342 Ga0207689_10974106 3300025942 Unclassified 716
343 Ga0207679_10003661 3300025945 Bacteria 9525
344 Ga0207679_10402309 3300025945 Bacteria 1205
345 Ga0207651_10170815 3300025960 Unclassified 1714
346 Ga0207712_10030686 3300025961 Bacteria 3616
347 Ga0207712_10031779 3300025961 Bacteria 3558
348 Ga0207712_10035064 3300025961 Unclassified 3405
349 Ga0207712_10202340 3300025961 Unclassified 1575
350 Ga0207712_10222115 3300025961 Bacteria 1511
351 Ga0207712_11719562 3300025961 Unclassified 562
352 Ga0207668_10069463 3300025972 Bacteria 2508
353 Ga0207668_10105043 3300025972 Bacteria 2107
354 Ga0207668_10860225 3300025972 Bacteria 805
355 Ga0207640_11202633 3300025981 Bacteria 674
356 Ga0207640_11428261 3300025981 Unclassified 620
357 Ga0207658_10011810 3300025986 Bacteria 5950
358 Ga0207677_10313114 3300026023 Unclassified 1301
359 Ga0207703_10019390 3300026035 Bacteria 5314
360 Ga0207703_10239446 3300026035 Unclassified 1631
361 Ga0207703_10322453 3300026035 Bacteria 1415
362 Ga0207703_11065159 3300026035 Unclassified 776
363 Ga0207678_10518164 3300026067 Bacteria 1040
364 Ga0207708_10002543 3300026075 Bacteria 13415
365 Ga0207708_10036921 3300026075 Bacteria 3721
366 Ga0207708_10204530 3300026075 Bacteria 1576
367 Ga0207708_10723584 3300026075 Bacteria 852
368 Ga0207641_10016278 3300026088 Bacteria 6090
369 Ga0207641_10024838 3300026088 Bacteria 4939
370 Ga0207641_11178453 3300026088 Unclassified 765
371 Ga0207648_10001568 3300026089 Bacteria 25093
372 Ga0207648_10027186 3300026089 Bacteria 5081
373 Ga0207648_10201819 3300026089 Bacteria 1764
374 Ga0207648_10726395 3300026089 Bacteria 921
375 Ga0207674_10033905 3300026116 Bacteria 5341
376 Ga0207674_10451014 3300026116 Unclassified 1243
377 Ga0207674_10871221 3300026116 Bacteria 868
378 Ga0207674_11292675 3300026116 Bacteria 699
379 Ga0207675_100000327 3300026118 Bacteria 45350
380 Ga0207675_100008175 3300026118 Bacteria 9861
381 Ga0207675_100016039 3300026118 Bacteria 6995
382 Ga0207675_101629662 3300026118 Unclassified 666
383 Ga0207683_10018975 3300026121 Bacteria 5868
384 Ga0207683_10099843 3300026121 Bacteria 2591
385 Ga0210000_1018750 3300027462 Unclassified 1052
386 Ga0209995_1021938 3300027471 Bacteria 1059
387 Ga0209999_1010712 3300027543 Bacteria 1658
388 Ga0209982_1018004 3300027552 Bacteria 1079
389 Ga0209970_1005754 3300027614 Bacteria 2040
390 Ga0210002_1019222 3300027617 Bacteria 1095
391 Ga0209974_10004326 3300027876 Bacteria 5051
392 Ga0209974_10136991 3300027876 Unclassified 876
393 Ga0207428_10000684 3300027907 Bacteria 39601
394 Ga0207428_10006670 3300027907 Bacteria 10601
395 Ga0207428_10131710 3300027907 Bacteria 1913
396 Ga0207428_10198972 3300027907 Bacteria 1508
397 Ga0207428_10720015 3300027907 Unclassified 713
398 Ga0268266_10281591 3300028379 Bacteria 1546
399 Ga0268266_11159457 3300028379 Unclassified 747
400 Ga0268265_10018259 3300028380 Bacteria 4858
401 Ga0268265_10019972 3300028380 Bacteria 4667
402 Ga0268265_10183594 3300028380 Bacteria 1799
403 Ga0268265_10506806 3300028380 Unclassified 1138
404 Ga0268265_10609326 3300028380 Bacteria 1045
405 Ga0268265_10652868 3300028380 Bacteria 1011
406 Ga0268265_10690271 3300028380 Bacteria 985
407 Ga0268264_10518164 3300028381 Unclassified 1165
408 Ga0268264_10637135 3300028381 Bacteria 1054
409 Ga0307408_100018631 3300031548 Bacteria 4663
410 Ga0307408_100025956 3300031548 Bacteria 4017
411 Ga0307408_100044315 3300031548 Bacteria 3170
412 Ga0307405_10060034 3300031731 Bacteria 2398
413 Ga0307413_10105775 3300031824 Bacteria 1871
414 Ga0307413_11578984 3300031824 Bacteria 582
415 Ga0307410_10106714 3300031852 Bacteria 2019
416 Ga0307410_10372853 3300031852 Bacteria 1146
417 Ga0307410_10380885 3300031852 Bacteria 1135
418 Ga0307406_10290845 3300031901 Bacteria 1251
419 Ga0307406_10934255 3300031901 Bacteria 740
420 Ga0307406_11395459 3300031901 Bacteria 614
421 Ga0307407_10012832 3300031903 Bacteria 4045
422 Ga0307407_10037053 3300031903 Bacteria 2692
423 Ga0307412_10086251 3300031911 Bacteria 2184
424 Ga0307412_10401343 3300031911 Bacteria 1116
425 Ga0307412_10465318 3300031911 Bacteria 1045
426 Ga0307412_11443304 3300031911 Unclassified 624
427 Ga0307409_100018528 3300031995 Bacteria 4684
428 Ga0307409_100387735 3300031995 Unclassified 1330
429 Ga0307409_100932283 3300031995 Unclassified 883
430 Ga0307416_100402847 3300032002 Unclassified 1406
431 Ga0307416_101278444 3300032002 Bacteria 839
432 Ga0307414_10174943 3300032004 Bacteria 1720
433 Ga0307411_10118173 3300032005 Unclassified 1912
434 Ga0307411_10458124 3300032005 Bacteria 1068
435 Ga0307411_10598774 3300032005 Bacteria 947
436 Ga0307411_11014752 3300032005 Unclassified 744
437 Ga0307415_100118373 3300032126 Bacteria 1980
438 Ga0307415_100717836 3300032126 Bacteria 904
439 Ga0373932_0012065 3300035112 Unclassified 2123
440 Ga0373962_0306672 3300035242 Bacteria 564
441 Ga0439450_179195 3300042008 Unclassified 562
442 Ga0450921_004832 3300042123 Unclassified 1000
443 Ga0450892_010041 3300042130 Bacteria 825
444 Ga0450896_053417 3300042133 Unclassified 647
445 Ga0450899_015420 3300042135 Bacteria 871
446 Ga0439444_0031616 3300042437 Bacteria 997
447 Ga0439464_0056938 3300042439 Bacteria 1139
448 Ga0439464_0092274 3300042439 Bacteria 914
449 Ga0439464_0211361 3300042439 Bacteria 621
450 Ga0439460_0156889 3300042461 Bacteria 761
451 Ga0453683_0730557 3300044673 Unclassified 650
452 Ga0451576_0024132 3300045051 Bacteria 6570
453 Ga0451576_2263587 3300045051 Unclassified 557
454 Ga0495668_0203141 3300046616 Bacteria 1085
455 Ga0496100_1081289 3300048903 Bacteria 632
456 Ga0496102_0836801 3300048905 Unclassified 842
457 Ga0496104_0434998 3300048907 Bacteria 1224
458 Ga0496106_0836538 3300048909 Unclassified 729
459 Ga0496107_0546119 3300048910 Unclassified 858
460 Ga0496109_0268620 3300048912 Bacteria 1607
461 Ga0496109_1333570 3300048912 Unclassified 653
462 Ga0496110_0633997 3300048913 Bacteria 968
463 Ga0496111_0653843 3300048914 Unclassified 767
464 Ga0496112_0056653 3300048915 Bacteria 3858
465 Ga0496112_0583482 3300048915 Bacteria 1050
466 Ga0496119_0426866 3300048922 Unclassified 628
467 Ga0496121_0004494 3300048924 Bacteria 18693
468 Ga0496122_0553967 3300048925 Unclassified 547
469 Ga0496124_0468638 3300048927 Unclassified 854
470 Ga0496125_0053539 3300048928 Bacteria 3307
471 Ga0501296_031703 3300049519 Unclassified 715
472 Ga0501298_054301 3300049521 Bacteria 836
473 Ga0501299_000590 3300049522 Bacteria 4345
474 Ga0501299_038869 3300049522 Bacteria 948
475 Ga0501299_109363 3300049522 Bacteria 652
476 Ga0501299_150198 3300049522 Unclassified 587
477 Ga0501031_0488301 3300049568 Bacteria 795
478 Ga0501037_0093643 3300049573 Unclassified 2172
479 Ga0501041_0064287 3300049577 Unclassified 2247
480 Ga0501041_1124738 3300049577 Bacteria 506
481 Ga0501046_0002417 3300049580 Bacteria 17511
482 Ga0501046_0261350 3300049580 Bacteria 1272
483 Ga0501068_0809801 3300049584 Bacteria 614
484 Ga0501069_0485457 3300049585 Bacteria 736
485 Ga0501072_0122233 3300049588 Bacteria 2074
486 Ga0501072_0543154 3300049588 Bacteria 918
487 Ga0501075_0253711 3300049591 Bacteria 1341
488 Ga0501077_0057139 3300049593 Bacteria 2478
489 Ga0501216_169528 3300049660 Bacteria 528
490 Ga0501238_035999 3300049671 Unclassified 722
491 Ga0501243_059997 3300049675 Bacteria 704
492 Ga0501249_000791 3300049679 Bacteria 7080
493 Ga0501245_123875 3300049708 Unclassified 547
494 Ga0501080_0046082 3300049742 Bacteria 4061
495 Ga0501080_0108578 3300049742 Bacteria 2572
496 Ga0501268_032720 3300049765 Bacteria 949
497 Ga0501283_035628 3300049779 Unclassified 848
498 Ga0501035_1139474 3300049822 Bacteria 608
499 Ga0501045_0053957 3300049824 Bacteria 2938
500 Ga0501045_0136240 3300049824 Bacteria 1825
501 nmdc:mga05p37_14623_c1 3300050507 Bacteria 9429
502 nmdc:mga05p37_158490_c1 3300050507 Bacteria 2765
503 nmdc:mga05p37_1696550_c1 3300050507 Unclassified 616
504 nmdc:mga05p37_26800_c1 3300050507 Bacteria 4760
505 nmdc:mga05p37_311925_c1 3300050507 Bacteria 1864
506 nmdc:mga05p37_77179_c1 3300050507 Unclassified 4101
507 nmdc:mga05p37_79_c1 3300050507 Bacteria 85182
508 nmdc:mga09592_119418_c1 3300050508 Bacteria 2264
509 nmdc:mga09592_308_c1 3300050508 Bacteria 35779
510 nmdc:mga09592_400030_c1 3300050508 Bacteria 1187
511 nmdc:mga09592_440264_c1 3300050508 Bacteria 1125
512 nmdc:mga09592_466515_c1 3300050508 Bacteria 1089
513 nmdc:mga09592_82163_c1 3300050508 Bacteria 2746
514 nmdc:mga0qj67_142495_c1 3300050509 Unclassified 1943
515 nmdc:mga0qj67_178006_c1 3300050509 Bacteria 1727
516 nmdc:mga0qj67_220898_c1 3300050509 Bacteria 1538
517 nmdc:mga0qj67_50982_c1 3300050509 Bacteria 3272
518 nmdc:mga0qj67_61793_c1 3300050509 Bacteria 2975
519 nmdc:mga0qj67_697314_c1 3300050509 Bacteria 808
520 nmdc:mga0qj67_9749_c1 3300050509 Bacteria 7154
521 nmdc:mga06r32_21068_c1 3300050510 Bacteria 6014
522 nmdc:mga06r32_231474_c1 3300050510 Bacteria 1836
523 nmdc:mga06r32_256967_c1 3300050510 Bacteria 1735
524 nmdc:mga06r32_272065_c1 3300050510 Bacteria 1681
525 nmdc:mga06r32_4379_c1 3300050510 Bacteria 12624
526 nmdc:mga06r32_48846_c1 3300050510 Bacteria 4046
527 nmdc:mga06r32_609_c1 3300050510 Bacteria 31282
528 nmdc:mga08y16_1249045_c1 3300050511 Bacteria 712
529 nmdc:mga08y16_16297_c1 3300050511 Bacteria 7815
530 nmdc:mga08y16_261116_c2 3300050511 Bacteria 1211
531 nmdc:mga08y16_2836_c1 3300050511 Bacteria 17812
532 nmdc:mga08y16_319371_c1 3300050511 Bacteria 1599
533 nmdc:mga08y16_36456_c1 3300050511 Bacteria 5166
534 nmdc:mga08y16_69_c1 3300050511 Bacteria 85136
535 nmdc:mga0rr50_34728_c1 3300050513 Unclassified 3613
536 nmdc:mga0a205_115624_c1 3300050515 Unclassified 2581
537 nmdc:mga0a205_1205731_c1 3300050515 Unclassified 605
538 nmdc:mga0a205_4389_c1 3300050515 Bacteria 12650
539 Ga0500583_0012066 3300053092 Bacteria 3282
540 Ga0500641_0317100 3300053096 Unclassified 635
541 Ga0500658_0078833 3300053134 Bacteria 1405
542 Ga0500633_0363292 3300053160 Unclassified 526
543 Ga0500656_023017 3300053732 Unclassified 785
544 Ga0501084_0165420 3300054114 Bacteria 1867
545 Ga0501084_0576429 3300054114 Unclassified 951
546 Ga0590071_001192 3300059421 Bacteria 7035
547 Ga0590074_001094 3300059423 Unclassified 4271
548 Ga0590075_000067 3300059424 Bacteria 25816
549 Ga0590077_002417 3300059426 Bacteria 4007
550 Ga0501082_0226420 3300060353 Bacteria 1627
551 Ga0530510_0363281 3300061734 Bacteria 1088
552 Ga0207686_10501647
553 JGI25406J46586_10003113
554 Ga0065714_10430296
555 Ga0065704_10236000
556 Ga0065704_10563344
557 Ga0065715_10005736
558 Ga0065707_10229963
559 Ga0065707_10386437
560 Ga0070676_10043015
561 Ga0070676_10140572
562 Ga0070676_10148161
563 Ga0070676_10541464
564 Ga0070676_10619251
565 Ga0070683_100801770
566 Ga0070690_100039941
567 Ga0070690_100268820
568 Ga0070670_100028658
569 Ga0070677_10006527
570 Ga0070677_10088982
571 Ga0070677_10219855
572 Ga0070677_10233109
573 Ga0068869_100003353
574 Ga0068869_100139956
575 Ga0068869_101125969
576 Ga0068869_101326837
577 Ga0070666_10550076
578 Ga0070680_100602371
579 Ga0070680_101602302
580 Ga0070682_100505747
581 Ga0070682_100655494
582 Ga0068868_100054587
583 Ga0068868_100105873
584 Ga0068868_102147064
585 Ga0070660_100854798
586 Ga0070689_100000024
587 Ga0070689_100055279
588 Ga0070689_100682658
589 Ga0070661_100010587
590 Ga0070668_100006686
591 Ga0070668_100102387
592 Ga0070668_100659286
593 Ga0070669_100005903
594 Ga0070669_100036189
595 Ga0070669_100054927
596 Ga0070669_100312320
597 Ga0070669_100503852
598 Ga0070675_100005541
599 Ga0070675_100057609
600 Ga0070675_100774161
601 Ga0070675_100816902
602 Ga0070671_100000744
603 Ga0070671_100126685
604 Ga0070671_100999955
605 Ga0070674_100026696
606 Ga0070674_100108634
607 Ga0070674_100927763
608 Ga0070673_100022878
609 Ga0070673_100067242
610 Ga0070673_100816818
611 Ga0070688_100002318
612 Ga0070688_100011253
613 Ga0070688_100892694
614 Ga0070688_101477971
615 Ga0070659_100142696
616 Ga0070659_100148850
617 Ga0070667_100003685
618 Ga0070667_100192833
619 Ga0070667_101897288
620 Ga0070701_10026197
621 Ga0070701_10133331
622 Ga0070701_10510167
623 Ga0070701_10636585
624 Ga0070705_100045570
625 Ga0070700_100045154
626 Ga0070700_100048565
627 Ga0070700_100070257
628 Ga0070700_100163389
629 Ga0070700_100697162
630 Ga0070700_101895098
631 Ga0070694_100082722
632 Ga0070663_100499951
633 Ga0070678_100061141
634 Ga0070662_100021862
635 Ga0070662_100089718
636 Ga0070662_100090064
637 Ga0070662_100274378
638 Ga0070681_10369801
639 Ga0070681_11104623
640 Ga0068867_100042851
641 Ga0068867_100167998
642 Ga0068867_100668889
643 Ga0070685_10006396
644 Ga0070685_10006452
645 Ga0070685_10551897
646 Ga0070698_100283445
647 Ga0070679_100228954
648 Ga0070684_100095052
649 Ga0070672_100026489
650 Ga0070672_100189022
651 Ga0070672_100725029
652 Ga0070672_100930802
653 Ga0070686_100002263
654 Ga0070686_100024446
655 Ga0070686_100058829
656 Ga0070686_101898884
657 Ga0070695_101204175
658 Ga0070693_100215123
659 Ga0070693_100394991
660 Ga0070665_100049909
661 Ga0070665_100198523
662 Ga0070665_100201187
663 Ga0070704_100148963
664 Ga0070704_100397557
665 Ga0070704_100818303
666 Ga0070704_102218117
667 Ga0070664_100003417
668 Ga0070664_100008808
669 Ga0070664_100470253
670 Ga0068857_100021441
671 Ga0068857_100047158
672 Ga0068857_100151859
673 Ga0068857_100485064
674 Ga0068854_100415563
675 Ga0068854_101586548
676 Ga0068854_101663237
677 Ga0068856_100262358
678 Ga0070702_100006564
679 Ga0070702_100085817
680 Ga0070702_100473916
681 Ga0068859_100000817
682 Ga0068859_100023631
683 Ga0068859_100097830
684 Ga0068864_100012316
685 Ga0068864_101509162
686 Ga0068866_10027161
687 Ga0068866_10882733
688 Ga0068861_100021309
689 Ga0068861_100044359
690 Ga0068861_100071126
691 Ga0068861_101116248
692 Ga0068870_10020491
693 Ga0068870_10446185
694 Ga0068870_11194450
695 Ga0068863_100010005
696 Ga0068863_100015735
697 Ga0068863_101257508
698 Ga0068858_100021535
699 Ga0068858_100267645
700 Ga0068858_100331045
701 Ga0068860_100028173
702 Ga0068860_100048644
703 Ga0068860_100100045
704 Ga0068860_100224823
705 Ga0068860_102138892
706 Ga0068862_100001775
707 Ga0068862_100009798
708 Ga0068862_100057829
709 Ga0068862_100110315
710 Ga0068862_100593686
711 Ga0068862_100656459
712 Ga0068862_101206790
713 Ga0068862_101838702
714 Ga0081455_10156505
715 Ga0081539_10000114
716 Ga0097621_100274775
717 Ga0097621_100376645
718 Ga0097621_100719563
719 Ga0068871_100029442
720 Ga0068871_100362452
721 Ga0068871_101568114
722 Ga0075428_100003247
723 Ga0075428_100024949
724 Ga0075428_100041922
725 Ga0075428_100060802
726 Ga0075428_100167323
727 Ga0075428_100965477
728 Ga0075430_100015939
729 Ga0075430_100062872
730 Ga0075430_100073527
731 Ga0075430_100150088
732 Ga0075430_100446989
733 Ga0075431_100000006
734 Ga0075431_100007260
735 Ga0075431_100022975
736 Ga0075431_100044397
737 Ga0075431_100273551
738 Ga0075431_100327268
739 Ga0075431_100342131
740 Ga0075431_100867335
741 Ga0075431_101841999
742 Ga0075433_10484370
743 Ga0075434_100664469
744 Ga0075429_100002477
745 Ga0075429_100088123
746 Ga0075429_100111549
747 Ga0075429_100156454
748 Ga0075429_100278020
749 Ga0075429_100503776
750 Ga0075429_100854529
751 Ga0068865_100005869
752 Ga0068865_100033253
753 Ga0097620_100000817
754 Ga0097620_100023631
755 Ga0097620_100097838
756 Ga0075435_100096978
757 Ga0105250_10022177
758 Ga0111539_10000553
759 Ga0111539_10001806
760 Ga0111539_10003272
761 Ga0111539_10017124
762 Ga0111539_10030245
763 Ga0111539_10070594
764 Ga0111539_10116274
765 Ga0111539_10257213
766 Ga0111539_10787648
767 Ga0111539_11980993
768 Ga0105245_11079057
769 Ga0105245_13037905
770 Ga0105247_10000329
771 Ga0105247_10056446
772 Ga0114129_10002025
773 Ga0114129_10068569
774 Ga0114129_10081751
775 Ga0114129_10230945
776 Ga0114129_10404107
777 Ga0114129_10548144
778 Ga0114129_11661910
779 Ga0114129_11765384
780 Ga0105243_10029084
781 Ga0105243_10991874
782 Ga0105242_10441279
783 Ga0105242_11703522
784 Ga0105242_11891742
785 Ga0105242_12283795
786 Ga0105248_10020382
787 Ga0105248_10161455
788 Ga0105248_10337849
789 Ga0105248_10375280
790 Ga0105248_11557214
791 Ga0105249_10001902
792 Ga0105249_10005393
793 Ga0105249_10010293
794 Ga0105249_10011012
795 Ga0105249_10015819
796 Ga0105249_10043362
797 Ga0105249_10098035
798 Ga0105249_12005037
799 Ga0105249_12028274
800 Ga0105239_10219959
801 Ga0105239_10590766
802 Ga0105239_12723314
803 Ga0105246_10041928
804 Ga0105246_10341022
805 Ga0105246_10966669
806 Ga0157374_11184643
807 Ga0157378_10343067
808 Ga0163162_10164974
809 Ga0163162_10487115
810 Ga0163162_11172533
811 Ga0163162_12882614
812 Ga0157375_10936439
813 Ga0157375_11168046
814 Ga0163163_10001274
815 Ga0163163_12438712
816 Ga0157380_10270094
817 Ga0157380_10550114
818 Ga0157380_11387594
819 Ga0157380_12137880
820 Ga0157377_10033066
821 Ga0157377_10509140
822 Ga0157377_11458335
823 Ga0157379_10052176
824 Ga0157379_10268442
825 Ga0157376_10054043
826 Ga0157376_10115042
827 Ga0157376_10300360
828 Ga0163161_10647607
829 Ga0163161_11602051
830 Ga0207673_1003084
831 Ga0207697_10001877
832 Ga0207682_10010022
833 Ga0207682_10044185
834 Ga0207682_10250877
835 Ga0207642_10537267
836 Ga0207710_10000306
837 Ga0207688_10005219
838 Ga0207688_10500283
839 Ga0207680_10473674
840 Ga0207680_10556575
841 Ga0207647_10412160
842 Ga0207645_10006054
843 Ga0207645_10019423
844 Ga0207645_10057650
845 Ga0207645_10090131
846 Ga0207645_10508324
847 Ga0207643_10000926
848 Ga0207643_10030555
849 Ga0207643_10044927
850 Ga0207643_10282338
851 Ga0207654_10519286
852 Ga0207654_10864236
853 Ga0207707_10326548
854 Ga0207660_10074160
855 Ga0207660_10573667
856 Ga0207660_11357808
857 Ga0207662_10000410
858 Ga0207662_10395441
859 Ga0207649_10041233
860 Ga0207652_10259508
861 Ga0207681_10036941
862 Ga0207681_10190171
863 Ga0207681_10228046
864 Ga0207681_10410161
865 Ga0207659_10010710
866 Ga0207659_10232950
867 Ga0207687_10959141
868 Ga0207687_11537554
869 Ga0207644_10211321
870 Ga0207644_10457881
871 Ga0207690_10100667
872 Ga0207706_10011385
873 Ga0207706_10014414
874 Ga0207706_10016592
875 Ga0207686_11768470
876 Ga0207670_10000030
877 Ga0207670_10096596
878 Ga0207670_10241698
879 Ga0207669_10193447
880 Ga0207669_10767555
881 Ga0207669_11370998
882 Ga0207704_10005414
883 Ga0207704_10061950
884 Ga0207704_10750857
885 Ga0207704_10849286
886 Ga0207691_10002214
887 Ga0207691_10017592
888 Ga0207691_10148934
889 Ga0207691_11140499
890 Ga0207711_10064613
891 Ga0207711_10112975
892 Ga0207689_10737372
893 Ga0207689_10974106
894 Ga0207679_10003661
895 Ga0207679_10402309
896 Ga0207651_10170815
897 Ga0207712_10030686
898 Ga0207712_10031779
899 Ga0207712_10035064
900 Ga0207712_10202340
901 Ga0207712_10222115
902 Ga0207712_11719562
903 Ga0207668_10069463
904 Ga0207668_10105043
905 Ga0207668_10860225
906 Ga0207640_11202633
907 Ga0207640_11428261
908 Ga0207658_10011810
909 Ga0207677_10313114
910 Ga0207703_10019390
911 Ga0207703_10239446
912 Ga0207703_10322453
913 Ga0207703_11065159
914 Ga0207678_10518164
915 Ga0207708_10002543
916 Ga0207708_10036921
917 Ga0207708_10204530
918 Ga0207708_10723584
919 Ga0207641_10016278
920 Ga0207641_10024838
921 Ga0207641_11178453
922 Ga0207648_10001568
923 Ga0207648_10027186
924 Ga0207648_10201819
925 Ga0207648_10726395
926 Ga0207674_10033905
927 Ga0207674_10451014
928 Ga0207674_10871221
929 Ga0207674_11292675
930 Ga0207675_100000327
931 Ga0207675_100008175
932 Ga0207675_100016039
933 Ga0207675_101629662
934 Ga0207683_10018975
935 Ga0207683_10099843
936 Ga0210000_1018750
937 Ga0209995_1021938
938 Ga0209999_1010712
939 Ga0209982_1018004
940 Ga0209970_1005754
941 Ga0210002_1019222
942 Ga0209974_10004326
943 Ga0209974_10136991
944 Ga0207428_10000684
945 Ga0207428_10006670
946 Ga0207428_10131710
947 Ga0207428_10198972
948 Ga0207428_10720015
949 Ga0268266_10281591
950 Ga0268266_11159457
951 Ga0268265_10018259
952 Ga0268265_10019972
953 Ga0268265_10183594
954 Ga0268265_10506806
955 Ga0268265_10609326
956 Ga0268265_10652868
957 Ga0268265_10690271
958 Ga0268264_10518164
959 Ga0268264_10637135
960 Ga0307408_100018631
961 Ga0307408_100025956
962 Ga0307408_100044315
963 Ga0307405_10060034
964 Ga0307413_10105775
965 Ga0307413_11578984
966 Ga0307410_10106714
967 Ga0307410_10372853
968 Ga0307410_10380885
969 Ga0307406_10290845
970 Ga0307406_10934255
971 Ga0307406_11395459
972 Ga0307407_10012832
973 Ga0307407_10037053
974 Ga0307412_10086251
975 Ga0307412_10401343
976 Ga0307412_10465318
977 Ga0307412_11443304
978 Ga0307409_100018528
979 Ga0307409_100387735
980 Ga0307409_100932283
981 Ga0307416_100402847
982 Ga0307416_101278444
983 Ga0307414_10174943
984 Ga0307411_10118173
985 Ga0307411_10458124
986 Ga0307411_10598774
987 Ga0307411_11014752
988 Ga0307415_100118373
989 Ga0307415_100717836
990 Ga0373932_0012065
991 Ga0373962_0306672
992 Ga0439450_179195
993 Ga0450921_004832
994 Ga0450892_010041
995 Ga0450896_053417
996 Ga0450899_015420
997 Ga0439444_0031616
998 Ga0439464_0056938
999 Ga0439464_0092274
1000 Ga0439464_0211361
1001 Ga0439460_0156889
1002 Ga0453683_0730557
1003 Ga0451576_0024132
1004 Ga0451576_2263587
1005 Ga0495668_0203141
1006 Ga0496100_1081289
1007 Ga0496102_0836801
1008 Ga0496104_0434998
1009 Ga0496106_0836538
1010 Ga0496107_0546119
1011 Ga0496109_0268620
1012 Ga0496109_1333570
1013 Ga0496110_0633997
1014 Ga0496111_0653843
1015 Ga0496112_0056653
1016 Ga0496112_0583482
1017 Ga0496119_0426866
1018 Ga0496121_0004494
1019 Ga0496122_0553967
1020 Ga0496124_0468638
1021 Ga0496125_0053539
1022 Ga0501296_031703
1023 Ga0501298_054301
1024 Ga0501299_000590
1025 Ga0501299_038869
1026 Ga0501299_109363
1027 Ga0501299_150198
1028 Ga0501031_0488301
1029 Ga0501037_0093643
1030 Ga0501041_0064287
1031 Ga0501041_1124738
1032 Ga0501046_0002417
1033 Ga0501046_0261350
1034 Ga0501068_0809801
1035 Ga0501069_0485457
1036 Ga0501072_0122233
1037 Ga0501072_0543154
1038 Ga0501075_0253711
1039 Ga0501077_0057139
1040 Ga0501216_169528
1041 Ga0501238_035999
1042 Ga0501243_059997
1043 Ga0501249_000791
1044 Ga0501245_123875
1045 Ga0501080_0046082
1046 Ga0501080_0108578
1047 Ga0501268_032720
1048 Ga0501283_035628
1049 Ga0501035_1139474
1050 Ga0501045_0053957
1051 Ga0501045_0136240
1052 nmdc:mga05p37_14623_c1
1053 nmdc:mga05p37_158490_c1
1054 nmdc:mga05p37_1696550_c1
1055 nmdc:mga05p37_26800_c1
1056 nmdc:mga05p37_311925_c1
1057 nmdc:mga05p37_77179_c1
1058 nmdc:mga05p37_79_c1
1059 nmdc:mga09592_119418_c1
1060 nmdc:mga09592_308_c1
1061 nmdc:mga09592_400030_c1
1062 nmdc:mga09592_440264_c1
1063 nmdc:mga09592_466515_c1
1064 nmdc:mga09592_82163_c1
1065 nmdc:mga0qj67_142495_c1
1066 nmdc:mga0qj67_178006_c1
1067 nmdc:mga0qj67_220898_c1
1068 nmdc:mga0qj67_50982_c1
1069 nmdc:mga0qj67_61793_c1
1070 nmdc:mga0qj67_697314_c1
1071 nmdc:mga0qj67_9749_c1
1072 nmdc:mga06r32_21068_c1
1073 nmdc:mga06r32_231474_c1
1074 nmdc:mga06r32_256967_c1
1075 nmdc:mga06r32_272065_c1
1076 nmdc:mga06r32_4379_c1
1077 nmdc:mga06r32_48846_c1
1078 nmdc:mga06r32_609_c1
1079 nmdc:mga08y16_1249045_c1
1080 nmdc:mga08y16_16297_c1
1081 nmdc:mga08y16_261116_c2
1082 nmdc:mga08y16_2836_c1
1083 nmdc:mga08y16_319371_c1
1084 nmdc:mga08y16_36456_c1
1085 nmdc:mga08y16_69_c1
1086 nmdc:mga0rr50_34728_c1
1087 nmdc:mga0a205_115624_c1
1088 nmdc:mga0a205_1205731_c1
1089 nmdc:mga0a205_4389_c1
1090 Ga0500583_0012066
1091 Ga0500641_0317100
1092 Ga0500658_0078833
1093 Ga0500633_0363292
1094 Ga0500656_023017
1095 Ga0501084_0165420
1096 Ga0501084_0576429
1097 Ga0590071_001192
1098 Ga0590074_001094
1099 Ga0590075_000067
1100 Ga0590077_002417
1101 Ga0501082_0226420
1102 Ga0530510_0363281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

23

104

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.8207 1 85
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7949 2 87
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7928 2 86
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.7869 1 84
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7577 2 89
ID Description Score Start End Superfamily
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8199 1 85 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8013 1 84 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7839 2 88 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7771 1 88 3.30.70.1060
af_I1L029_2_64_3.30.310.20 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;DNA-3-methyladenine glycosylase AlkA, N-terminal domain 0.7768 3 63 3.30.310.20
ID Description Score Start End GO Terms
AF-A0A1M5PIL2-F1-model_v4 Uncharacterized conserved protein YciI, contains a putative active-site phosphohistidine 0.9996 2 87
AF-A0A6B3IRT7-F1-model_v4 YCII-related domain-containing protein 0.9987 1 73
AF-A0A7Y5JL18-F1-model_v4 YCII-related domain-containing protein 0.9973 2 84
AF-A0A5E4Y3I9-F1-model_v4 GTP cyclohydrolase 0.9964 2 88 GO:0016787
AF-A0A3D4TW86-F1-model_v4 GTP cyclohydrolase 0.9953 1 73 GO:0016787

Map