F462496

General Info

Members Datasets Scaffolds Average Seq Length
550 281 548 178

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10159663|Ga0157375_101596633
Length 203
Sequence VADTGETLPGVRKWKPSFYATPMPPDANHLIWIDMEMTGLVPERDRIIEVALVITDANLAPVAQAPVWVVHQQDAVLDAMDSWNQGTHGKSGLVAKVKASVNDEATVEAEALAFLAQHVPSKASPMCGNSICQDRRFLARWMPRLEDWFHYRNLDVSTLKELARRWAPDLMKGIPKEGKHEALADVYESILELKYYREHFIRP

Samples

Sample ID Description Type Environment
1 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
2 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
164 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
165 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
166 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
205 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
206 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
207 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
208 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
209 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
210 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 1.64
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.82
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c011124 3300000044 Bacteria 754
2 JGI24742J22300_10021375 3300002244 Bacteria 1104
3 Ga0065715_10791798 3300005293 Bacteria 613
4 Ga0065707_10004016 3300005295 Bacteria 5740
5 Ga0070676_10176593 3300005328 Bacteria 1386
6 Ga0070690_100000335 3300005330 Bacteria 24144
7 Ga0070690_100189099 3300005330 Bacteria 1426
8 Ga0070670_100021506 3300005331 Bacteria 5549
9 Ga0070670_100021978 3300005331 Bacteria 5489
10 Ga0070670_100022354 3300005331 Bacteria 5444
11 Ga0070670_100554055 3300005331 Bacteria 1026
12 Ga0068869_100001158 3300005334 Bacteria 15429
13 Ga0070666_10201882 3300005335 Bacteria 1399
14 Ga0070680_100001369 3300005336 Bacteria 17652
15 Ga0070680_100044326 3300005336 Bacteria 3615
16 Ga0068868_100000378 3300005338 Bacteria 30380
17 Ga0068868_100242264 3300005338 Bacteria 1515
18 Ga0070660_100158284 3300005339 Bacteria 1824
19 Ga0070689_100213174 3300005340 Bacteria 1581
20 Ga0070691_10255978 3300005341 Bacteria 941
21 Ga0070687_100000353 3300005343 Bacteria 15629
22 Ga0070687_100337491 3300005343 Bacteria 968
23 Ga0070692_10003721 3300005345 Bacteria 6256
24 Ga0070692_10151507 3300005345 Bacteria 1321
25 Ga0070668_100017930 3300005347 Bacteria 5310
26 Ga0070668_100028612 3300005347 Bacteria 4230
27 Ga0070668_100211002 3300005347 Bacteria 1597
28 Ga0070675_100035578 3300005354 Bacteria 4047
29 Ga0070671_100321467 3300005355 Bacteria 1319
30 Ga0070674_100573491 3300005356 Bacteria 950
31 Ga0070673_100110107 3300005364 Bacteria 2283
32 Ga0070673_100205804 3300005364 Bacteria 1697
33 Ga0070688_100034314 3300005365 Bacteria 3073
34 Ga0070659_100099548 3300005366 Bacteria 2339
35 Ga0070667_100075953 3300005367 Bacteria 2868
36 Ga0070667_100154591 3300005367 Bacteria 2017
37 Ga0070703_10006589 3300005406 Bacteria 3255
38 Ga0070701_10000027 3300005438 Bacteria 38022
39 Ga0070701_10113890 3300005438 Bacteria 1515
40 Ga0070711_100598316 3300005439 Bacteria 920
41 Ga0070705_100000061 3300005440 Bacteria 56772
42 Ga0070705_100026329 3300005440 Bacteria 3164
43 Ga0070705_100172034 3300005440 Bacteria 1459
44 Ga0070705_100227540 3300005440 Bacteria 1295
45 Ga0070705_100282480 3300005440 Bacteria 1181
46 Ga0070705_100409054 3300005440 Bacteria 1007
47 Ga0070700_100000386 3300005441 Bacteria 22650
48 Ga0070700_100123244 3300005441 Bacteria 1740
49 Ga0070700_100772742 3300005441 Bacteria 771
50 Ga0070694_100000096 3300005444 Bacteria 42431
51 Ga0070694_100007671 3300005444 Bacteria 6587
52 Ga0070694_100263250 3300005444 Bacteria 1309
53 Ga0070694_100317230 3300005444 Bacteria 1199
54 Ga0070694_100348439 3300005444 Bacteria 1147
55 Ga0070694_100362641 3300005444 Bacteria 1126
56 Ga0070663_100053485 3300005455 Bacteria 2883
57 Ga0070678_100156833 3300005456 Bacteria 1840
58 Ga0070678_100175610 3300005456 Bacteria 1749
59 Ga0070662_100252742 3300005457 Bacteria 1418
60 Ga0070662_100737412 3300005457 Bacteria 835
61 Ga0070681_10000372 3300005458 Bacteria 36177
62 Ga0070681_10032716 3300005458 Bacteria 5221
63 Ga0068867_100001399 3300005459 Bacteria 16670
64 Ga0068867_100039342 3300005459 Bacteria 3447
65 Ga0068867_100180993 3300005459 Bacteria 1676
66 Ga0068867_100196166 3300005459 Bacteria 1614
67 Ga0070698_100066546 3300005471 Bacteria 3626
68 Ga0070699_100094917 3300005518 Bacteria 2611
69 Ga0070679_100030156 3300005530 Bacteria 5353
70 Ga0070697_100027227 3300005536 Bacteria 4572
71 Ga0068853_100032789 3300005539 Bacteria 4403
72 Ga0070672_100035396 3300005543 Bacteria 3796
73 Ga0070672_101226629 3300005543 Bacteria 668
74 Ga0070686_100001578 3300005544 Bacteria 12805
75 Ga0070686_100076937 3300005544 Bacteria 2198
76 Ga0070695_100000965 3300005545 Bacteria 15608
77 Ga0070695_100010236 3300005545 Bacteria 5595
78 Ga0070695_100021715 3300005545 Bacteria 3932
79 Ga0070695_100036956 3300005545 Bacteria 3075
80 Ga0070695_100418541 3300005545 Bacteria 1020
81 Ga0070696_100000560 3300005546 Bacteria 23643
82 Ga0070696_100005584 3300005546 Bacteria 8398
83 Ga0070696_100103355 3300005546 Bacteria 2044
84 Ga0070696_100670226 3300005546 Bacteria 843
85 Ga0070693_100000003 3300005547 Bacteria 95793
86 Ga0070665_100414560 3300005548 Bacteria 1355
87 Ga0070665_100775083 3300005548 Bacteria 972
88 Ga0070704_100000504 3300005549 Bacteria 18563
89 Ga0070704_100034199 3300005549 Bacteria 3444
90 Ga0070704_100038185 3300005549 Bacteria 3287
91 Ga0070704_100056791 3300005549 Bacteria 2781
92 Ga0070704_100677403 3300005549 Bacteria 913
93 Ga0070704_100699372 3300005549 Bacteria 899
94 Ga0068855_100005492 3300005563 Bacteria 15467
95 Ga0068857_100205536 3300005577 Bacteria 1796
96 Ga0068857_100671624 3300005577 Bacteria 983
97 Ga0068854_100003450 3300005578 Bacteria 9865
98 Ga0070702_100000004 3300005615 Bacteria 70302
99 Ga0068852_100037238 3300005616 Bacteria 4077
100 Ga0068859_100002292 3300005617 Bacteria 19424
101 Ga0068859_100021439 3300005617 Bacteria 6485
102 Ga0068859_100085987 3300005617 Bacteria 3190
103 Ga0068859_100917765 3300005617 Bacteria 960
104 Ga0068864_100032992 3300005618 Bacteria 4400
105 Ga0068864_100051810 3300005618 Bacteria 3537
106 Ga0068864_100199350 3300005618 Bacteria 1838
107 Ga0068866_10000342 3300005718 Bacteria 21994
108 Ga0068861_100001170 3300005719 Bacteria 16343
109 Ga0068861_100256670 3300005719 Bacteria 1494
110 Ga0068851_10145136 3300005834 Bacteria 1293
111 Ga0068870_10004636 3300005840 Bacteria 5929
112 Ga0068863_100471589 3300005841 Bacteria 1233
113 Ga0068863_101240586 3300005841 Bacteria 752
114 Ga0068858_100002734 3300005842 Bacteria 17741
115 Ga0068858_100288953 3300005842 Bacteria 1562
116 Ga0068860_100002098 3300005843 Bacteria 21009
117 Ga0068860_100389607 3300005843 Bacteria 1377
118 Ga0068860_101286146 3300005843 Bacteria 752
119 Ga0068862_100001419 3300005844 Bacteria 22189
120 Ga0068862_100007767 3300005844 Bacteria 8870
121 Ga0097621_100000024 3300006237 Bacteria 81390
122 Ga0097621_100659538 3300006237 Bacteria 961
123 Ga0068871_100002217 3300006358 Bacteria 13190
124 Ga0068871_100459946 3300006358 Bacteria 1142
125 Ga0075428_100004856 3300006844 Bacteria 14915
126 Ga0075428_100023622 3300006844 Bacteria 6806
127 Ga0075428_100061299 3300006844 Bacteria 4120
128 Ga0075431_100003037 3300006847 Bacteria 16231
129 Ga0075431_100078193 3300006847 Bacteria 3415
130 Ga0075433_10002500 3300006852 Bacteria 13986
131 Ga0075433_10030077 3300006852 Bacteria 4632
132 Ga0075433_10137140 3300006852 Bacteria 2175
133 Ga0075433_10677626 3300006852 Bacteria 904
134 Ga0075434_100001724 3300006871 Bacteria 18761
135 Ga0075434_100002486 3300006871 Bacteria 16234
136 Ga0075434_100172137 3300006871 Bacteria 2185
137 Ga0075434_100301160 3300006871 Bacteria 1624
138 Ga0075429_100000018 3300006880 Bacteria 71039
139 Ga0075429_100000496 3300006880 Bacteria 29568
140 Ga0068865_100000417 3300006881 Bacteria 23766
141 Ga0075436_100000142 3300006914 Bacteria 43453
142 Ga0075436_100077534 3300006914 Bacteria 2302
143 Ga0075436_100168868 3300006914 Bacteria 1544
144 Ga0097620_100002292 3300006931 Bacteria 19424
145 Ga0097620_100021438 3300006931 Bacteria 6485
146 Ga0097620_100085985 3300006931 Bacteria 3190
147 Ga0097620_100917822 3300006931 Bacteria 960
148 Ga0075435_100004636 3300007076 Bacteria 9470
149 Ga0075435_100006910 3300007076 Bacteria 8051
150 Ga0075435_100008441 3300007076 Bacteria 7391
151 Ga0075435_100023958 3300007076 Bacteria 4729
152 Ga0099794_10228772 3300007265 Bacteria 956
153 Ga0105240_10032705 3300009093 Bacteria 6731
154 Ga0111539_10014451 3300009094 Bacteria 9851
155 Ga0111539_10028668 3300009094 Bacteria 6790
156 Ga0111539_10046437 3300009094 Bacteria 5194
157 Ga0111539_10105719 3300009094 Bacteria 3302
158 Ga0111539_10128179 3300009094 Bacteria 2972
159 Ga0111539_10233688 3300009094 Bacteria 2140
160 Ga0111539_10262662 3300009094 Bacteria 2010
161 Ga0111539_10354926 3300009094 Bacteria 1706
162 Ga0111539_10561441 3300009094 Bacteria 1329
163 Ga0105245_10001245 3300009098 Bacteria 22979
164 Ga0105245_10529449 3300009098 Bacteria 1198
165 Ga0114129_10001872 3300009147 Bacteria 28684
166 Ga0114129_10010633 3300009147 Bacteria 13126
167 Ga0114129_10111438 3300009147 Bacteria 3776
168 Ga0114129_10480138 3300009147 Bacteria 1626
169 Ga0105243_10000339 3300009148 Bacteria 51082
170 Ga0105243_10489249 3300009148 Bacteria 1163
171 Ga0105241_10015808 3300009174 Bacteria 5529
172 Ga0105242_10000346 3300009176 Bacteria 37361
173 Ga0105242_10006022 3300009176 Bacteria 9351
174 Ga0105248_10212527 3300009177 Bacteria 2179
175 Ga0105237_10084351 3300009545 Bacteria 3167
176 Ga0105249_10012564 3300009553 Bacteria 7464
177 Ga0105249_10632325 3300009553 Bacteria 1127
178 Ga0105239_10817261 3300010375 Bacteria 1068
179 Ga0157344_1009928 3300012476 Bacteria 677
180 Ga0157378_10000192 3300013297 Bacteria 59014
181 Ga0163162_10233824 3300013306 Bacteria 1969
182 Ga0163162_10848988 3300013306 Bacteria 1028
183 Ga0163162_11417460 3300013306 Bacteria 790
184 Ga0157375_10159663 3300013308 Bacteria 2396
185 Ga0157380_10006145 3300014326 Bacteria 8420
186 Ga0157380_10007200 3300014326 Bacteria 7882
187 Ga0157380_10316039 3300014326 Bacteria 1446
188 Ga0157380_10393396 3300014326 Bacteria 1312
189 Ga0157377_10219906 3300014745 Bacteria 1215
190 Ga0157377_10556328 3300014745 Bacteria 811
191 Ga0157379_10107088 3300014968 Bacteria 2510
192 Ga0157376_10021789 3300014969 Bacteria 4980
193 Ga0207656_10006815 3300025321 Bacteria 4130
194 Ga0207653_10008181 3300025885 Bacteria 3260
195 Ga0207692_10607292 3300025898 Bacteria 704
196 Ga0207642_10001562 3300025899 Bacteria 7050
197 Ga0207647_10036448 3300025904 Bacteria 3125
198 Ga0207699_10412728 3300025906 Bacteria 963
199 Ga0207645_10119939 3300025907 Bacteria 1707
200 Ga0207643_10022819 3300025908 Bacteria 3448
201 Ga0207707_10000590 3300025912 Bacteria 36588
202 Ga0207707_10026336 3300025912 Bacteria 5083
203 Ga0207695_10155922 3300025913 Bacteria 2218
204 Ga0207671_10267220 3300025914 Bacteria 1347
205 Ga0207660_10006379 3300025917 Bacteria 7645
206 Ga0207660_10011374 3300025917 Bacteria 5790
207 Ga0207660_10084472 3300025917 Bacteria 2340
208 Ga0207662_10000653 3300025918 Bacteria 15703
209 Ga0207662_10613712 3300025918 Bacteria 758
210 Ga0207652_10017093 3300025921 Bacteria 5934
211 Ga0207652_10390397 3300025921 Bacteria 1256
212 Ga0207694_10151451 3300025924 Bacteria 1869
213 Ga0207650_10084585 3300025925 Bacteria 2412
214 Ga0207650_10286002 3300025925 Bacteria 1343
215 Ga0207650_10444079 3300025925 Bacteria 1079
216 Ga0207659_10044601 3300025926 Bacteria 3120
217 Ga0207687_10000454 3300025927 Bacteria 27910
218 Ga0207664_10291481 3300025929 Bacteria 1434
219 Ga0207644_10371029 3300025931 Bacteria 1166
220 Ga0207706_10036461 3300025933 Bacteria 4368
221 Ga0207686_10000806 3300025934 Bacteria 19237
222 Ga0207709_10000297 3300025935 Bacteria 55386
223 Ga0207670_10000590 3300025936 Bacteria 19930
224 Ga0207669_10022176 3300025937 Bacteria 3368
225 Ga0207704_10000251 3300025938 Bacteria 26202
226 Ga0207691_10013055 3300025940 Bacteria 7953
227 Ga0207691_10059115 3300025940 Bacteria 3486
228 Ga0207691_10112758 3300025940 Bacteria 2417
229 Ga0207689_10000103 3300025942 Bacteria 69244
230 Ga0207689_10236570 3300025942 Bacteria 1510
231 Ga0207689_10546149 3300025942 Bacteria 973
232 Ga0207679_10372014 3300025945 Bacteria 1251
233 Ga0207667_10007221 3300025949 Bacteria 13405
234 Ga0207651_10162940 3300025960 Bacteria 1750
235 Ga0207712_10007693 3300025961 Bacteria 6813
236 Ga0207668_10009666 3300025972 Bacteria 5790
237 Ga0207668_10011288 3300025972 Bacteria 5422
238 Ga0207668_10542192 3300025972 Bacteria 1006
239 Ga0207640_10003140 3300025981 Bacteria 8893
240 Ga0207677_10000533 3300026023 Bacteria 24049
241 Ga0207703_10000898 3300026035 Bacteria 29129
242 Ga0207703_10627800 3300026035 Bacteria 1018
243 Ga0207703_10633602 3300026035 Bacteria 1013
244 Ga0207639_10086040 3300026041 Bacteria 2502
245 Ga0207639_10107052 3300026041 Bacteria 2270
246 Ga0207678_10030236 3300026067 Bacteria 4728
247 Ga0207708_10000048 3300026075 Bacteria 114754
248 Ga0207708_10149729 3300026075 Bacteria 1836
249 Ga0207708_10877416 3300026075 Bacteria 775
250 Ga0207708_10897270 3300026075 Bacteria 767
251 Ga0207641_10121879 3300026088 Bacteria 2328
252 Ga0207641_10201148 3300026088 Bacteria 1837
253 Ga0207641_10833905 3300026088 Bacteria 913
254 Ga0207648_10001181 3300026089 Bacteria 29231
255 Ga0207648_10325132 3300026089 Bacteria 1383
256 Ga0207676_10201540 3300026095 Bacteria 1759
257 Ga0207674_10226051 3300026116 Bacteria 1820
258 Ga0207675_100000593 3300026118 Bacteria 35437
259 Ga0207675_100077563 3300026118 Bacteria 3113
260 Ga0207683_10045055 3300026121 Bacteria 3857
261 Ga0207683_10238169 3300026121 Bacteria 1660
262 Ga0207698_10129826 3300026142 Bacteria 2151
263 Ga0207698_10173506 3300026142 Bacteria 1901
264 Ga0209969_1042461 3300027360 Bacteria 707
265 Ga0209981_1002474 3300027378 Bacteria 2356
266 Ga0210000_1049226 3300027462 Bacteria 675
267 Ga0209971_1079695 3300027682 Bacteria 797
268 Ga0207428_10001315 3300027907 Bacteria 26451
269 Ga0207428_10076276 3300027907 Bacteria 2625
270 Ga0207428_10085269 3300027907 Bacteria 2460
271 Ga0207428_10322976 3300027907 Bacteria 1140
272 Ga0268266_10229121 3300028379 Bacteria 1711
273 Ga0268265_10001097 3300028380 Bacteria 24045
274 Ga0268265_10803491 3300028380 Bacteria 917
275 Ga0268264_10001229 3300028381 Bacteria 24608
276 Ga0268264_10477935 3300028381 Bacteria 1211
277 Ga0265336_10001259 3300028666 Bacteria 11998
278 Ga0265324_10000006 3300029957 Bacteria 267048
279 Ga0265324_10153637 3300029957 Bacteria 781
280 Ga0265325_10000110 3300031241 Bacteria 56687
281 Ga0265316_10080901 3300031344 Bacteria 2491
282 Ga0316575_10000027 3300031665 Bacteria 35516
283 Ga0316575_10001046 3300031665 Bacteria 8592
284 Ga0316575_10006576 3300031665 Bacteria 4187
285 Ga0316575_10132663 3300031665 Bacteria 1022
286 Ga0316579_10002999 3300031691 Bacteria 6491
287 Ga0316579_10146874 3300031691 Bacteria 1137
288 Ga0265314_10044054 3300031711 Bacteria 3166
289 Ga0316576_10001219 3300031727 Bacteria 13608
290 Ga0316576_10001522 3300031727 Bacteria 12542
291 Ga0316576_10246508 3300031727 Bacteria 1341
292 Ga0316576_10412973 3300031727 Bacteria 1000
293 Ga0316576_10465449 3300031727 Bacteria 932
294 Ga0316576_10633651 3300031727 Bacteria 778
295 Ga0316578_10008889 3300031728 Bacteria 5136
296 Ga0316578_10138349 3300031728 Bacteria 1466
297 Ga0316578_10208961 3300031728 Bacteria 1174
298 Ga0316578_10229127 3300031728 Bacteria 1116
299 Ga0316578_10305627 3300031728 Bacteria 950
300 Ga0316577_10000993 3300031733 Bacteria 12678
301 Ga0316577_10003659 3300031733 Bacteria 7809
302 Ga0316577_10050280 3300031733 Bacteria 2326
303 Ga0316577_10094392 3300031733 Bacteria 1675
304 Ga0307412_10346285 3300031911 Bacteria 1191
305 Ga0307409_101355300 3300031995 Bacteria 737
306 Ga0307416_101083174 3300032002 Bacteria 906
307 Ga0316583_10008512 3300032133 Bacteria 3699
308 Ga0316585_10002191 3300032137 Bacteria 5238
309 Ga0316585_10018515 3300032137 Bacteria 2114
310 Ga0316580_10000494 3300032139 Bacteria 9117
311 Ga0316593_10013132 3300032168 Bacteria 2446
312 Ga0316593_10250246 3300032168 Bacteria 663
313 Ga0316592_1001349 3300033524 Bacteria 3920
314 Ga0316592_1003844 3300033524 Bacteria 2753
315 Ga0316586_1001181 3300033527 Bacteria 2883
316 Ga0316588_1000401 3300033528 Bacteria 5730
317 Ga0316588_1083550 3300033528 Bacteria 792
318 Ga0316596_1002912 3300033541 Bacteria 3708
319 Ga0316596_1003215 3300033541 Bacteria 3555
320 Ga0373958_0031256 3300034819 Bacteria 1045
321 Ga0373959_0008987 3300034820 Bacteria 1713
322 Ga0373938_0002224 3300034957 Bacteria 3115
323 Ga0373938_0054377 3300034957 Bacteria 922
324 Ga0373926_0001853 3300035083 Bacteria 6583
325 Ga0373929_0015567 3300035085 Bacteria 1480
326 Ga0373929_0054455 3300035085 Bacteria 922
327 Ga0373944_0016793 3300035089 Bacteria 2069
328 Ga0373949_0003719 3300035090 Bacteria 3570
329 Ga0373923_0041652 3300035111 Bacteria 1894
330 Ga0373932_0004698 3300035112 Bacteria 3225
331 Ga0373936_0012274 3300035113 Bacteria 3256
332 Ga0373936_0035417 3300035113 Bacteria 1987
333 Ga0373941_0006424 3300035115 Bacteria 2832
334 Ga0373941_0008866 3300035115 Bacteria 2517
335 Ga0373941_0169457 3300035115 Bacteria 813
336 Ga0373945_0041557 3300035116 Bacteria 1662
337 Ga0373954_0000013 3300035118 Bacteria 73606
338 Ga0373956_0444363 3300035119 Bacteria 619
339 Ga0373960_0145145 3300035121 Bacteria 806
340 Ga0373943_0058874 3300035170 Bacteria 1913
341 Ga0373943_0100389 3300035170 Bacteria 1512
342 Ga0373955_0014316 3300035172 Bacteria 3856
343 Ga0373942_0014175 3300035207 Bacteria 1926
344 Ga0373962_0041398 3300035242 Bacteria 1299
345 Ga0316574_0009469 3300035398 Bacteria 5459
346 Ga0316574_0078623 3300035398 Bacteria 2091
347 Ga0373924_0017981 3300035410 Bacteria 2719
348 Ga0373924_0104578 3300035410 Bacteria 1220
349 Ga0373931_0014482 3300035691 Bacteria 3856
350 Ga0373935_0038687 3300035692 Bacteria 2987
351 Ga0373935_0091104 3300035692 Bacteria 1997
352 Ga0373935_0164688 3300035692 Bacteria 1513
353 Ga0373927_0060202 3300035695 Bacteria 2456
354 Ga0373927_0097951 3300035695 Bacteria 1906
355 Ga0373933_0031736 3300035724 Bacteria 3066
356 Ga0373947_0144024 3300035725 Bacteria 1530
357 Ga0373937_0201695 3300036401 Bacteria 1870
358 Ga0373937_0580923 3300036401 Bacteria 1064
359 Ga0316582_0000206 3300036647 Bacteria 18954
360 Ga0316582_0019895 3300036647 Bacteria 3937
361 Ga0316582_0252662 3300036647 Bacteria 1208
362 Ga0316584_0005625 3300036712 Bacteria 8438
363 Ga0316584_0007251 3300036712 Bacteria 7567
364 Ga0316584_0014866 3300036712 Bacteria 5560
365 Ga0316584_0061821 3300036712 Bacteria 2804
366 Ga0316584_0091946 3300036712 Bacteria 2271
367 Ga0373925_0046190 3300037068 Bacteria 3237
368 Ga0373925_0380285 3300037068 Bacteria 1149
369 Ga0395905_0682176 3300037471 Bacteria 930
370 Ga0316581_0007984 3300037588 Bacteria 2863
371 Ga0451853_2332119 3300041512 Bacteria 1228
372 Ga0450919_008840 3300042121 Bacteria 1163
373 Ga0450920_024462 3300042122 Bacteria 1174
374 Ga0450923_000777 3300042125 Bacteria 3830
375 Ga0450890_016187 3300042127 Bacteria 985
376 Ga0450894_005040 3300042131 Bacteria 1707
377 Ga0450907_012001 3300042146 Bacteria 1440
378 Ga0450907_035563 3300042146 Bacteria 850
379 Ga0450908_003350 3300042184 Bacteria 3111
380 Ga0439460_0039633 3300042461 Bacteria 1378
381 Ga0451577_0002897 3300042876 Bacteria 19683
382 Ga0451577_0037595 3300042876 Bacteria 4356
383 Ga0451577_0053947 3300042876 Bacteria 3589
384 Ga0451577_0066293 3300042876 Bacteria 3221
385 Ga0453683_0624084 3300044673 Bacteria 704
386 Ga0453684_0046258 3300044712 Bacteria 5790
387 Ga0453684_0341393 3300044712 Bacteria 1691
388 Ga0466968_0259924 3300044735 Bacteria 826
389 Ga0451576_0002487 3300045051 Bacteria 27363
390 Ga0451576_0007423 3300045051 Bacteria 13110
391 Ga0495603_0004362 3300046455 Bacteria 8440
392 Ga0495653_0056651 3300046463 Bacteria 2987
393 Ga0495580_0064097 3300046472 Bacteria 2576
394 Ga0495582_0041039 3300046473 Bacteria 2549
395 Ga0495594_0141289 3300046499 Bacteria 1366
396 Ga0495628_0287336 3300046516 Bacteria 1220
397 Ga0495630_0044545 3300046517 Bacteria 3316
398 Ga0495630_0050296 3300046517 Bacteria 3119
399 Ga0495666_0012336 3300046526 Bacteria 4260
400 Ga0495586_0001122 3300046535 Bacteria 15063
401 Ga0495587_0351605 3300046536 Bacteria 821
402 Ga0495598_0092283 3300046537 Bacteria 989
403 Ga0495634_0400719 3300046642 Bacteria 815
404 Ga0495659_0016723 3300046664 Bacteria 2423
405 Ga0495588_0008579 3300046674 Bacteria 4695
406 Ga0495647_0001029 3300046681 Bacteria 8505
407 Ga0495658_0002217 3300046683 Bacteria 9820
408 Ga0495658_0041748 3300046683 Bacteria 2558
409 Ga0495674_0726149 3300047319 Bacteria 778
410 Ga0495593_0308369 3300047673 Bacteria 791
411 Ga0495602_0609749 3300048088 Bacteria 750
412 Ga0501031_0081169 3300049568 Bacteria 2114
413 Ga0501032_0177934 3300049569 Bacteria 1393
414 Ga0501033_0016265 3300049570 Bacteria 5634
415 Ga0501033_0025955 3300049570 Bacteria 4412
416 Ga0501033_0339895 3300049570 Bacteria 1053
417 Ga0501034_0459443 3300049571 Bacteria 1190
418 Ga0501036_0002538 3300049572 Bacteria 14348
419 Ga0501036_0035298 3300049572 Bacteria 4231
420 Ga0501036_0660338 3300049572 Bacteria 865
421 Ga0501037_0011042 3300049573 Bacteria 6643
422 Ga0501037_0233113 3300049573 Bacteria 1292
423 Ga0501037_0337153 3300049573 Bacteria 1042
424 Ga0501038_0002348 3300049574 Bacteria 17640
425 Ga0501038_0099114 3300049574 Bacteria 2429
426 Ga0501038_0320777 3300049574 Bacteria 1212
427 Ga0501039_0140514 3300049575 Bacteria 1897
428 Ga0501040_0001256 3300049576 Bacteria 16114
429 Ga0501040_0004980 3300049576 Bacteria 8594
430 Ga0501040_0466770 3300049576 Bacteria 909
431 Ga0501040_0508868 3300049576 Bacteria 868
432 Ga0501041_0002453 3300049577 Bacteria 10533
433 Ga0501041_0009824 3300049577 Bacteria 5633
434 Ga0501041_0155463 3300049577 Bacteria 1429
435 Ga0501041_0169055 3300049577 Bacteria 1368
436 Ga0501041_0272908 3300049577 Bacteria 1064
437 Ga0501041_0293288 3300049577 Bacteria 1024
438 Ga0501042_0000735 3300049578 Bacteria 17775
439 Ga0501042_0070834 3300049578 Bacteria 2494
440 Ga0501042_0369925 3300049578 Bacteria 1037
441 Ga0501042_0543946 3300049578 Bacteria 844
442 Ga0501043_0007575 3300049579 Bacteria 8605
443 Ga0501043_0123349 3300049579 Bacteria 2032
444 Ga0501043_0239999 3300049579 Bacteria 1398
445 Ga0501046_0003327 3300049580 Bacteria 14777
446 Ga0501046_0045838 3300049580 Bacteria 3471
447 Ga0501046_0057870 3300049580 Bacteria 3040
448 Ga0501047_0036663 3300049581 Bacteria 4740
449 Ga0501048_0032779 3300049582 Bacteria 3754
450 Ga0501048_0053282 3300049582 Bacteria 2878
451 Ga0501048_0352102 3300049582 Bacteria 1050
452 Ga0501068_0305730 3300049584 Bacteria 1018
453 Ga0501068_0591921 3300049584 Bacteria 722
454 Ga0501069_0273398 3300049585 Bacteria 988
455 Ga0501070_0012503 3300049586 Bacteria 7160
456 Ga0501071_0003199 3300049587 Bacteria 10200
457 Ga0501071_0242156 3300049587 Bacteria 1360
458 Ga0501071_0245031 3300049587 Bacteria 1352
459 Ga0501071_0992479 3300049587 Bacteria 648
460 Ga0501072_0020103 3300049588 Bacteria 5170
461 Ga0501072_0043357 3300049588 Bacteria 3536
462 Ga0501072_0053110 3300049588 Bacteria 3191
463 Ga0501072_0058598 3300049588 Bacteria 3035
464 Ga0501072_0453098 3300049588 Bacteria 1016
465 Ga0501073_0056780 3300049589 Bacteria 2738
466 Ga0501073_0158154 3300049589 Bacteria 1570
467 Ga0501073_0349454 3300049589 Bacteria 1021
468 Ga0501074_0024589 3300049590 Bacteria 4377
469 Ga0501074_0041328 3300049590 Bacteria 3339
470 Ga0501074_0482654 3300049590 Bacteria 878
471 Ga0501075_0002051 3300049591 Bacteria 13334
472 Ga0501075_0020908 3300049591 Bacteria 4767
473 Ga0501075_0093631 3300049591 Bacteria 2281
474 Ga0501075_0243164 3300049591 Bacteria 1372
475 Ga0501075_0248818 3300049591 Bacteria 1355
476 Ga0501076_0002867 3300049592 Bacteria 11935
477 Ga0501076_0020590 3300049592 Bacteria 5049
478 Ga0501076_0025702 3300049592 Bacteria 4559
479 Ga0501076_0356519 3300049592 Bacteria 1201
480 Ga0501076_0712571 3300049592 Bacteria 828
481 Ga0501077_0000443 3300049593 Bacteria 25079
482 Ga0501077_0037025 3300049593 Bacteria 3108
483 Ga0501077_0492428 3300049593 Bacteria 786
484 Ga0501079_0000827 3300049741 Bacteria 21030
485 Ga0501079_0002756 3300049741 Bacteria 12808
486 Ga0501079_0050908 3300049741 Bacteria 3196
487 Ga0501079_0121363 3300049741 Bacteria 2033
488 Ga0501079_0431575 3300049741 Bacteria 1034
489 Ga0501079_0717128 3300049741 Bacteria 787
490 Ga0501080_0000692 3300049742 Bacteria 27042
491 Ga0501080_0042781 3300049742 Bacteria 4217
492 Ga0501080_0169487 3300049742 Bacteria 2014
493 Ga0501080_0281456 3300049742 Bacteria 1512
494 Ga0501080_0812180 3300049742 Bacteria 820
495 Ga0501081_0001598 3300049743 Bacteria 13983
496 Ga0501081_0039707 3300049743 Bacteria 3222
497 Ga0501081_0068203 3300049743 Bacteria 2476
498 Ga0501081_0168109 3300049743 Bacteria 1582
499 Ga0501083_0033389 3300049744 Bacteria 3524
500 Ga0501083_0187571 3300049744 Bacteria 1350
501 Ga0501035_0013485 3300049822 Bacteria 7544
502 Ga0501035_0115279 3300049822 Bacteria 2352
503 Ga0501035_0617050 3300049822 Bacteria 882
504 Ga0501044_0074090 3300049823 Bacteria 3460
505 Ga0501044_0699929 3300049823 Bacteria 899
506 Ga0501045_0018274 3300049824 Bacteria 4986
507 Ga0501045_0064364 3300049824 Bacteria 2691
508 nmdc:mga05p37_128747_c1 3300050507 Bacteria 3107
509 nmdc:mga05p37_15060_c1 3300050507 Bacteria 9285
510 nmdc:mga05p37_291_c1 3300050507 Bacteria 52424
511 nmdc:mga05p37_732274_c1 3300050507 Bacteria 1093
512 nmdc:mga09592_124522_c1 3300050508 Bacteria 2215
513 nmdc:mga09592_2325_c1 3300050508 Bacteria 15340
514 nmdc:mga09592_355891_c1 3300050508 Bacteria 1267
515 nmdc:mga09592_88_c1 3300050508 Bacteria 54764
516 nmdc:mga0qj67_243665_c1 3300050509 Bacteria 1458
517 nmdc:mga06r32_3835_c1 3300050510 Bacteria 13451
518 nmdc:mga06r32_90108_c1 3300050510 Bacteria 2995
519 nmdc:mga08y16_1707_c1 3300050511 Bacteria 22276
520 nmdc:mga08y16_232561_c1 3300050511 Bacteria 1906
521 nmdc:mga08y16_29646_c1 3300050511 Bacteria 5762
522 nmdc:mga08y16_299390_c1 3300050511 Bacteria 1658
523 nmdc:mga08y16_32909_c1 3300050511 Bacteria 5449
524 nmdc:mga0n895_127974_c1 3300050512 Bacteria 2564
525 nmdc:mga0n895_333_c1 3300050512 Bacteria 31507
526 nmdc:mga0rr50_4041_c1 3300050513 Bacteria 8561
527 nmdc:mga0rr50_569_c1 3300050513 Bacteria 19810
528 nmdc:mga0rr50_59239_c1 3300050513 Bacteria 2874
529 nmdc:mga0rr50_68912_c1 3300050513 Bacteria 1582
530 nmdc:mga08x19_1192_c1 3300050514 Bacteria 16244
531 nmdc:mga08x19_260393_c1 3300050514 Bacteria 1199
532 nmdc:mga08x19_28528_c1 3300050514 Bacteria 3496
533 nmdc:mga0a205_13415_c1 3300050515 Bacteria 7629
534 nmdc:mga0a205_188_c1 3300050515 Bacteria 30684
535 nmdc:mga0a205_1994_c1 3300050515 Bacteria 17784
536 nmdc:mga0a205_56872_c1 3300050515 Bacteria 3776
537 Ga0501084_0002718 3300054114 Bacteria 14257
538 Ga0501084_0125888 3300054114 Bacteria 2156
539 Ga0501084_1200137 3300054114 Bacteria 636
540 Ga0590074_048058 3300059423 Bacteria 777
541 Ga0590077_018187 3300059426 Bacteria 1483
542 Ga0501082_0018622 3300060353 Bacteria 5984
543 Ga0501082_0096533 3300060353 Bacteria 2555
544 Ga0501082_0496108 3300060353 Bacteria 1067
545 Ga0530510_0002712 3300061734 Bacteria 12180
546 Ga0530510_0004302 3300061734 Bacteria 9853
547 Ga0530510_0322704 3300061734 Bacteria 1158
548 Ga0530510_0742737 3300061734 Bacteria 748

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005343 Ga0070687_100337491 Ga0070687_1003374912 165
2 3300005438 Ga0070701_10113890 Ga0070701_101138903 165
3 3300005440 Ga0070705_100227540 Ga0070705_1002275402 165
4 3300005441 Ga0070700_100123244 Ga0070700_1001232443 165
5 3300005444 Ga0070694_100317230 Ga0070694_1003172302 165
6 3300005444 Ga0070694_100348439 Ga0070694_1003484391 165
7 3300005444 Ga0070694_100362641 Ga0070694_1003626412 165
8 3300005545 Ga0070695_100418541 Ga0070695_1004185411 165
9 3300005549 Ga0070704_100034199 Ga0070704_1000341993 165
10 3300005549 Ga0070704_100038185 Ga0070704_1000381854 165
11 3300005617 Ga0068859_100021439 Ga0068859_1000214396 165
12 3300005843 Ga0068860_101286146 Ga0068860_1012861462 165
13 3300006847 Ga0075431_100078193 Ga0075431_1000781932 165
14 3300006931 Ga0097620_100021438 Ga0097620_1000214386 165
15 3300009094 Ga0111539_10014451 Ga0111539_100144515 165
16 3300009094 Ga0111539_10354926 Ga0111539_103549262 165
17 3300009553 Ga0105249_10632325 Ga0105249_106323252 165
18 3300025918 Ga0207662_10613712 Ga0207662_106137121 165
19 3300026035 Ga0207703_10627800 Ga0207703_106278001 165
20 3300026075 Ga0207708_10149729 Ga0207708_101497292 165
21 3300027462 Ga0210000_1049226 Ga0210000_10492261 165
22 3300027682 Ga0209971_1079695 Ga0209971_10796952 165
23 3300027907 Ga0207428_10076276 Ga0207428_100762764 165
24 3300035115 Ga0373941_0169457 Ga0373941_0169457_26_571 165
25 3300050511 nmdc:mga08y16_29646_c1 nmdc:mga08y16_29646_c1_162_707 165
26 3300050511 nmdc:mga08y16_299390_c1 nmdc:mga08y16_299390_c1_562_1107 165
27 3300050515 nmdc:mga0a205_56872_c1 nmdc:mga0a205_56872_c1_1290_1835 165
28 3300049588 Ga0501072_0453098 Ga0501072_0453098_11_511 166
29 3300005471 Ga0070698_100066546 Ga0070698_1000665465 167
30 3300006844 Ga0075428_100061299 Ga0075428_1000612995 167
31 3300006847 Ga0075431_100003037 Ga0075431_1000030378 167
32 3300006880 Ga0075429_100000018 Ga0075429_10000001857 167
33 3300009094 Ga0111539_10561441 Ga0111539_105614413 167
34 3300009147 Ga0114129_10010633 Ga0114129_100106333 167
35 3300014745 Ga0157377_10556328 Ga0157377_105563281 167
36 3300025924 Ga0207694_10151451 Ga0207694_101514512 167
37 3300049576 Ga0501040_0466770 Ga0501040_0466770_372_896 167
38 3300050507 nmdc:mga05p37_291_c1 nmdc:mga05p37_291_c1_20206_20751 167
39 3300050508 nmdc:mga09592_88_c1 nmdc:mga09592_88_c1_5402_5947 167
40 3300050510 nmdc:mga06r32_3835_c1 nmdc:mga06r32_3835_c1_4766_5311 167
41 3300005331 Ga0070670_100021506 Ga0070670_1000215064 168
42 3300005367 Ga0070667_100154591 Ga0070667_1001545912 168
43 3300005617 Ga0068859_100917765 Ga0068859_1009177652 168
44 3300006931 Ga0097620_100917822 Ga0097620_1009178222 168
45 3300035118 Ga0373954_0000013 Ga0373954_0000013_64779_65339 168
46 3300035172 Ga0373955_0014316 Ga0373955_0014316_1954_2514 168
47 3300035724 Ga0373933_0031736 Ga0373933_0031736_94_654 168
48 3300046536 Ga0495587_0351605 Ga0495587_0351605_214_774 168
49 3300046664 Ga0495659_0016723 Ga0495659_0016723_496_1002 168
50 3300048088 Ga0495602_0609749 Ga0495602_0609749_163_723 168
51 3300049589 Ga0501073_0349454 Ga0501073_0349454_502_1008 168
52 3300002244 JGI24742J22300_10021375 JGI24742J22300_100213752 169
53 3300005330 Ga0070690_100000335 Ga0070690_1000003359 169
54 3300005334 Ga0068869_100001158 Ga0068869_1000011589 169
55 3300005335 Ga0070666_10201882 Ga0070666_102018822 169
56 3300005336 Ga0070680_100001369 Ga0070680_1000013692 169
57 3300005338 Ga0068868_100000378 Ga0068868_1000003789 169
58 3300005338 Ga0068868_100242264 Ga0068868_1002422642 169
59 3300005341 Ga0070691_10255978 Ga0070691_102559782 169
60 3300005343 Ga0070687_100000353 Ga0070687_10000035313 169
61 3300005345 Ga0070692_10003721 Ga0070692_100037219 169
62 3300005345 Ga0070692_10151507 Ga0070692_101515072 169
63 3300005347 Ga0070668_100017930 Ga0070668_1000179305 169
64 3300005355 Ga0070671_100321467 Ga0070671_1003214672 169
65 3300005364 Ga0070673_100205804 Ga0070673_1002058041 169
66 3300005367 Ga0070667_100075953 Ga0070667_1000759532 169
67 3300005406 Ga0070703_10006589 Ga0070703_100065892 169
68 3300005438 Ga0070701_10000027 Ga0070701_1000002714 169
69 3300005439 Ga0070711_100598316 Ga0070711_1005983162 169
70 3300005440 Ga0070705_100000061 Ga0070705_10000006121 169
71 3300005441 Ga0070700_100000386 Ga0070700_1000003869 169
72 3300005441 Ga0070700_100772742 Ga0070700_1007727421 169
73 3300005444 Ga0070694_100000096 Ga0070694_10000009614 169
74 3300005444 Ga0070694_100263250 Ga0070694_1002632502 169
75 3300005455 Ga0070663_100053485 Ga0070663_1000534852 169
76 3300005456 Ga0070678_100156833 Ga0070678_1001568332 169
77 3300005456 Ga0070678_100175610 Ga0070678_1001756102 169
78 3300005457 Ga0070662_100252742 Ga0070662_1002527422 169
79 3300005457 Ga0070662_100737412 Ga0070662_1007374121 169
80 3300005458 Ga0070681_10032716 Ga0070681_100327163 169
81 3300005459 Ga0068867_100001399 Ga0068867_1000013998 169
82 3300005459 Ga0068867_100039342 Ga0068867_1000393422 169
83 3300005530 Ga0070679_100030156 Ga0070679_1000301563 169
84 3300005539 Ga0068853_100032789 Ga0068853_1000327893 169
85 3300005543 Ga0070672_100035396 Ga0070672_1000353962 169
86 3300005544 Ga0070686_100001578 Ga0070686_1000015785 169
87 3300005545 Ga0070695_100000965 Ga0070695_10000096511 169
88 3300005546 Ga0070696_100000560 Ga0070696_10000056014 169
89 3300005547 Ga0070693_100000003 Ga0070693_10000000359 169
90 3300005549 Ga0070704_100000504 Ga0070704_10000050412 169
91 3300005549 Ga0070704_100699372 Ga0070704_1006993721 169
92 3300005563 Ga0068855_100005492 Ga0068855_1000054926 169
93 3300005578 Ga0068854_100003450 Ga0068854_1000034509 169
94 3300005615 Ga0070702_100000004 Ga0070702_10000000455 169
95 3300005616 Ga0068852_100037238 Ga0068852_1000372382 169
96 3300005617 Ga0068859_100002292 Ga0068859_10000229216 169
97 3300005718 Ga0068866_10000342 Ga0068866_1000034219 169
98 3300005719 Ga0068861_100001170 Ga0068861_1000011709 169
99 3300005840 Ga0068870_10004636 Ga0068870_100046362 169
100 3300005842 Ga0068858_100002734 Ga0068858_10000273414 169
101 3300005843 Ga0068860_100002098 Ga0068860_1000020989 169
102 3300005843 Ga0068860_100389607 Ga0068860_1003896072 169
103 3300005844 Ga0068862_100001419 Ga0068862_1000014195 169
104 3300006237 Ga0097621_100000024 Ga0097621_1000000243 169
105 3300006237 Ga0097621_100659538 Ga0097621_1006595382 169
106 3300006358 Ga0068871_100002217 Ga0068871_1000022178 169
107 3300006358 Ga0068871_100459946 Ga0068871_1004599462 169
108 3300006881 Ga0068865_100000417 Ga0068865_1000004178 169
109 3300006931 Ga0097620_100002292 Ga0097620_10000229216 169
110 3300009098 Ga0105245_10001245 Ga0105245_100012452 169
111 3300009176 Ga0105242_10000346 Ga0105242_1000034625 169
112 3300009177 Ga0105248_10212527 Ga0105248_102125272 169
113 3300012476 Ga0157344_1009928 Ga0157344_10099281 169
114 3300013306 Ga0163162_10233824 Ga0163162_102338242 169
115 3300014326 Ga0157380_10007200 Ga0157380_100072005 169
116 3300014745 Ga0157377_10219906 Ga0157377_102199063 169
117 3300025885 Ga0207653_10008181 Ga0207653_100081815 169
118 3300025899 Ga0207642_10001562 Ga0207642_100015629 169
119 3300025908 Ga0207643_10022819 Ga0207643_100228193 169
120 3300025912 Ga0207707_10026336 Ga0207707_100263366 169
121 3300025917 Ga0207660_10006379 Ga0207660_100063793 169
122 3300025917 Ga0207660_10084472 Ga0207660_100844722 169
123 3300025918 Ga0207662_10000653 Ga0207662_1000065313 169
124 3300025921 Ga0207652_10017093 Ga0207652_100170937 169
125 3300025927 Ga0207687_10000454 Ga0207687_100004549 169
126 3300025931 Ga0207644_10371029 Ga0207644_103710291 169
127 3300025933 Ga0207706_10036461 Ga0207706_100364614 169
128 3300025934 Ga0207686_10000806 Ga0207686_100008065 169
129 3300025935 Ga0207709_10000297 Ga0207709_1000029722 169
130 3300025936 Ga0207670_10000590 Ga0207670_1000059012 169
131 3300025938 Ga0207704_10000251 Ga0207704_100002513 169
132 3300025940 Ga0207691_10013055 Ga0207691_100130556 169
133 3300025942 Ga0207689_10000103 Ga0207689_1000010319 169
134 3300025949 Ga0207667_10007221 Ga0207667_1000722112 169
135 3300025960 Ga0207651_10162940 Ga0207651_101629402 169
136 3300025961 Ga0207712_10007693 Ga0207712_100076939 169
137 3300025972 Ga0207668_10542192 Ga0207668_105421922 169
138 3300025981 Ga0207640_10003140 Ga0207640_1000314010 169
139 3300026023 Ga0207677_10000533 Ga0207677_100005339 169
140 3300026035 Ga0207703_10000898 Ga0207703_1000089821 169
141 3300026041 Ga0207639_10086040 Ga0207639_100860402 169
142 3300026075 Ga0207708_10000048 Ga0207708_1000004873 169
143 3300026075 Ga0207708_10877416 Ga0207708_108774162 169
144 3300026088 Ga0207641_10201148 Ga0207641_102011483 169
145 3300026089 Ga0207648_10001181 Ga0207648_1000118119 169
146 3300026089 Ga0207648_10325132 Ga0207648_103251322 169
147 3300026118 Ga0207675_100000593 Ga0207675_10000059332 169
148 3300026121 Ga0207683_10045055 Ga0207683_100450555 169
149 3300026121 Ga0207683_10238169 Ga0207683_102381692 169
150 3300026142 Ga0207698_10129826 Ga0207698_101298263 169
151 3300028379 Ga0268266_10229121 Ga0268266_102291212 169
152 3300028380 Ga0268265_10001097 Ga0268265_1000109711 169
153 3300028381 Ga0268264_10001229 Ga0268264_1000122921 169
154 3300028381 Ga0268264_10477935 Ga0268264_104779352 169
155 3300028666 Ga0265336_10001259 Ga0265336_100012596 169
156 3300029957 Ga0265324_10000006 Ga0265324_10000006164 169
157 3300029957 Ga0265324_10153637 Ga0265324_101536372 169
158 3300031241 Ga0265325_10000110 Ga0265325_1000011053 169
159 3300031665 Ga0316575_10000027 Ga0316575_1000002728 169
160 3300031711 Ga0265314_10044054 Ga0265314_100440542 169
161 3300031911 Ga0307412_10346285 Ga0307412_103462852 169
162 3300035119 Ga0373956_0444363 Ga0373956_0444363_29_538 169
163 3300035121 Ga0373960_0145145 Ga0373960_0145145_269_778 169
164 3300042876 Ga0451577_0002897 Ga0451577_0002897_12173_12694 169
165 3300042876 Ga0451577_0053947 Ga0451577_0053947_487_996 169
166 3300049584 Ga0501068_0591921 Ga0501068_0591921_16_525 169
167 3300049742 Ga0501080_0812180 Ga0501080_0812180_296_805 169
168 3300014326 Ga0157380_10393396 Ga0157380_103933962 170
169 3300032002 Ga0307416_101083174 Ga0307416_1010831742 172
170 3300005440 Ga0070705_100026329 Ga0070705_1000263293 173
171 3300031995 Ga0307409_101355300 Ga0307409_1013553002 173
172 3300005545 Ga0070695_100036956 Ga0070695_1000369563 174
173 3300005546 Ga0070696_100103355 Ga0070696_1001033552 174
174 3300005549 Ga0070704_100056791 Ga0070704_1000567915 174
175 3300035115 Ga0373941_0008866 Ga0373941_0008866_37_564 175
176 iso_pu_bacteria 2846037992 2846041043 177
177 iso_pu_bacteria 2998344455 2998347311 177
178 3300005339 Ga0070660_100158284 Ga0070660_1001582842 178
179 3300005366 Ga0070659_100099548 Ga0070659_1000995482 178
180 3300005577 Ga0068857_100205536 Ga0068857_1002055362 179
181 3300006844 Ga0075428_100023622 Ga0075428_1000236222 179
182 3300007076 Ga0075435_100004636 Ga0075435_1000046362 179
183 3300009094 Ga0111539_10105719 Ga0111539_101057193 179
184 3300009094 Ga0111539_10262662 Ga0111539_102626622 179
185 3300009147 Ga0114129_10111438 Ga0114129_101114383 179
186 3300014326 Ga0157380_10006145 Ga0157380_100061452 179
187 3300026116 Ga0207674_10226051 Ga0207674_102260512 179
188 3300027907 Ga0207428_10322976 Ga0207428_103229761 179
189 3300031665 Ga0316575_10001046 Ga0316575_100010466 179
190 3300031665 Ga0316575_10132663 Ga0316575_101326631 179
191 3300031691 Ga0316579_10002999 Ga0316579_100029995 179
192 3300031691 Ga0316579_10146874 Ga0316579_101468742 179
193 3300031727 Ga0316576_10001219 Ga0316576_100012196 179
194 3300031727 Ga0316576_10001522 Ga0316576_100015226 179
195 3300031727 Ga0316576_10246508 Ga0316576_102465082 179
196 3300031727 Ga0316576_10412973 Ga0316576_104129732 179
197 3300031727 Ga0316576_10465449 Ga0316576_104654492 179
198 3300031727 Ga0316576_10633651 Ga0316576_106336511 179
199 3300031728 Ga0316578_10008889 Ga0316578_100088898 179
200 3300031728 Ga0316578_10138349 Ga0316578_101383492 179
201 3300031728 Ga0316578_10229127 Ga0316578_102291272 179
202 3300031728 Ga0316578_10305627 Ga0316578_103056271 179
203 3300031733 Ga0316577_10000993 Ga0316577_100009936 179
204 3300031733 Ga0316577_10003659 Ga0316577_100036598 179
205 3300031733 Ga0316577_10050280 Ga0316577_100502802 179
206 3300031733 Ga0316577_10094392 Ga0316577_100943922 179
207 3300032133 Ga0316583_10008512 Ga0316583_100085122 179
208 3300032137 Ga0316585_10002191 Ga0316585_100021917 179
209 3300032137 Ga0316585_10018515 Ga0316585_100185152 179
210 3300032139 Ga0316580_10000494 Ga0316580_100004949 179
211 3300032168 Ga0316593_10013132 Ga0316593_100131322 179
212 3300032168 Ga0316593_10250246 Ga0316593_102502461 179
213 3300033524 Ga0316592_1001349 Ga0316592_10013494 179
214 3300033524 Ga0316592_1003844 Ga0316592_10038441 179
215 3300033527 Ga0316586_1001181 Ga0316586_10011813 179
216 3300033528 Ga0316588_1000401 Ga0316588_10004015 179
217 3300033528 Ga0316588_1083550 Ga0316588_10835501 179
218 3300033541 Ga0316596_1002912 Ga0316596_10029125 179
219 3300033541 Ga0316596_1003215 Ga0316596_10032153 179
220 3300035398 Ga0316574_0078623 Ga0316574_0078623_1296_1847 179
221 3300036647 Ga0316582_0000206 Ga0316582_0000206_12772_13317 179
222 3300036647 Ga0316582_0019895 Ga0316582_0019895_418_969 179
223 3300036647 Ga0316582_0252662 Ga0316582_0252662_463_1011 179
224 3300036712 Ga0316584_0005625 Ga0316584_0005625_285_833 179
225 3300036712 Ga0316584_0007251 Ga0316584_0007251_5379_5921 179
226 3300036712 Ga0316584_0014866 Ga0316584_0014866_1875_2420 179
227 3300036712 Ga0316584_0061821 Ga0316584_0061821_1335_1880 179
228 3300036712 Ga0316584_0091946 Ga0316584_0091946_108_659 179
229 3300042121 Ga0450919_008840 Ga0450919_008840_422_982 179
230 3300042122 Ga0450920_024462 Ga0450920_024462_547_1113 179
231 3300042125 Ga0450923_000777 Ga0450923_000777_720_1286 179
232 3300042127 Ga0450890_016187 Ga0450890_016187_157_720 179
233 3300042131 Ga0450894_005040 Ga0450894_005040_1078_1644 179
234 3300042146 Ga0450907_012001 Ga0450907_012001_109_675 179
235 3300042146 Ga0450907_035563 Ga0450907_035563_134_694 179
236 3300042184 Ga0450908_003350 Ga0450908_003350_299_865 179
237 3300049575 Ga0501039_0140514 Ga0501039_0140514_523_1086 179
238 3300049578 Ga0501042_0369925 Ga0501042_0369925_150_713 179
239 3300050513 nmdc:mga0rr50_68912_c1 nmdc:mga0rr50_68912_c1_431_994 179
240 3300050515 nmdc:mga0a205_188_c1 nmdc:mga0a205_188_c1_11314_11877 179
241 3300005548 Ga0070665_100775083 Ga0070665_1007750832 180
242 3300009093 Ga0105240_10032705 Ga0105240_100327057 180
243 3300009545 Ga0105237_10084351 Ga0105237_100843512 180
244 3300013306 Ga0163162_11417460 Ga0163162_114174601 180
245 3300025913 Ga0207695_10155922 Ga0207695_101559222 180
246 3300025914 Ga0207671_10267220 Ga0207671_102672202 180
247 3300026041 Ga0207639_10107052 Ga0207639_101070522 180
248 3300028380 Ga0268265_10803491 Ga0268265_108034911 180
249 3300044673 Ga0453683_0624084 Ga0453683_0624084_65_607 180
250 3300049570 Ga0501033_0339895 Ga0501033_0339895_243_785 180
251 3300049572 Ga0501036_0035298 Ga0501036_0035298_3373_3915 180
252 3300049573 Ga0501037_0337153 Ga0501037_0337153_148_690 180
253 3300049574 Ga0501038_0099114 Ga0501038_0099114_299_841 180
254 3300049576 Ga0501040_0004980 Ga0501040_0004980_435_977 180
255 3300049576 Ga0501040_0508868 Ga0501040_0508868_201_743 180
256 3300049577 Ga0501041_0009824 Ga0501041_0009824_1601_2143 180
257 3300049577 Ga0501041_0293288 Ga0501041_0293288_459_1001 180
258 3300049578 Ga0501042_0070834 Ga0501042_0070834_376_918 180
259 3300049578 Ga0501042_0543946 Ga0501042_0543946_184_726 180
260 3300049579 Ga0501043_0123349 Ga0501043_0123349_1088_1630 180
261 3300049579 Ga0501043_0239999 Ga0501043_0239999_271_813 180
262 3300049580 Ga0501046_0057870 Ga0501046_0057870_863_1405 180
263 3300049581 Ga0501047_0036663 Ga0501047_0036663_314_856 180
264 3300049582 Ga0501048_0032779 Ga0501048_0032779_1612_2154 180
265 3300049584 Ga0501068_0305730 Ga0501068_0305730_80_622 180
266 3300049586 Ga0501070_0012503 Ga0501070_0012503_2706_3248 180
267 3300049588 Ga0501072_0020103 Ga0501072_0020103_1156_1698 180
268 3300049589 Ga0501073_0056780 Ga0501073_0056780_421_963 180
269 3300049590 Ga0501074_0041328 Ga0501074_0041328_1586_2128 180
270 3300049590 Ga0501074_0482654 Ga0501074_0482654_27_569 180
271 3300049591 Ga0501075_0020908 Ga0501075_0020908_3484_4026 180
272 3300049592 Ga0501076_0020590 Ga0501076_0020590_882_1424 180
273 3300049592 Ga0501076_0356519 Ga0501076_0356519_513_1055 180
274 3300049592 Ga0501076_0712571 Ga0501076_0712571_34_576 180
275 3300049593 Ga0501077_0492428 Ga0501077_0492428_199_741 180
276 3300049741 Ga0501079_0002756 Ga0501079_0002756_4910_5452 180
277 3300049741 Ga0501079_0121363 Ga0501079_0121363_1396_1938 180
278 3300049741 Ga0501079_0431575 Ga0501079_0431575_479_1021 180
279 3300049742 Ga0501080_0042781 Ga0501080_0042781_714_1256 180
280 3300049742 Ga0501080_0281456 Ga0501080_0281456_150_692 180
281 3300049743 Ga0501081_0168109 Ga0501081_0168109_921_1463 180
282 3300049744 Ga0501083_0033389 Ga0501083_0033389_2540_3082 180
283 3300049822 Ga0501035_0115279 Ga0501035_0115279_77_619 180
284 3300049822 Ga0501035_0617050 Ga0501035_0617050_101_643 180
285 3300049823 Ga0501044_0699929 Ga0501044_0699929_166_708 180
286 3300054114 Ga0501084_0125888 Ga0501084_0125888_336_878 180
287 3300054114 Ga0501084_1200137 Ga0501084_1200137_51_593 180
288 3300060353 Ga0501082_0096533 Ga0501082_0096533_588_1130 180
289 3300061734 Ga0530510_0004302 Ga0530510_0004302_4265_4807 180
290 3300005293 Ga0065715_10791798 Ga0065715_107917981 181
291 3300005295 Ga0065707_10004016 Ga0065707_100040164 181
292 3300005328 Ga0070676_10176593 Ga0070676_101765931 181
293 3300005330 Ga0070690_100189099 Ga0070690_1001890992 181
294 3300005331 Ga0070670_100021978 Ga0070670_1000219785 181
295 3300005331 Ga0070670_100022354 Ga0070670_1000223546 181
296 3300005331 Ga0070670_100554055 Ga0070670_1005540551 181
297 3300005336 Ga0070680_100044326 Ga0070680_1000443263 181
298 3300005340 Ga0070689_100213174 Ga0070689_1002131742 181
299 3300005347 Ga0070668_100028612 Ga0070668_1000286122 181
300 3300005347 Ga0070668_100211002 Ga0070668_1002110022 181
301 3300005354 Ga0070675_100035578 Ga0070675_1000355784 181
302 3300005356 Ga0070674_100573491 Ga0070674_1005734912 181
303 3300005364 Ga0070673_100110107 Ga0070673_1001101074 181
304 3300005365 Ga0070688_100034314 Ga0070688_1000343142 181
305 3300005440 Ga0070705_100172034 Ga0070705_1001720341 181
306 3300005440 Ga0070705_100282480 Ga0070705_1002824802 181
307 3300005440 Ga0070705_100409054 Ga0070705_1004090542 181
308 3300005444 Ga0070694_100007671 Ga0070694_1000076716 181
309 3300005458 Ga0070681_10000372 Ga0070681_1000037212 181
310 3300005459 Ga0068867_100180993 Ga0068867_1001809932 181
311 3300005459 Ga0068867_100196166 Ga0068867_1001961662 181
312 3300005518 Ga0070699_100094917 Ga0070699_1000949173 181
313 3300005536 Ga0070697_100027227 Ga0070697_1000272275 181
314 3300005543 Ga0070672_101226629 Ga0070672_1012266291 181
315 3300005544 Ga0070686_100076937 Ga0070686_1000769371 181
316 3300005545 Ga0070695_100010236 Ga0070695_1000102365 181
317 3300005545 Ga0070695_100021715 Ga0070695_1000217152 181
318 3300005546 Ga0070696_100005584 Ga0070696_1000055842 181
319 3300005546 Ga0070696_100670226 Ga0070696_1006702261 181
320 3300005548 Ga0070665_100414560 Ga0070665_1004145602 181
321 3300005549 Ga0070704_100677403 Ga0070704_1006774032 181
322 3300005617 Ga0068859_100085987 Ga0068859_1000859872 181
323 3300005618 Ga0068864_100032992 Ga0068864_1000329924 181
324 3300005618 Ga0068864_100051810 Ga0068864_1000518102 181
325 3300005618 Ga0068864_100199350 Ga0068864_1001993502 181
326 3300005719 Ga0068861_100256670 Ga0068861_1002566702 181
327 3300005834 Ga0068851_10145136 Ga0068851_101451362 181
328 3300005841 Ga0068863_100471589 Ga0068863_1004715892 181
329 3300005841 Ga0068863_101240586 Ga0068863_1012405861 181
330 3300005842 Ga0068858_100288953 Ga0068858_1002889532 181
331 3300005844 Ga0068862_100007767 Ga0068862_1000077676 181
332 3300006844 Ga0075428_100004856 Ga0075428_10000485618 181
333 3300006852 Ga0075433_10002500 Ga0075433_1000250015 181
334 3300006852 Ga0075433_10030077 Ga0075433_100300777 181
335 3300006852 Ga0075433_10137140 Ga0075433_101371401 181
336 3300006852 Ga0075433_10677626 Ga0075433_106776262 181
337 3300006871 Ga0075434_100001724 Ga0075434_10000172414 181
338 3300006871 Ga0075434_100172137 Ga0075434_1001721372 181
339 3300006871 Ga0075434_100301160 Ga0075434_1003011601 181
340 3300006880 Ga0075429_100000496 Ga0075429_1000004969 181
341 3300006914 Ga0075436_100000142 Ga0075436_10000014232 181
342 3300006914 Ga0075436_100168868 Ga0075436_1001688682 181
343 3300006931 Ga0097620_100085985 Ga0097620_1000859852 181
344 3300007076 Ga0075435_100008441 Ga0075435_1000084413 181
345 3300007076 Ga0075435_100023958 Ga0075435_1000239584 181
346 3300007265 Ga0099794_10228772 Ga0099794_102287722 181
347 3300009094 Ga0111539_10028668 Ga0111539_100286689 181
348 3300009094 Ga0111539_10046437 Ga0111539_100464375 181
349 3300009094 Ga0111539_10128179 Ga0111539_101281792 181
350 3300009094 Ga0111539_10233688 Ga0111539_102336882 181
351 3300009098 Ga0105245_10529449 Ga0105245_105294492 181
352 3300009147 Ga0114129_10001872 Ga0114129_1000187220 181
353 3300009147 Ga0114129_10480138 Ga0114129_104801383 181
354 3300009148 Ga0105243_10000339 Ga0105243_1000033914 181
355 3300009148 Ga0105243_10489249 Ga0105243_104892492 181
356 3300009174 Ga0105241_10015808 Ga0105241_100158084 181
357 3300009176 Ga0105242_10006022 Ga0105242_100060229 181
358 3300009553 Ga0105249_10012564 Ga0105249_100125643 181
359 3300010375 Ga0105239_10817261 Ga0105239_108172612 181
360 3300013297 Ga0157378_10000192 Ga0157378_1000019255 181
361 3300013306 Ga0163162_10848988 Ga0163162_108489882 181
362 3300013308 Ga0157375_10159663 Ga0157375_101596633 181
363 3300014326 Ga0157380_10316039 Ga0157380_103160392 181
364 3300014968 Ga0157379_10107088 Ga0157379_101070882 181
365 3300014969 Ga0157376_10021789 Ga0157376_100217893 181
366 3300025321 Ga0207656_10006815 Ga0207656_100068154 181
367 3300025898 Ga0207692_10607292 Ga0207692_106072922 181
368 3300025904 Ga0207647_10036448 Ga0207647_100364481 181
369 3300025906 Ga0207699_10412728 Ga0207699_104127282 181
370 3300025907 Ga0207645_10119939 Ga0207645_101199392 181
371 3300025912 Ga0207707_10000590 Ga0207707_1000059029 181
372 3300025917 Ga0207660_10011374 Ga0207660_100113744 181
373 3300025921 Ga0207652_10390397 Ga0207652_103903972 181
374 3300025925 Ga0207650_10084585 Ga0207650_100845852 181
375 3300025925 Ga0207650_10286002 Ga0207650_102860022 181
376 3300025925 Ga0207650_10444079 Ga0207650_104440792 181
377 3300025926 Ga0207659_10044601 Ga0207659_100446012 181
378 3300025929 Ga0207664_10291481 Ga0207664_102914812 181
379 3300025937 Ga0207669_10022176 Ga0207669_100221761 181
380 3300025940 Ga0207691_10059115 Ga0207691_100591154 181
381 3300025940 Ga0207691_10112758 Ga0207691_101127582 181
382 3300025942 Ga0207689_10236570 Ga0207689_102365702 181
383 3300025942 Ga0207689_10546149 Ga0207689_105461492 181
384 3300025945 Ga0207679_10372014 Ga0207679_103720142 181
385 3300025972 Ga0207668_10009666 Ga0207668_100096664 181
386 3300025972 Ga0207668_10011288 Ga0207668_100112885 181
387 3300026035 Ga0207703_10633602 Ga0207703_106336022 181
388 3300026067 Ga0207678_10030236 Ga0207678_100302364 181
389 3300026075 Ga0207708_10897270 Ga0207708_108972701 181
390 3300026088 Ga0207641_10121879 Ga0207641_101218792 181
391 3300026088 Ga0207641_10833905 Ga0207641_108339052 181
392 3300026095 Ga0207676_10201540 Ga0207676_102015401 181
393 3300026118 Ga0207675_100077563 Ga0207675_1000775632 181
394 3300026142 Ga0207698_10173506 Ga0207698_101735062 181
395 3300027360 Ga0209969_1042461 Ga0209969_10424611 181
396 3300027378 Ga0209981_1002474 Ga0209981_10024741 181
397 3300027907 Ga0207428_10001315 Ga0207428_1000131520 181
398 3300027907 Ga0207428_10085269 Ga0207428_100852692 181
399 3300031344 Ga0265316_10080901 Ga0265316_100809013 181
400 3300031665 Ga0316575_10006576 Ga0316575_100065764 181
401 3300031728 Ga0316578_10208961 Ga0316578_102089612 181
402 3300034819 Ga0373958_0031256 Ga0373958_0031256_284_829 181
403 3300034820 Ga0373959_0008987 Ga0373959_0008987_972_1517 181
404 3300034957 Ga0373938_0002224 Ga0373938_0002224_401_946 181
405 3300034957 Ga0373938_0054377 Ga0373938_0054377_199_765 181
406 3300035083 Ga0373926_0001853 Ga0373926_0001853_1569_2114 181
407 3300035085 Ga0373929_0015567 Ga0373929_0015567_590_1135 181
408 3300035085 Ga0373929_0054455 Ga0373929_0054455_249_794 181
409 3300035089 Ga0373944_0016793 Ga0373944_0016793_588_1133 181
410 3300035090 Ga0373949_0003719 Ga0373949_0003719_2437_2982 181
411 3300035111 Ga0373923_0041652 Ga0373923_0041652_992_1537 181
412 3300035112 Ga0373932_0004698 Ga0373932_0004698_845_1390 181
413 3300035113 Ga0373936_0012274 Ga0373936_0012274_2273_2818 181
414 3300035113 Ga0373936_0035417 Ga0373936_0035417_776_1321 181
415 3300035115 Ga0373941_0006424 Ga0373941_0006424_2110_2655 181
416 3300035116 Ga0373945_0041557 Ga0373945_0041557_804_1349 181
417 3300035170 Ga0373943_0058874 Ga0373943_0058874_1235_1780 181
418 3300035170 Ga0373943_0100389 Ga0373943_0100389_492_1037 181
419 3300035207 Ga0373942_0014175 Ga0373942_0014175_212_757 181
420 3300035242 Ga0373962_0041398 Ga0373962_0041398_113_658 181
421 3300035398 Ga0316574_0009469 Ga0316574_0009469_46_591 181
422 3300035410 Ga0373924_0017981 Ga0373924_0017981_1494_2039 181
423 3300035410 Ga0373924_0104578 Ga0373924_0104578_387_932 181
424 3300035691 Ga0373931_0014482 Ga0373931_0014482_63_608 181
425 3300035692 Ga0373935_0038687 Ga0373935_0038687_2161_2706 181
426 3300035692 Ga0373935_0091104 Ga0373935_0091104_1418_1963 181
427 3300035692 Ga0373935_0164688 Ga0373935_0164688_935_1480 181
428 3300035695 Ga0373927_0060202 Ga0373927_0060202_631_1176 181
429 3300035695 Ga0373927_0097951 Ga0373927_0097951_1002_1547 181
430 3300035725 Ga0373947_0144024 Ga0373947_0144024_493_1038 181
431 3300036401 Ga0373937_0201695 Ga0373937_0201695_1077_1637 181
432 3300036401 Ga0373937_0580923 Ga0373937_0580923_283_843 181
433 3300037068 Ga0373925_0046190 Ga0373925_0046190_2161_2706 181
434 3300037068 Ga0373925_0380285 Ga0373925_0380285_501_1046 181
435 3300037471 Ga0395905_0682176 Ga0395905_0682176_113_658 181
436 3300037588 Ga0316581_0007984 Ga0316581_0007984_1639_2184 181
437 3300041512 Ga0451853_2332119 Ga0451853_2332119_169_750 181
438 3300042461 Ga0439460_0039633 Ga0439460_0039633_530_1090 181
439 3300042876 Ga0451577_0066293 Ga0451577_0066293_1337_1882 181
440 3300044712 Ga0453684_0046258 Ga0453684_0046258_4719_5264 181
441 3300044712 Ga0453684_0341393 Ga0453684_0341393_693_1238 181
442 3300044735 Ga0466968_0259924 Ga0466968_0259924_199_744 181
443 3300045051 Ga0451576_0007423 Ga0451576_0007423_10372_10917 181
444 3300046455 Ga0495603_0004362 Ga0495603_0004362_1499_2044 181
445 3300046463 Ga0495653_0056651 Ga0495653_0056651_1399_1944 181
446 3300046472 Ga0495580_0064097 Ga0495580_0064097_298_843 181
447 3300046473 Ga0495582_0041039 Ga0495582_0041039_1855_2400 181
448 3300046499 Ga0495594_0141289 Ga0495594_0141289_174_719 181
449 3300046516 Ga0495628_0287336 Ga0495628_0287336_138_683 181
450 3300046517 Ga0495630_0044545 Ga0495630_0044545_2581_3126 181
451 3300046517 Ga0495630_0050296 Ga0495630_0050296_1733_2278 181
452 3300046526 Ga0495666_0012336 Ga0495666_0012336_1545_2090 181
453 3300046535 Ga0495586_0001122 Ga0495586_0001122_4165_4710 181
454 3300046642 Ga0495634_0400719 Ga0495634_0400719_94_639 181
455 3300046674 Ga0495588_0008579 Ga0495588_0008579_1452_1997 181
456 3300046681 Ga0495647_0001029 Ga0495647_0001029_1334_1879 181
457 3300046683 Ga0495658_0002217 Ga0495658_0002217_585_1130 181
458 3300046683 Ga0495658_0041748 Ga0495658_0041748_1320_1865 181
459 3300047319 Ga0495674_0726149 Ga0495674_0726149_43_588 181
460 3300047673 Ga0495593_0308369 Ga0495593_0308369_131_676 181
461 3300049568 Ga0501031_0081169 Ga0501031_0081169_1537_2082 181
462 3300049570 Ga0501033_0025955 Ga0501033_0025955_3815_4360 181
463 3300049577 Ga0501041_0272908 Ga0501041_0272908_176_727 181
464 3300049580 Ga0501046_0045838 Ga0501046_0045838_1530_2075 181
465 3300049585 Ga0501069_0273398 Ga0501069_0273398_159_704 181
466 3300049587 Ga0501071_0003199 Ga0501071_0003199_1061_1606 181
467 3300049587 Ga0501071_0992479 Ga0501071_0992479_17_562 181
468 3300049588 Ga0501072_0043357 Ga0501072_0043357_548_1093 181
469 3300049589 Ga0501073_0158154 Ga0501073_0158154_753_1298 181
470 3300049591 Ga0501075_0093631 Ga0501075_0093631_80_625 181
471 3300049592 Ga0501076_0025702 Ga0501076_0025702_214_759 181
472 3300049593 Ga0501077_0037025 Ga0501077_0037025_1933_2484 181
473 3300049741 Ga0501079_0050908 Ga0501079_0050908_2345_2890 181
474 3300049742 Ga0501080_0000692 Ga0501080_0000692_14307_14852 181
475 3300049743 Ga0501081_0039707 Ga0501081_0039707_2157_2702 181
476 3300049743 Ga0501081_0068203 Ga0501081_0068203_508_1053 181
477 3300049824 Ga0501045_0018274 Ga0501045_0018274_994_1539 181
478 3300050507 nmdc:mga05p37_128747_c1 nmdc:mga05p37_128747_c1_535_1080 181
479 3300050507 nmdc:mga05p37_15060_c1 nmdc:mga05p37_15060_c1_1499_2044 181
480 3300050507 nmdc:mga05p37_732274_c1 nmdc:mga05p37_732274_c1_474_1019 181
481 3300050508 nmdc:mga09592_124522_c1 nmdc:mga09592_124522_c1_740_1285 181
482 3300050508 nmdc:mga09592_2325_c1 nmdc:mga09592_2325_c1_13079_13624 181
483 3300050508 nmdc:mga09592_355891_c1 nmdc:mga09592_355891_c1_565_1110 181
484 3300050509 nmdc:mga0qj67_243665_c1 nmdc:mga0qj67_243665_c1_858_1403 181
485 3300050510 nmdc:mga06r32_90108_c1 nmdc:mga06r32_90108_c1_1498_2043 181
486 3300050511 nmdc:mga08y16_1707_c1 nmdc:mga08y16_1707_c1_7416_7961 181
487 3300050511 nmdc:mga08y16_232561_c1 nmdc:mga08y16_232561_c1_1331_1876 181
488 3300050511 nmdc:mga08y16_32909_c1 nmdc:mga08y16_32909_c1_3283_3828 181
489 3300050512 nmdc:mga0n895_333_c1 nmdc:mga0n895_333_c1_18738_19283 181
490 3300050513 nmdc:mga0rr50_569_c1 nmdc:mga0rr50_569_c1_12681_13226 181
491 3300050513 nmdc:mga0rr50_59239_c1 nmdc:mga0rr50_59239_c1_570_1115 181
492 3300050514 nmdc:mga08x19_1192_c1 nmdc:mga08x19_1192_c1_3238_3783 181
493 3300050514 nmdc:mga08x19_260393_c1 nmdc:mga08x19_260393_c1_266_811 181
494 3300050514 nmdc:mga08x19_28528_c1 nmdc:mga08x19_28528_c1_2619_3164 181
495 3300050515 nmdc:mga0a205_13415_c1 nmdc:mga0a205_13415_c1_761_1306 181
496 3300050515 nmdc:mga0a205_1994_c1 nmdc:mga0a205_1994_c1_16207_16752 181
497 3300059423 Ga0590074_048058 Ga0590074_048058_109_666 181
498 3300059426 Ga0590077_018187 Ga0590077_018187_286_831 181
499 3300060353 Ga0501082_0496108 Ga0501082_0496108_294_839 181
500 3300049569 Ga0501032_0177934 Ga0501032_0177934_781_1338 182
501 3300049570 Ga0501033_0016265 Ga0501033_0016265_893_1450 182
502 3300049572 Ga0501036_0002538 Ga0501036_0002538_554_1111 182
503 3300049573 Ga0501037_0011042 Ga0501037_0011042_742_1299 182
504 3300049574 Ga0501038_0002348 Ga0501038_0002348_13460_14017 182
505 3300049576 Ga0501040_0001256 Ga0501040_0001256_15000_15557 182
506 3300049577 Ga0501041_0002453 Ga0501041_0002453_7947_8504 182
507 3300049578 Ga0501042_0000735 Ga0501042_0000735_8064_8621 182
508 3300049579 Ga0501043_0007575 Ga0501043_0007575_4809_5366 182
509 3300049580 Ga0501046_0003327 Ga0501046_0003327_32_589 182
510 3300049582 Ga0501048_0053282 Ga0501048_0053282_1927_2484 182
511 3300049588 Ga0501072_0058598 Ga0501072_0058598_72_629 182
512 3300049590 Ga0501074_0024589 Ga0501074_0024589_3424_3981 182
513 3300049591 Ga0501075_0002051 Ga0501075_0002051_7646_8203 182
514 3300049592 Ga0501076_0002867 Ga0501076_0002867_5588_6145 182
515 3300049593 Ga0501077_0000443 Ga0501077_0000443_11394_11951 182
516 3300049741 Ga0501079_0000827 Ga0501079_0000827_6543_7100 182
517 3300049742 Ga0501080_0169487 Ga0501080_0169487_854_1411 182
518 3300049743 Ga0501081_0001598 Ga0501081_0001598_12874_13431 182
519 3300049744 Ga0501083_0187571 Ga0501083_0187571_120_677 182
520 3300049822 Ga0501035_0013485 Ga0501035_0013485_5405_5962 182
521 3300049824 Ga0501045_0064364 Ga0501045_0064364_1559_2116 182
522 3300054114 Ga0501084_0002718 Ga0501084_0002718_11585_12148 182
523 3300060353 Ga0501082_0018622 Ga0501082_0018622_89_646 182
524 3300061734 Ga0530510_0002712 Ga0530510_0002712_2118_2675 182
525 3300005577 Ga0068857_100671624 Ga0068857_1006716242 183
526 3300006871 Ga0075434_100002486 Ga0075434_10000248612 183
527 3300006914 Ga0075436_100077534 Ga0075436_1000775342 183
528 3300007076 Ga0075435_100006910 Ga0075435_1000069109 183
529 3300042876 Ga0451577_0037595 Ga0451577_0037595_2110_2703 183
530 3300045051 Ga0451576_0002487 Ga0451576_0002487_4041_4634 183
531 3300049571 Ga0501034_0459443 Ga0501034_0459443_556_1137 183
532 3300049572 Ga0501036_0660338 Ga0501036_0660338_228_809 183
533 3300049573 Ga0501037_0233113 Ga0501037_0233113_642_1223 183
534 3300049574 Ga0501038_0320777 Ga0501038_0320777_373_954 183
535 3300049577 Ga0501041_0155463 Ga0501041_0155463_475_1050 183
536 3300049577 Ga0501041_0169055 Ga0501041_0169055_17_574 183
537 3300049582 Ga0501048_0352102 Ga0501048_0352102_290_847 183
538 3300049587 Ga0501071_0242156 Ga0501071_0242156_580_1137 183
539 3300049587 Ga0501071_0245031 Ga0501071_0245031_758_1333 183
540 3300049588 Ga0501072_0053110 Ga0501072_0053110_2073_2630 183
541 3300049591 Ga0501075_0243164 Ga0501075_0243164_33_590 183
542 3300049591 Ga0501075_0248818 Ga0501075_0248818_128_703 183
543 3300049741 Ga0501079_0717128 Ga0501079_0717128_65_640 183
544 3300049823 Ga0501044_0074090 Ga0501044_0074090_2666_3247 183
545 3300050512 nmdc:mga0n895_127974_c1 nmdc:mga0n895_127974_c1_1435_1992 183
546 3300050513 nmdc:mga0rr50_4041_c1 nmdc:mga0rr50_4041_c1_5217_5774 183
547 3300061734 Ga0530510_0322704 Ga0530510_0322704_440_1015 183
548 3300061734 Ga0530510_0742737 Ga0530510_0742737_123_680 183
549 3300046537 Ga0495598_0092283 Ga0495598_0092283_24_593 184
550 3300000044 ARSoilOldRDRAFT_c011124 ARSoilOldRDRAFT_0111241 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

31

193

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j9a-assembly1.cif.gz_A-2 oligoribonuclease 0.9741 9 185
5cy4-assembly1.cif.gz_B crystal structure of an oligoribonuclease from acinetobacter baumannii 0.9739 5 181
7vh4-assembly1.cif.gz_C crystal structure of oligoribonuclease of escherichia coli 0.9727 9 185
7va3-assembly1.cif.gz_A paorn oligoribonuclease d11a mutant with substrate pgpg complex structure 0.9726 9 185
7vh4-assembly1.cif.gz_D-2 crystal structure of oligoribonuclease of escherichia coli 0.9718 9 185
ID Description Score Start End Superfamily
af_Q556Y2_11_190_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9778 7 184 3.30.420.10
af_P9WIU1_1_181_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9678 9 185 3.30.420.10
1ytaA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9624 6 185 3.30.420.10
af_Q6K4V8_62_244_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9587 10 185 3.30.420.10
1ytaA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9571 6 185 3.30.420.10
ID Description Score Start End GO Terms
AF-X1BLJ9-F1-model_v4 Exonuclease domain-containing protein 0.9947 8 108 GO:0000175
GO:0003676
AF-A0A3D2DDW7-F1-model_v4 deleted 0.9944 9 102
AF-A0A182K888-F1-model_v4 Exonuclease domain-containing protein 0.9884 9 108 GO:0000175
GO:0003676
GO:0005739
AF-A0A847E1P4-F1-model_v4 Oligoribonuclease (EC 3.1.-.-) 0.9848 9 185 GO:0000175
GO:0003676
GO:0005737
GO:0006259
AF-A0A4Z0M0X9-F1-model_v4 Oligoribonuclease (EC 3.1.-.-) 0.9848 9 181 GO:0000175
GO:0003676
GO:0005737
GO:0006259

Feature Viewer

pLDDT pTM Quality
91.73 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map