F462496
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 550 | 281 | 548 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10159663|Ga0157375_101596633 |
| Length | 203 |
| Sequence | VADTGETLPGVRKWKPSFYATPMPPDANHLIWIDMEMTGLVPERDRIIEVALVITDANLAPVAQAPVWVVHQQDAVLDAMDSWNQGTHGKSGLVAKVKASVNDEATVEAEALAFLAQHVPSKASPMCGNSICQDRRFLARWMPRLEDWFHYRNLDVSTLKELARRWAPDLMKGIPKEGKHEALADVYESILELKYYREHFIRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 2 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 155 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 158 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 159 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 164 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 165 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 166 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 172 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 173 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 199 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 205 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 206 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 207 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 208 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 209 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 210 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 279 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98 |
| Metatranscriptomes | 1.64 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilOldRDRAFT_c011124 | 3300000044 | Bacteria | 754 |
| 2 | JGI24742J22300_10021375 | 3300002244 | Bacteria | 1104 |
| 3 | Ga0065715_10791798 | 3300005293 | Bacteria | 613 |
| 4 | Ga0065707_10004016 | 3300005295 | Bacteria | 5740 |
| 5 | Ga0070676_10176593 | 3300005328 | Bacteria | 1386 |
| 6 | Ga0070690_100000335 | 3300005330 | Bacteria | 24144 |
| 7 | Ga0070690_100189099 | 3300005330 | Bacteria | 1426 |
| 8 | Ga0070670_100021506 | 3300005331 | Bacteria | 5549 |
| 9 | Ga0070670_100021978 | 3300005331 | Bacteria | 5489 |
| 10 | Ga0070670_100022354 | 3300005331 | Bacteria | 5444 |
| 11 | Ga0070670_100554055 | 3300005331 | Bacteria | 1026 |
| 12 | Ga0068869_100001158 | 3300005334 | Bacteria | 15429 |
| 13 | Ga0070666_10201882 | 3300005335 | Bacteria | 1399 |
| 14 | Ga0070680_100001369 | 3300005336 | Bacteria | 17652 |
| 15 | Ga0070680_100044326 | 3300005336 | Bacteria | 3615 |
| 16 | Ga0068868_100000378 | 3300005338 | Bacteria | 30380 |
| 17 | Ga0068868_100242264 | 3300005338 | Bacteria | 1515 |
| 18 | Ga0070660_100158284 | 3300005339 | Bacteria | 1824 |
| 19 | Ga0070689_100213174 | 3300005340 | Bacteria | 1581 |
| 20 | Ga0070691_10255978 | 3300005341 | Bacteria | 941 |
| 21 | Ga0070687_100000353 | 3300005343 | Bacteria | 15629 |
| 22 | Ga0070687_100337491 | 3300005343 | Bacteria | 968 |
| 23 | Ga0070692_10003721 | 3300005345 | Bacteria | 6256 |
| 24 | Ga0070692_10151507 | 3300005345 | Bacteria | 1321 |
| 25 | Ga0070668_100017930 | 3300005347 | Bacteria | 5310 |
| 26 | Ga0070668_100028612 | 3300005347 | Bacteria | 4230 |
| 27 | Ga0070668_100211002 | 3300005347 | Bacteria | 1597 |
| 28 | Ga0070675_100035578 | 3300005354 | Bacteria | 4047 |
| 29 | Ga0070671_100321467 | 3300005355 | Bacteria | 1319 |
| 30 | Ga0070674_100573491 | 3300005356 | Bacteria | 950 |
| 31 | Ga0070673_100110107 | 3300005364 | Bacteria | 2283 |
| 32 | Ga0070673_100205804 | 3300005364 | Bacteria | 1697 |
| 33 | Ga0070688_100034314 | 3300005365 | Bacteria | 3073 |
| 34 | Ga0070659_100099548 | 3300005366 | Bacteria | 2339 |
| 35 | Ga0070667_100075953 | 3300005367 | Bacteria | 2868 |
| 36 | Ga0070667_100154591 | 3300005367 | Bacteria | 2017 |
| 37 | Ga0070703_10006589 | 3300005406 | Bacteria | 3255 |
| 38 | Ga0070701_10000027 | 3300005438 | Bacteria | 38022 |
| 39 | Ga0070701_10113890 | 3300005438 | Bacteria | 1515 |
| 40 | Ga0070711_100598316 | 3300005439 | Bacteria | 920 |
| 41 | Ga0070705_100000061 | 3300005440 | Bacteria | 56772 |
| 42 | Ga0070705_100026329 | 3300005440 | Bacteria | 3164 |
| 43 | Ga0070705_100172034 | 3300005440 | Bacteria | 1459 |
| 44 | Ga0070705_100227540 | 3300005440 | Bacteria | 1295 |
| 45 | Ga0070705_100282480 | 3300005440 | Bacteria | 1181 |
| 46 | Ga0070705_100409054 | 3300005440 | Bacteria | 1007 |
| 47 | Ga0070700_100000386 | 3300005441 | Bacteria | 22650 |
| 48 | Ga0070700_100123244 | 3300005441 | Bacteria | 1740 |
| 49 | Ga0070700_100772742 | 3300005441 | Bacteria | 771 |
| 50 | Ga0070694_100000096 | 3300005444 | Bacteria | 42431 |
| 51 | Ga0070694_100007671 | 3300005444 | Bacteria | 6587 |
| 52 | Ga0070694_100263250 | 3300005444 | Bacteria | 1309 |
| 53 | Ga0070694_100317230 | 3300005444 | Bacteria | 1199 |
| 54 | Ga0070694_100348439 | 3300005444 | Bacteria | 1147 |
| 55 | Ga0070694_100362641 | 3300005444 | Bacteria | 1126 |
| 56 | Ga0070663_100053485 | 3300005455 | Bacteria | 2883 |
| 57 | Ga0070678_100156833 | 3300005456 | Bacteria | 1840 |
| 58 | Ga0070678_100175610 | 3300005456 | Bacteria | 1749 |
| 59 | Ga0070662_100252742 | 3300005457 | Bacteria | 1418 |
| 60 | Ga0070662_100737412 | 3300005457 | Bacteria | 835 |
| 61 | Ga0070681_10000372 | 3300005458 | Bacteria | 36177 |
| 62 | Ga0070681_10032716 | 3300005458 | Bacteria | 5221 |
| 63 | Ga0068867_100001399 | 3300005459 | Bacteria | 16670 |
| 64 | Ga0068867_100039342 | 3300005459 | Bacteria | 3447 |
| 65 | Ga0068867_100180993 | 3300005459 | Bacteria | 1676 |
| 66 | Ga0068867_100196166 | 3300005459 | Bacteria | 1614 |
| 67 | Ga0070698_100066546 | 3300005471 | Bacteria | 3626 |
| 68 | Ga0070699_100094917 | 3300005518 | Bacteria | 2611 |
| 69 | Ga0070679_100030156 | 3300005530 | Bacteria | 5353 |
| 70 | Ga0070697_100027227 | 3300005536 | Bacteria | 4572 |
| 71 | Ga0068853_100032789 | 3300005539 | Bacteria | 4403 |
| 72 | Ga0070672_100035396 | 3300005543 | Bacteria | 3796 |
| 73 | Ga0070672_101226629 | 3300005543 | Bacteria | 668 |
| 74 | Ga0070686_100001578 | 3300005544 | Bacteria | 12805 |
| 75 | Ga0070686_100076937 | 3300005544 | Bacteria | 2198 |
| 76 | Ga0070695_100000965 | 3300005545 | Bacteria | 15608 |
| 77 | Ga0070695_100010236 | 3300005545 | Bacteria | 5595 |
| 78 | Ga0070695_100021715 | 3300005545 | Bacteria | 3932 |
| 79 | Ga0070695_100036956 | 3300005545 | Bacteria | 3075 |
| 80 | Ga0070695_100418541 | 3300005545 | Bacteria | 1020 |
| 81 | Ga0070696_100000560 | 3300005546 | Bacteria | 23643 |
| 82 | Ga0070696_100005584 | 3300005546 | Bacteria | 8398 |
| 83 | Ga0070696_100103355 | 3300005546 | Bacteria | 2044 |
| 84 | Ga0070696_100670226 | 3300005546 | Bacteria | 843 |
| 85 | Ga0070693_100000003 | 3300005547 | Bacteria | 95793 |
| 86 | Ga0070665_100414560 | 3300005548 | Bacteria | 1355 |
| 87 | Ga0070665_100775083 | 3300005548 | Bacteria | 972 |
| 88 | Ga0070704_100000504 | 3300005549 | Bacteria | 18563 |
| 89 | Ga0070704_100034199 | 3300005549 | Bacteria | 3444 |
| 90 | Ga0070704_100038185 | 3300005549 | Bacteria | 3287 |
| 91 | Ga0070704_100056791 | 3300005549 | Bacteria | 2781 |
| 92 | Ga0070704_100677403 | 3300005549 | Bacteria | 913 |
| 93 | Ga0070704_100699372 | 3300005549 | Bacteria | 899 |
| 94 | Ga0068855_100005492 | 3300005563 | Bacteria | 15467 |
| 95 | Ga0068857_100205536 | 3300005577 | Bacteria | 1796 |
| 96 | Ga0068857_100671624 | 3300005577 | Bacteria | 983 |
| 97 | Ga0068854_100003450 | 3300005578 | Bacteria | 9865 |
| 98 | Ga0070702_100000004 | 3300005615 | Bacteria | 70302 |
| 99 | Ga0068852_100037238 | 3300005616 | Bacteria | 4077 |
| 100 | Ga0068859_100002292 | 3300005617 | Bacteria | 19424 |
| 101 | Ga0068859_100021439 | 3300005617 | Bacteria | 6485 |
| 102 | Ga0068859_100085987 | 3300005617 | Bacteria | 3190 |
| 103 | Ga0068859_100917765 | 3300005617 | Bacteria | 960 |
| 104 | Ga0068864_100032992 | 3300005618 | Bacteria | 4400 |
| 105 | Ga0068864_100051810 | 3300005618 | Bacteria | 3537 |
| 106 | Ga0068864_100199350 | 3300005618 | Bacteria | 1838 |
| 107 | Ga0068866_10000342 | 3300005718 | Bacteria | 21994 |
| 108 | Ga0068861_100001170 | 3300005719 | Bacteria | 16343 |
| 109 | Ga0068861_100256670 | 3300005719 | Bacteria | 1494 |
| 110 | Ga0068851_10145136 | 3300005834 | Bacteria | 1293 |
| 111 | Ga0068870_10004636 | 3300005840 | Bacteria | 5929 |
| 112 | Ga0068863_100471589 | 3300005841 | Bacteria | 1233 |
| 113 | Ga0068863_101240586 | 3300005841 | Bacteria | 752 |
| 114 | Ga0068858_100002734 | 3300005842 | Bacteria | 17741 |
| 115 | Ga0068858_100288953 | 3300005842 | Bacteria | 1562 |
| 116 | Ga0068860_100002098 | 3300005843 | Bacteria | 21009 |
| 117 | Ga0068860_100389607 | 3300005843 | Bacteria | 1377 |
| 118 | Ga0068860_101286146 | 3300005843 | Bacteria | 752 |
| 119 | Ga0068862_100001419 | 3300005844 | Bacteria | 22189 |
| 120 | Ga0068862_100007767 | 3300005844 | Bacteria | 8870 |
| 121 | Ga0097621_100000024 | 3300006237 | Bacteria | 81390 |
| 122 | Ga0097621_100659538 | 3300006237 | Bacteria | 961 |
| 123 | Ga0068871_100002217 | 3300006358 | Bacteria | 13190 |
| 124 | Ga0068871_100459946 | 3300006358 | Bacteria | 1142 |
| 125 | Ga0075428_100004856 | 3300006844 | Bacteria | 14915 |
| 126 | Ga0075428_100023622 | 3300006844 | Bacteria | 6806 |
| 127 | Ga0075428_100061299 | 3300006844 | Bacteria | 4120 |
| 128 | Ga0075431_100003037 | 3300006847 | Bacteria | 16231 |
| 129 | Ga0075431_100078193 | 3300006847 | Bacteria | 3415 |
| 130 | Ga0075433_10002500 | 3300006852 | Bacteria | 13986 |
| 131 | Ga0075433_10030077 | 3300006852 | Bacteria | 4632 |
| 132 | Ga0075433_10137140 | 3300006852 | Bacteria | 2175 |
| 133 | Ga0075433_10677626 | 3300006852 | Bacteria | 904 |
| 134 | Ga0075434_100001724 | 3300006871 | Bacteria | 18761 |
| 135 | Ga0075434_100002486 | 3300006871 | Bacteria | 16234 |
| 136 | Ga0075434_100172137 | 3300006871 | Bacteria | 2185 |
| 137 | Ga0075434_100301160 | 3300006871 | Bacteria | 1624 |
| 138 | Ga0075429_100000018 | 3300006880 | Bacteria | 71039 |
| 139 | Ga0075429_100000496 | 3300006880 | Bacteria | 29568 |
| 140 | Ga0068865_100000417 | 3300006881 | Bacteria | 23766 |
| 141 | Ga0075436_100000142 | 3300006914 | Bacteria | 43453 |
| 142 | Ga0075436_100077534 | 3300006914 | Bacteria | 2302 |
| 143 | Ga0075436_100168868 | 3300006914 | Bacteria | 1544 |
| 144 | Ga0097620_100002292 | 3300006931 | Bacteria | 19424 |
| 145 | Ga0097620_100021438 | 3300006931 | Bacteria | 6485 |
| 146 | Ga0097620_100085985 | 3300006931 | Bacteria | 3190 |
| 147 | Ga0097620_100917822 | 3300006931 | Bacteria | 960 |
| 148 | Ga0075435_100004636 | 3300007076 | Bacteria | 9470 |
| 149 | Ga0075435_100006910 | 3300007076 | Bacteria | 8051 |
| 150 | Ga0075435_100008441 | 3300007076 | Bacteria | 7391 |
| 151 | Ga0075435_100023958 | 3300007076 | Bacteria | 4729 |
| 152 | Ga0099794_10228772 | 3300007265 | Bacteria | 956 |
| 153 | Ga0105240_10032705 | 3300009093 | Bacteria | 6731 |
| 154 | Ga0111539_10014451 | 3300009094 | Bacteria | 9851 |
| 155 | Ga0111539_10028668 | 3300009094 | Bacteria | 6790 |
| 156 | Ga0111539_10046437 | 3300009094 | Bacteria | 5194 |
| 157 | Ga0111539_10105719 | 3300009094 | Bacteria | 3302 |
| 158 | Ga0111539_10128179 | 3300009094 | Bacteria | 2972 |
| 159 | Ga0111539_10233688 | 3300009094 | Bacteria | 2140 |
| 160 | Ga0111539_10262662 | 3300009094 | Bacteria | 2010 |
| 161 | Ga0111539_10354926 | 3300009094 | Bacteria | 1706 |
| 162 | Ga0111539_10561441 | 3300009094 | Bacteria | 1329 |
| 163 | Ga0105245_10001245 | 3300009098 | Bacteria | 22979 |
| 164 | Ga0105245_10529449 | 3300009098 | Bacteria | 1198 |
| 165 | Ga0114129_10001872 | 3300009147 | Bacteria | 28684 |
| 166 | Ga0114129_10010633 | 3300009147 | Bacteria | 13126 |
| 167 | Ga0114129_10111438 | 3300009147 | Bacteria | 3776 |
| 168 | Ga0114129_10480138 | 3300009147 | Bacteria | 1626 |
| 169 | Ga0105243_10000339 | 3300009148 | Bacteria | 51082 |
| 170 | Ga0105243_10489249 | 3300009148 | Bacteria | 1163 |
| 171 | Ga0105241_10015808 | 3300009174 | Bacteria | 5529 |
| 172 | Ga0105242_10000346 | 3300009176 | Bacteria | 37361 |
| 173 | Ga0105242_10006022 | 3300009176 | Bacteria | 9351 |
| 174 | Ga0105248_10212527 | 3300009177 | Bacteria | 2179 |
| 175 | Ga0105237_10084351 | 3300009545 | Bacteria | 3167 |
| 176 | Ga0105249_10012564 | 3300009553 | Bacteria | 7464 |
| 177 | Ga0105249_10632325 | 3300009553 | Bacteria | 1127 |
| 178 | Ga0105239_10817261 | 3300010375 | Bacteria | 1068 |
| 179 | Ga0157344_1009928 | 3300012476 | Bacteria | 677 |
| 180 | Ga0157378_10000192 | 3300013297 | Bacteria | 59014 |
| 181 | Ga0163162_10233824 | 3300013306 | Bacteria | 1969 |
| 182 | Ga0163162_10848988 | 3300013306 | Bacteria | 1028 |
| 183 | Ga0163162_11417460 | 3300013306 | Bacteria | 790 |
| 184 | Ga0157375_10159663 | 3300013308 | Bacteria | 2396 |
| 185 | Ga0157380_10006145 | 3300014326 | Bacteria | 8420 |
| 186 | Ga0157380_10007200 | 3300014326 | Bacteria | 7882 |
| 187 | Ga0157380_10316039 | 3300014326 | Bacteria | 1446 |
| 188 | Ga0157380_10393396 | 3300014326 | Bacteria | 1312 |
| 189 | Ga0157377_10219906 | 3300014745 | Bacteria | 1215 |
| 190 | Ga0157377_10556328 | 3300014745 | Bacteria | 811 |
| 191 | Ga0157379_10107088 | 3300014968 | Bacteria | 2510 |
| 192 | Ga0157376_10021789 | 3300014969 | Bacteria | 4980 |
| 193 | Ga0207656_10006815 | 3300025321 | Bacteria | 4130 |
| 194 | Ga0207653_10008181 | 3300025885 | Bacteria | 3260 |
| 195 | Ga0207692_10607292 | 3300025898 | Bacteria | 704 |
| 196 | Ga0207642_10001562 | 3300025899 | Bacteria | 7050 |
| 197 | Ga0207647_10036448 | 3300025904 | Bacteria | 3125 |
| 198 | Ga0207699_10412728 | 3300025906 | Bacteria | 963 |
| 199 | Ga0207645_10119939 | 3300025907 | Bacteria | 1707 |
| 200 | Ga0207643_10022819 | 3300025908 | Bacteria | 3448 |
| 201 | Ga0207707_10000590 | 3300025912 | Bacteria | 36588 |
| 202 | Ga0207707_10026336 | 3300025912 | Bacteria | 5083 |
| 203 | Ga0207695_10155922 | 3300025913 | Bacteria | 2218 |
| 204 | Ga0207671_10267220 | 3300025914 | Bacteria | 1347 |
| 205 | Ga0207660_10006379 | 3300025917 | Bacteria | 7645 |
| 206 | Ga0207660_10011374 | 3300025917 | Bacteria | 5790 |
| 207 | Ga0207660_10084472 | 3300025917 | Bacteria | 2340 |
| 208 | Ga0207662_10000653 | 3300025918 | Bacteria | 15703 |
| 209 | Ga0207662_10613712 | 3300025918 | Bacteria | 758 |
| 210 | Ga0207652_10017093 | 3300025921 | Bacteria | 5934 |
| 211 | Ga0207652_10390397 | 3300025921 | Bacteria | 1256 |
| 212 | Ga0207694_10151451 | 3300025924 | Bacteria | 1869 |
| 213 | Ga0207650_10084585 | 3300025925 | Bacteria | 2412 |
| 214 | Ga0207650_10286002 | 3300025925 | Bacteria | 1343 |
| 215 | Ga0207650_10444079 | 3300025925 | Bacteria | 1079 |
| 216 | Ga0207659_10044601 | 3300025926 | Bacteria | 3120 |
| 217 | Ga0207687_10000454 | 3300025927 | Bacteria | 27910 |
| 218 | Ga0207664_10291481 | 3300025929 | Bacteria | 1434 |
| 219 | Ga0207644_10371029 | 3300025931 | Bacteria | 1166 |
| 220 | Ga0207706_10036461 | 3300025933 | Bacteria | 4368 |
| 221 | Ga0207686_10000806 | 3300025934 | Bacteria | 19237 |
| 222 | Ga0207709_10000297 | 3300025935 | Bacteria | 55386 |
| 223 | Ga0207670_10000590 | 3300025936 | Bacteria | 19930 |
| 224 | Ga0207669_10022176 | 3300025937 | Bacteria | 3368 |
| 225 | Ga0207704_10000251 | 3300025938 | Bacteria | 26202 |
| 226 | Ga0207691_10013055 | 3300025940 | Bacteria | 7953 |
| 227 | Ga0207691_10059115 | 3300025940 | Bacteria | 3486 |
| 228 | Ga0207691_10112758 | 3300025940 | Bacteria | 2417 |
| 229 | Ga0207689_10000103 | 3300025942 | Bacteria | 69244 |
| 230 | Ga0207689_10236570 | 3300025942 | Bacteria | 1510 |
| 231 | Ga0207689_10546149 | 3300025942 | Bacteria | 973 |
| 232 | Ga0207679_10372014 | 3300025945 | Bacteria | 1251 |
| 233 | Ga0207667_10007221 | 3300025949 | Bacteria | 13405 |
| 234 | Ga0207651_10162940 | 3300025960 | Bacteria | 1750 |
| 235 | Ga0207712_10007693 | 3300025961 | Bacteria | 6813 |
| 236 | Ga0207668_10009666 | 3300025972 | Bacteria | 5790 |
| 237 | Ga0207668_10011288 | 3300025972 | Bacteria | 5422 |
| 238 | Ga0207668_10542192 | 3300025972 | Bacteria | 1006 |
| 239 | Ga0207640_10003140 | 3300025981 | Bacteria | 8893 |
| 240 | Ga0207677_10000533 | 3300026023 | Bacteria | 24049 |
| 241 | Ga0207703_10000898 | 3300026035 | Bacteria | 29129 |
| 242 | Ga0207703_10627800 | 3300026035 | Bacteria | 1018 |
| 243 | Ga0207703_10633602 | 3300026035 | Bacteria | 1013 |
| 244 | Ga0207639_10086040 | 3300026041 | Bacteria | 2502 |
| 245 | Ga0207639_10107052 | 3300026041 | Bacteria | 2270 |
| 246 | Ga0207678_10030236 | 3300026067 | Bacteria | 4728 |
| 247 | Ga0207708_10000048 | 3300026075 | Bacteria | 114754 |
| 248 | Ga0207708_10149729 | 3300026075 | Bacteria | 1836 |
| 249 | Ga0207708_10877416 | 3300026075 | Bacteria | 775 |
| 250 | Ga0207708_10897270 | 3300026075 | Bacteria | 767 |
| 251 | Ga0207641_10121879 | 3300026088 | Bacteria | 2328 |
| 252 | Ga0207641_10201148 | 3300026088 | Bacteria | 1837 |
| 253 | Ga0207641_10833905 | 3300026088 | Bacteria | 913 |
| 254 | Ga0207648_10001181 | 3300026089 | Bacteria | 29231 |
| 255 | Ga0207648_10325132 | 3300026089 | Bacteria | 1383 |
| 256 | Ga0207676_10201540 | 3300026095 | Bacteria | 1759 |
| 257 | Ga0207674_10226051 | 3300026116 | Bacteria | 1820 |
| 258 | Ga0207675_100000593 | 3300026118 | Bacteria | 35437 |
| 259 | Ga0207675_100077563 | 3300026118 | Bacteria | 3113 |
| 260 | Ga0207683_10045055 | 3300026121 | Bacteria | 3857 |
| 261 | Ga0207683_10238169 | 3300026121 | Bacteria | 1660 |
| 262 | Ga0207698_10129826 | 3300026142 | Bacteria | 2151 |
| 263 | Ga0207698_10173506 | 3300026142 | Bacteria | 1901 |
| 264 | Ga0209969_1042461 | 3300027360 | Bacteria | 707 |
| 265 | Ga0209981_1002474 | 3300027378 | Bacteria | 2356 |
| 266 | Ga0210000_1049226 | 3300027462 | Bacteria | 675 |
| 267 | Ga0209971_1079695 | 3300027682 | Bacteria | 797 |
| 268 | Ga0207428_10001315 | 3300027907 | Bacteria | 26451 |
| 269 | Ga0207428_10076276 | 3300027907 | Bacteria | 2625 |
| 270 | Ga0207428_10085269 | 3300027907 | Bacteria | 2460 |
| 271 | Ga0207428_10322976 | 3300027907 | Bacteria | 1140 |
| 272 | Ga0268266_10229121 | 3300028379 | Bacteria | 1711 |
| 273 | Ga0268265_10001097 | 3300028380 | Bacteria | 24045 |
| 274 | Ga0268265_10803491 | 3300028380 | Bacteria | 917 |
| 275 | Ga0268264_10001229 | 3300028381 | Bacteria | 24608 |
| 276 | Ga0268264_10477935 | 3300028381 | Bacteria | 1211 |
| 277 | Ga0265336_10001259 | 3300028666 | Bacteria | 11998 |
| 278 | Ga0265324_10000006 | 3300029957 | Bacteria | 267048 |
| 279 | Ga0265324_10153637 | 3300029957 | Bacteria | 781 |
| 280 | Ga0265325_10000110 | 3300031241 | Bacteria | 56687 |
| 281 | Ga0265316_10080901 | 3300031344 | Bacteria | 2491 |
| 282 | Ga0316575_10000027 | 3300031665 | Bacteria | 35516 |
| 283 | Ga0316575_10001046 | 3300031665 | Bacteria | 8592 |
| 284 | Ga0316575_10006576 | 3300031665 | Bacteria | 4187 |
| 285 | Ga0316575_10132663 | 3300031665 | Bacteria | 1022 |
| 286 | Ga0316579_10002999 | 3300031691 | Bacteria | 6491 |
| 287 | Ga0316579_10146874 | 3300031691 | Bacteria | 1137 |
| 288 | Ga0265314_10044054 | 3300031711 | Bacteria | 3166 |
| 289 | Ga0316576_10001219 | 3300031727 | Bacteria | 13608 |
| 290 | Ga0316576_10001522 | 3300031727 | Bacteria | 12542 |
| 291 | Ga0316576_10246508 | 3300031727 | Bacteria | 1341 |
| 292 | Ga0316576_10412973 | 3300031727 | Bacteria | 1000 |
| 293 | Ga0316576_10465449 | 3300031727 | Bacteria | 932 |
| 294 | Ga0316576_10633651 | 3300031727 | Bacteria | 778 |
| 295 | Ga0316578_10008889 | 3300031728 | Bacteria | 5136 |
| 296 | Ga0316578_10138349 | 3300031728 | Bacteria | 1466 |
| 297 | Ga0316578_10208961 | 3300031728 | Bacteria | 1174 |
| 298 | Ga0316578_10229127 | 3300031728 | Bacteria | 1116 |
| 299 | Ga0316578_10305627 | 3300031728 | Bacteria | 950 |
| 300 | Ga0316577_10000993 | 3300031733 | Bacteria | 12678 |
| 301 | Ga0316577_10003659 | 3300031733 | Bacteria | 7809 |
| 302 | Ga0316577_10050280 | 3300031733 | Bacteria | 2326 |
| 303 | Ga0316577_10094392 | 3300031733 | Bacteria | 1675 |
| 304 | Ga0307412_10346285 | 3300031911 | Bacteria | 1191 |
| 305 | Ga0307409_101355300 | 3300031995 | Bacteria | 737 |
| 306 | Ga0307416_101083174 | 3300032002 | Bacteria | 906 |
| 307 | Ga0316583_10008512 | 3300032133 | Bacteria | 3699 |
| 308 | Ga0316585_10002191 | 3300032137 | Bacteria | 5238 |
| 309 | Ga0316585_10018515 | 3300032137 | Bacteria | 2114 |
| 310 | Ga0316580_10000494 | 3300032139 | Bacteria | 9117 |
| 311 | Ga0316593_10013132 | 3300032168 | Bacteria | 2446 |
| 312 | Ga0316593_10250246 | 3300032168 | Bacteria | 663 |
| 313 | Ga0316592_1001349 | 3300033524 | Bacteria | 3920 |
| 314 | Ga0316592_1003844 | 3300033524 | Bacteria | 2753 |
| 315 | Ga0316586_1001181 | 3300033527 | Bacteria | 2883 |
| 316 | Ga0316588_1000401 | 3300033528 | Bacteria | 5730 |
| 317 | Ga0316588_1083550 | 3300033528 | Bacteria | 792 |
| 318 | Ga0316596_1002912 | 3300033541 | Bacteria | 3708 |
| 319 | Ga0316596_1003215 | 3300033541 | Bacteria | 3555 |
| 320 | Ga0373958_0031256 | 3300034819 | Bacteria | 1045 |
| 321 | Ga0373959_0008987 | 3300034820 | Bacteria | 1713 |
| 322 | Ga0373938_0002224 | 3300034957 | Bacteria | 3115 |
| 323 | Ga0373938_0054377 | 3300034957 | Bacteria | 922 |
| 324 | Ga0373926_0001853 | 3300035083 | Bacteria | 6583 |
| 325 | Ga0373929_0015567 | 3300035085 | Bacteria | 1480 |
| 326 | Ga0373929_0054455 | 3300035085 | Bacteria | 922 |
| 327 | Ga0373944_0016793 | 3300035089 | Bacteria | 2069 |
| 328 | Ga0373949_0003719 | 3300035090 | Bacteria | 3570 |
| 329 | Ga0373923_0041652 | 3300035111 | Bacteria | 1894 |
| 330 | Ga0373932_0004698 | 3300035112 | Bacteria | 3225 |
| 331 | Ga0373936_0012274 | 3300035113 | Bacteria | 3256 |
| 332 | Ga0373936_0035417 | 3300035113 | Bacteria | 1987 |
| 333 | Ga0373941_0006424 | 3300035115 | Bacteria | 2832 |
| 334 | Ga0373941_0008866 | 3300035115 | Bacteria | 2517 |
| 335 | Ga0373941_0169457 | 3300035115 | Bacteria | 813 |
| 336 | Ga0373945_0041557 | 3300035116 | Bacteria | 1662 |
| 337 | Ga0373954_0000013 | 3300035118 | Bacteria | 73606 |
| 338 | Ga0373956_0444363 | 3300035119 | Bacteria | 619 |
| 339 | Ga0373960_0145145 | 3300035121 | Bacteria | 806 |
| 340 | Ga0373943_0058874 | 3300035170 | Bacteria | 1913 |
| 341 | Ga0373943_0100389 | 3300035170 | Bacteria | 1512 |
| 342 | Ga0373955_0014316 | 3300035172 | Bacteria | 3856 |
| 343 | Ga0373942_0014175 | 3300035207 | Bacteria | 1926 |
| 344 | Ga0373962_0041398 | 3300035242 | Bacteria | 1299 |
| 345 | Ga0316574_0009469 | 3300035398 | Bacteria | 5459 |
| 346 | Ga0316574_0078623 | 3300035398 | Bacteria | 2091 |
| 347 | Ga0373924_0017981 | 3300035410 | Bacteria | 2719 |
| 348 | Ga0373924_0104578 | 3300035410 | Bacteria | 1220 |
| 349 | Ga0373931_0014482 | 3300035691 | Bacteria | 3856 |
| 350 | Ga0373935_0038687 | 3300035692 | Bacteria | 2987 |
| 351 | Ga0373935_0091104 | 3300035692 | Bacteria | 1997 |
| 352 | Ga0373935_0164688 | 3300035692 | Bacteria | 1513 |
| 353 | Ga0373927_0060202 | 3300035695 | Bacteria | 2456 |
| 354 | Ga0373927_0097951 | 3300035695 | Bacteria | 1906 |
| 355 | Ga0373933_0031736 | 3300035724 | Bacteria | 3066 |
| 356 | Ga0373947_0144024 | 3300035725 | Bacteria | 1530 |
| 357 | Ga0373937_0201695 | 3300036401 | Bacteria | 1870 |
| 358 | Ga0373937_0580923 | 3300036401 | Bacteria | 1064 |
| 359 | Ga0316582_0000206 | 3300036647 | Bacteria | 18954 |
| 360 | Ga0316582_0019895 | 3300036647 | Bacteria | 3937 |
| 361 | Ga0316582_0252662 | 3300036647 | Bacteria | 1208 |
| 362 | Ga0316584_0005625 | 3300036712 | Bacteria | 8438 |
| 363 | Ga0316584_0007251 | 3300036712 | Bacteria | 7567 |
| 364 | Ga0316584_0014866 | 3300036712 | Bacteria | 5560 |
| 365 | Ga0316584_0061821 | 3300036712 | Bacteria | 2804 |
| 366 | Ga0316584_0091946 | 3300036712 | Bacteria | 2271 |
| 367 | Ga0373925_0046190 | 3300037068 | Bacteria | 3237 |
| 368 | Ga0373925_0380285 | 3300037068 | Bacteria | 1149 |
| 369 | Ga0395905_0682176 | 3300037471 | Bacteria | 930 |
| 370 | Ga0316581_0007984 | 3300037588 | Bacteria | 2863 |
| 371 | Ga0451853_2332119 | 3300041512 | Bacteria | 1228 |
| 372 | Ga0450919_008840 | 3300042121 | Bacteria | 1163 |
| 373 | Ga0450920_024462 | 3300042122 | Bacteria | 1174 |
| 374 | Ga0450923_000777 | 3300042125 | Bacteria | 3830 |
| 375 | Ga0450890_016187 | 3300042127 | Bacteria | 985 |
| 376 | Ga0450894_005040 | 3300042131 | Bacteria | 1707 |
| 377 | Ga0450907_012001 | 3300042146 | Bacteria | 1440 |
| 378 | Ga0450907_035563 | 3300042146 | Bacteria | 850 |
| 379 | Ga0450908_003350 | 3300042184 | Bacteria | 3111 |
| 380 | Ga0439460_0039633 | 3300042461 | Bacteria | 1378 |
| 381 | Ga0451577_0002897 | 3300042876 | Bacteria | 19683 |
| 382 | Ga0451577_0037595 | 3300042876 | Bacteria | 4356 |
| 383 | Ga0451577_0053947 | 3300042876 | Bacteria | 3589 |
| 384 | Ga0451577_0066293 | 3300042876 | Bacteria | 3221 |
| 385 | Ga0453683_0624084 | 3300044673 | Bacteria | 704 |
| 386 | Ga0453684_0046258 | 3300044712 | Bacteria | 5790 |
| 387 | Ga0453684_0341393 | 3300044712 | Bacteria | 1691 |
| 388 | Ga0466968_0259924 | 3300044735 | Bacteria | 826 |
| 389 | Ga0451576_0002487 | 3300045051 | Bacteria | 27363 |
| 390 | Ga0451576_0007423 | 3300045051 | Bacteria | 13110 |
| 391 | Ga0495603_0004362 | 3300046455 | Bacteria | 8440 |
| 392 | Ga0495653_0056651 | 3300046463 | Bacteria | 2987 |
| 393 | Ga0495580_0064097 | 3300046472 | Bacteria | 2576 |
| 394 | Ga0495582_0041039 | 3300046473 | Bacteria | 2549 |
| 395 | Ga0495594_0141289 | 3300046499 | Bacteria | 1366 |
| 396 | Ga0495628_0287336 | 3300046516 | Bacteria | 1220 |
| 397 | Ga0495630_0044545 | 3300046517 | Bacteria | 3316 |
| 398 | Ga0495630_0050296 | 3300046517 | Bacteria | 3119 |
| 399 | Ga0495666_0012336 | 3300046526 | Bacteria | 4260 |
| 400 | Ga0495586_0001122 | 3300046535 | Bacteria | 15063 |
| 401 | Ga0495587_0351605 | 3300046536 | Bacteria | 821 |
| 402 | Ga0495598_0092283 | 3300046537 | Bacteria | 989 |
| 403 | Ga0495634_0400719 | 3300046642 | Bacteria | 815 |
| 404 | Ga0495659_0016723 | 3300046664 | Bacteria | 2423 |
| 405 | Ga0495588_0008579 | 3300046674 | Bacteria | 4695 |
| 406 | Ga0495647_0001029 | 3300046681 | Bacteria | 8505 |
| 407 | Ga0495658_0002217 | 3300046683 | Bacteria | 9820 |
| 408 | Ga0495658_0041748 | 3300046683 | Bacteria | 2558 |
| 409 | Ga0495674_0726149 | 3300047319 | Bacteria | 778 |
| 410 | Ga0495593_0308369 | 3300047673 | Bacteria | 791 |
| 411 | Ga0495602_0609749 | 3300048088 | Bacteria | 750 |
| 412 | Ga0501031_0081169 | 3300049568 | Bacteria | 2114 |
| 413 | Ga0501032_0177934 | 3300049569 | Bacteria | 1393 |
| 414 | Ga0501033_0016265 | 3300049570 | Bacteria | 5634 |
| 415 | Ga0501033_0025955 | 3300049570 | Bacteria | 4412 |
| 416 | Ga0501033_0339895 | 3300049570 | Bacteria | 1053 |
| 417 | Ga0501034_0459443 | 3300049571 | Bacteria | 1190 |
| 418 | Ga0501036_0002538 | 3300049572 | Bacteria | 14348 |
| 419 | Ga0501036_0035298 | 3300049572 | Bacteria | 4231 |
| 420 | Ga0501036_0660338 | 3300049572 | Bacteria | 865 |
| 421 | Ga0501037_0011042 | 3300049573 | Bacteria | 6643 |
| 422 | Ga0501037_0233113 | 3300049573 | Bacteria | 1292 |
| 423 | Ga0501037_0337153 | 3300049573 | Bacteria | 1042 |
| 424 | Ga0501038_0002348 | 3300049574 | Bacteria | 17640 |
| 425 | Ga0501038_0099114 | 3300049574 | Bacteria | 2429 |
| 426 | Ga0501038_0320777 | 3300049574 | Bacteria | 1212 |
| 427 | Ga0501039_0140514 | 3300049575 | Bacteria | 1897 |
| 428 | Ga0501040_0001256 | 3300049576 | Bacteria | 16114 |
| 429 | Ga0501040_0004980 | 3300049576 | Bacteria | 8594 |
| 430 | Ga0501040_0466770 | 3300049576 | Bacteria | 909 |
| 431 | Ga0501040_0508868 | 3300049576 | Bacteria | 868 |
| 432 | Ga0501041_0002453 | 3300049577 | Bacteria | 10533 |
| 433 | Ga0501041_0009824 | 3300049577 | Bacteria | 5633 |
| 434 | Ga0501041_0155463 | 3300049577 | Bacteria | 1429 |
| 435 | Ga0501041_0169055 | 3300049577 | Bacteria | 1368 |
| 436 | Ga0501041_0272908 | 3300049577 | Bacteria | 1064 |
| 437 | Ga0501041_0293288 | 3300049577 | Bacteria | 1024 |
| 438 | Ga0501042_0000735 | 3300049578 | Bacteria | 17775 |
| 439 | Ga0501042_0070834 | 3300049578 | Bacteria | 2494 |
| 440 | Ga0501042_0369925 | 3300049578 | Bacteria | 1037 |
| 441 | Ga0501042_0543946 | 3300049578 | Bacteria | 844 |
| 442 | Ga0501043_0007575 | 3300049579 | Bacteria | 8605 |
| 443 | Ga0501043_0123349 | 3300049579 | Bacteria | 2032 |
| 444 | Ga0501043_0239999 | 3300049579 | Bacteria | 1398 |
| 445 | Ga0501046_0003327 | 3300049580 | Bacteria | 14777 |
| 446 | Ga0501046_0045838 | 3300049580 | Bacteria | 3471 |
| 447 | Ga0501046_0057870 | 3300049580 | Bacteria | 3040 |
| 448 | Ga0501047_0036663 | 3300049581 | Bacteria | 4740 |
| 449 | Ga0501048_0032779 | 3300049582 | Bacteria | 3754 |
| 450 | Ga0501048_0053282 | 3300049582 | Bacteria | 2878 |
| 451 | Ga0501048_0352102 | 3300049582 | Bacteria | 1050 |
| 452 | Ga0501068_0305730 | 3300049584 | Bacteria | 1018 |
| 453 | Ga0501068_0591921 | 3300049584 | Bacteria | 722 |
| 454 | Ga0501069_0273398 | 3300049585 | Bacteria | 988 |
| 455 | Ga0501070_0012503 | 3300049586 | Bacteria | 7160 |
| 456 | Ga0501071_0003199 | 3300049587 | Bacteria | 10200 |
| 457 | Ga0501071_0242156 | 3300049587 | Bacteria | 1360 |
| 458 | Ga0501071_0245031 | 3300049587 | Bacteria | 1352 |
| 459 | Ga0501071_0992479 | 3300049587 | Bacteria | 648 |
| 460 | Ga0501072_0020103 | 3300049588 | Bacteria | 5170 |
| 461 | Ga0501072_0043357 | 3300049588 | Bacteria | 3536 |
| 462 | Ga0501072_0053110 | 3300049588 | Bacteria | 3191 |
| 463 | Ga0501072_0058598 | 3300049588 | Bacteria | 3035 |
| 464 | Ga0501072_0453098 | 3300049588 | Bacteria | 1016 |
| 465 | Ga0501073_0056780 | 3300049589 | Bacteria | 2738 |
| 466 | Ga0501073_0158154 | 3300049589 | Bacteria | 1570 |
| 467 | Ga0501073_0349454 | 3300049589 | Bacteria | 1021 |
| 468 | Ga0501074_0024589 | 3300049590 | Bacteria | 4377 |
| 469 | Ga0501074_0041328 | 3300049590 | Bacteria | 3339 |
| 470 | Ga0501074_0482654 | 3300049590 | Bacteria | 878 |
| 471 | Ga0501075_0002051 | 3300049591 | Bacteria | 13334 |
| 472 | Ga0501075_0020908 | 3300049591 | Bacteria | 4767 |
| 473 | Ga0501075_0093631 | 3300049591 | Bacteria | 2281 |
| 474 | Ga0501075_0243164 | 3300049591 | Bacteria | 1372 |
| 475 | Ga0501075_0248818 | 3300049591 | Bacteria | 1355 |
| 476 | Ga0501076_0002867 | 3300049592 | Bacteria | 11935 |
| 477 | Ga0501076_0020590 | 3300049592 | Bacteria | 5049 |
| 478 | Ga0501076_0025702 | 3300049592 | Bacteria | 4559 |
| 479 | Ga0501076_0356519 | 3300049592 | Bacteria | 1201 |
| 480 | Ga0501076_0712571 | 3300049592 | Bacteria | 828 |
| 481 | Ga0501077_0000443 | 3300049593 | Bacteria | 25079 |
| 482 | Ga0501077_0037025 | 3300049593 | Bacteria | 3108 |
| 483 | Ga0501077_0492428 | 3300049593 | Bacteria | 786 |
| 484 | Ga0501079_0000827 | 3300049741 | Bacteria | 21030 |
| 485 | Ga0501079_0002756 | 3300049741 | Bacteria | 12808 |
| 486 | Ga0501079_0050908 | 3300049741 | Bacteria | 3196 |
| 487 | Ga0501079_0121363 | 3300049741 | Bacteria | 2033 |
| 488 | Ga0501079_0431575 | 3300049741 | Bacteria | 1034 |
| 489 | Ga0501079_0717128 | 3300049741 | Bacteria | 787 |
| 490 | Ga0501080_0000692 | 3300049742 | Bacteria | 27042 |
| 491 | Ga0501080_0042781 | 3300049742 | Bacteria | 4217 |
| 492 | Ga0501080_0169487 | 3300049742 | Bacteria | 2014 |
| 493 | Ga0501080_0281456 | 3300049742 | Bacteria | 1512 |
| 494 | Ga0501080_0812180 | 3300049742 | Bacteria | 820 |
| 495 | Ga0501081_0001598 | 3300049743 | Bacteria | 13983 |
| 496 | Ga0501081_0039707 | 3300049743 | Bacteria | 3222 |
| 497 | Ga0501081_0068203 | 3300049743 | Bacteria | 2476 |
| 498 | Ga0501081_0168109 | 3300049743 | Bacteria | 1582 |
| 499 | Ga0501083_0033389 | 3300049744 | Bacteria | 3524 |
| 500 | Ga0501083_0187571 | 3300049744 | Bacteria | 1350 |
| 501 | Ga0501035_0013485 | 3300049822 | Bacteria | 7544 |
| 502 | Ga0501035_0115279 | 3300049822 | Bacteria | 2352 |
| 503 | Ga0501035_0617050 | 3300049822 | Bacteria | 882 |
| 504 | Ga0501044_0074090 | 3300049823 | Bacteria | 3460 |
| 505 | Ga0501044_0699929 | 3300049823 | Bacteria | 899 |
| 506 | Ga0501045_0018274 | 3300049824 | Bacteria | 4986 |
| 507 | Ga0501045_0064364 | 3300049824 | Bacteria | 2691 |
| 508 | nmdc:mga05p37_128747_c1 | 3300050507 | Bacteria | 3107 |
| 509 | nmdc:mga05p37_15060_c1 | 3300050507 | Bacteria | 9285 |
| 510 | nmdc:mga05p37_291_c1 | 3300050507 | Bacteria | 52424 |
| 511 | nmdc:mga05p37_732274_c1 | 3300050507 | Bacteria | 1093 |
| 512 | nmdc:mga09592_124522_c1 | 3300050508 | Bacteria | 2215 |
| 513 | nmdc:mga09592_2325_c1 | 3300050508 | Bacteria | 15340 |
| 514 | nmdc:mga09592_355891_c1 | 3300050508 | Bacteria | 1267 |
| 515 | nmdc:mga09592_88_c1 | 3300050508 | Bacteria | 54764 |
| 516 | nmdc:mga0qj67_243665_c1 | 3300050509 | Bacteria | 1458 |
| 517 | nmdc:mga06r32_3835_c1 | 3300050510 | Bacteria | 13451 |
| 518 | nmdc:mga06r32_90108_c1 | 3300050510 | Bacteria | 2995 |
| 519 | nmdc:mga08y16_1707_c1 | 3300050511 | Bacteria | 22276 |
| 520 | nmdc:mga08y16_232561_c1 | 3300050511 | Bacteria | 1906 |
| 521 | nmdc:mga08y16_29646_c1 | 3300050511 | Bacteria | 5762 |
| 522 | nmdc:mga08y16_299390_c1 | 3300050511 | Bacteria | 1658 |
| 523 | nmdc:mga08y16_32909_c1 | 3300050511 | Bacteria | 5449 |
| 524 | nmdc:mga0n895_127974_c1 | 3300050512 | Bacteria | 2564 |
| 525 | nmdc:mga0n895_333_c1 | 3300050512 | Bacteria | 31507 |
| 526 | nmdc:mga0rr50_4041_c1 | 3300050513 | Bacteria | 8561 |
| 527 | nmdc:mga0rr50_569_c1 | 3300050513 | Bacteria | 19810 |
| 528 | nmdc:mga0rr50_59239_c1 | 3300050513 | Bacteria | 2874 |
| 529 | nmdc:mga0rr50_68912_c1 | 3300050513 | Bacteria | 1582 |
| 530 | nmdc:mga08x19_1192_c1 | 3300050514 | Bacteria | 16244 |
| 531 | nmdc:mga08x19_260393_c1 | 3300050514 | Bacteria | 1199 |
| 532 | nmdc:mga08x19_28528_c1 | 3300050514 | Bacteria | 3496 |
| 533 | nmdc:mga0a205_13415_c1 | 3300050515 | Bacteria | 7629 |
| 534 | nmdc:mga0a205_188_c1 | 3300050515 | Bacteria | 30684 |
| 535 | nmdc:mga0a205_1994_c1 | 3300050515 | Bacteria | 17784 |
| 536 | nmdc:mga0a205_56872_c1 | 3300050515 | Bacteria | 3776 |
| 537 | Ga0501084_0002718 | 3300054114 | Bacteria | 14257 |
| 538 | Ga0501084_0125888 | 3300054114 | Bacteria | 2156 |
| 539 | Ga0501084_1200137 | 3300054114 | Bacteria | 636 |
| 540 | Ga0590074_048058 | 3300059423 | Bacteria | 777 |
| 541 | Ga0590077_018187 | 3300059426 | Bacteria | 1483 |
| 542 | Ga0501082_0018622 | 3300060353 | Bacteria | 5984 |
| 543 | Ga0501082_0096533 | 3300060353 | Bacteria | 2555 |
| 544 | Ga0501082_0496108 | 3300060353 | Bacteria | 1067 |
| 545 | Ga0530510_0002712 | 3300061734 | Bacteria | 12180 |
| 546 | Ga0530510_0004302 | 3300061734 | Bacteria | 9853 |
| 547 | Ga0530510_0322704 | 3300061734 | Bacteria | 1158 |
| 548 | Ga0530510_0742737 | 3300061734 | Bacteria | 748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005343 | Ga0070687_100337491 | Ga0070687_1003374912 | 165 |
| 2 | 3300005438 | Ga0070701_10113890 | Ga0070701_101138903 | 165 |
| 3 | 3300005440 | Ga0070705_100227540 | Ga0070705_1002275402 | 165 |
| 4 | 3300005441 | Ga0070700_100123244 | Ga0070700_1001232443 | 165 |
| 5 | 3300005444 | Ga0070694_100317230 | Ga0070694_1003172302 | 165 |
| 6 | 3300005444 | Ga0070694_100348439 | Ga0070694_1003484391 | 165 |
| 7 | 3300005444 | Ga0070694_100362641 | Ga0070694_1003626412 | 165 |
| 8 | 3300005545 | Ga0070695_100418541 | Ga0070695_1004185411 | 165 |
| 9 | 3300005549 | Ga0070704_100034199 | Ga0070704_1000341993 | 165 |
| 10 | 3300005549 | Ga0070704_100038185 | Ga0070704_1000381854 | 165 |
| 11 | 3300005617 | Ga0068859_100021439 | Ga0068859_1000214396 | 165 |
| 12 | 3300005843 | Ga0068860_101286146 | Ga0068860_1012861462 | 165 |
| 13 | 3300006847 | Ga0075431_100078193 | Ga0075431_1000781932 | 165 |
| 14 | 3300006931 | Ga0097620_100021438 | Ga0097620_1000214386 | 165 |
| 15 | 3300009094 | Ga0111539_10014451 | Ga0111539_100144515 | 165 |
| 16 | 3300009094 | Ga0111539_10354926 | Ga0111539_103549262 | 165 |
| 17 | 3300009553 | Ga0105249_10632325 | Ga0105249_106323252 | 165 |
| 18 | 3300025918 | Ga0207662_10613712 | Ga0207662_106137121 | 165 |
| 19 | 3300026035 | Ga0207703_10627800 | Ga0207703_106278001 | 165 |
| 20 | 3300026075 | Ga0207708_10149729 | Ga0207708_101497292 | 165 |
| 21 | 3300027462 | Ga0210000_1049226 | Ga0210000_10492261 | 165 |
| 22 | 3300027682 | Ga0209971_1079695 | Ga0209971_10796952 | 165 |
| 23 | 3300027907 | Ga0207428_10076276 | Ga0207428_100762764 | 165 |
| 24 | 3300035115 | Ga0373941_0169457 | Ga0373941_0169457_26_571 | 165 |
| 25 | 3300050511 | nmdc:mga08y16_29646_c1 | nmdc:mga08y16_29646_c1_162_707 | 165 |
| 26 | 3300050511 | nmdc:mga08y16_299390_c1 | nmdc:mga08y16_299390_c1_562_1107 | 165 |
| 27 | 3300050515 | nmdc:mga0a205_56872_c1 | nmdc:mga0a205_56872_c1_1290_1835 | 165 |
| 28 | 3300049588 | Ga0501072_0453098 | Ga0501072_0453098_11_511 | 166 |
| 29 | 3300005471 | Ga0070698_100066546 | Ga0070698_1000665465 | 167 |
| 30 | 3300006844 | Ga0075428_100061299 | Ga0075428_1000612995 | 167 |
| 31 | 3300006847 | Ga0075431_100003037 | Ga0075431_1000030378 | 167 |
| 32 | 3300006880 | Ga0075429_100000018 | Ga0075429_10000001857 | 167 |
| 33 | 3300009094 | Ga0111539_10561441 | Ga0111539_105614413 | 167 |
| 34 | 3300009147 | Ga0114129_10010633 | Ga0114129_100106333 | 167 |
| 35 | 3300014745 | Ga0157377_10556328 | Ga0157377_105563281 | 167 |
| 36 | 3300025924 | Ga0207694_10151451 | Ga0207694_101514512 | 167 |
| 37 | 3300049576 | Ga0501040_0466770 | Ga0501040_0466770_372_896 | 167 |
| 38 | 3300050507 | nmdc:mga05p37_291_c1 | nmdc:mga05p37_291_c1_20206_20751 | 167 |
| 39 | 3300050508 | nmdc:mga09592_88_c1 | nmdc:mga09592_88_c1_5402_5947 | 167 |
| 40 | 3300050510 | nmdc:mga06r32_3835_c1 | nmdc:mga06r32_3835_c1_4766_5311 | 167 |
| 41 | 3300005331 | Ga0070670_100021506 | Ga0070670_1000215064 | 168 |
| 42 | 3300005367 | Ga0070667_100154591 | Ga0070667_1001545912 | 168 |
| 43 | 3300005617 | Ga0068859_100917765 | Ga0068859_1009177652 | 168 |
| 44 | 3300006931 | Ga0097620_100917822 | Ga0097620_1009178222 | 168 |
| 45 | 3300035118 | Ga0373954_0000013 | Ga0373954_0000013_64779_65339 | 168 |
| 46 | 3300035172 | Ga0373955_0014316 | Ga0373955_0014316_1954_2514 | 168 |
| 47 | 3300035724 | Ga0373933_0031736 | Ga0373933_0031736_94_654 | 168 |
| 48 | 3300046536 | Ga0495587_0351605 | Ga0495587_0351605_214_774 | 168 |
| 49 | 3300046664 | Ga0495659_0016723 | Ga0495659_0016723_496_1002 | 168 |
| 50 | 3300048088 | Ga0495602_0609749 | Ga0495602_0609749_163_723 | 168 |
| 51 | 3300049589 | Ga0501073_0349454 | Ga0501073_0349454_502_1008 | 168 |
| 52 | 3300002244 | JGI24742J22300_10021375 | JGI24742J22300_100213752 | 169 |
| 53 | 3300005330 | Ga0070690_100000335 | Ga0070690_1000003359 | 169 |
| 54 | 3300005334 | Ga0068869_100001158 | Ga0068869_1000011589 | 169 |
| 55 | 3300005335 | Ga0070666_10201882 | Ga0070666_102018822 | 169 |
| 56 | 3300005336 | Ga0070680_100001369 | Ga0070680_1000013692 | 169 |
| 57 | 3300005338 | Ga0068868_100000378 | Ga0068868_1000003789 | 169 |
| 58 | 3300005338 | Ga0068868_100242264 | Ga0068868_1002422642 | 169 |
| 59 | 3300005341 | Ga0070691_10255978 | Ga0070691_102559782 | 169 |
| 60 | 3300005343 | Ga0070687_100000353 | Ga0070687_10000035313 | 169 |
| 61 | 3300005345 | Ga0070692_10003721 | Ga0070692_100037219 | 169 |
| 62 | 3300005345 | Ga0070692_10151507 | Ga0070692_101515072 | 169 |
| 63 | 3300005347 | Ga0070668_100017930 | Ga0070668_1000179305 | 169 |
| 64 | 3300005355 | Ga0070671_100321467 | Ga0070671_1003214672 | 169 |
| 65 | 3300005364 | Ga0070673_100205804 | Ga0070673_1002058041 | 169 |
| 66 | 3300005367 | Ga0070667_100075953 | Ga0070667_1000759532 | 169 |
| 67 | 3300005406 | Ga0070703_10006589 | Ga0070703_100065892 | 169 |
| 68 | 3300005438 | Ga0070701_10000027 | Ga0070701_1000002714 | 169 |
| 69 | 3300005439 | Ga0070711_100598316 | Ga0070711_1005983162 | 169 |
| 70 | 3300005440 | Ga0070705_100000061 | Ga0070705_10000006121 | 169 |
| 71 | 3300005441 | Ga0070700_100000386 | Ga0070700_1000003869 | 169 |
| 72 | 3300005441 | Ga0070700_100772742 | Ga0070700_1007727421 | 169 |
| 73 | 3300005444 | Ga0070694_100000096 | Ga0070694_10000009614 | 169 |
| 74 | 3300005444 | Ga0070694_100263250 | Ga0070694_1002632502 | 169 |
| 75 | 3300005455 | Ga0070663_100053485 | Ga0070663_1000534852 | 169 |
| 76 | 3300005456 | Ga0070678_100156833 | Ga0070678_1001568332 | 169 |
| 77 | 3300005456 | Ga0070678_100175610 | Ga0070678_1001756102 | 169 |
| 78 | 3300005457 | Ga0070662_100252742 | Ga0070662_1002527422 | 169 |
| 79 | 3300005457 | Ga0070662_100737412 | Ga0070662_1007374121 | 169 |
| 80 | 3300005458 | Ga0070681_10032716 | Ga0070681_100327163 | 169 |
| 81 | 3300005459 | Ga0068867_100001399 | Ga0068867_1000013998 | 169 |
| 82 | 3300005459 | Ga0068867_100039342 | Ga0068867_1000393422 | 169 |
| 83 | 3300005530 | Ga0070679_100030156 | Ga0070679_1000301563 | 169 |
| 84 | 3300005539 | Ga0068853_100032789 | Ga0068853_1000327893 | 169 |
| 85 | 3300005543 | Ga0070672_100035396 | Ga0070672_1000353962 | 169 |
| 86 | 3300005544 | Ga0070686_100001578 | Ga0070686_1000015785 | 169 |
| 87 | 3300005545 | Ga0070695_100000965 | Ga0070695_10000096511 | 169 |
| 88 | 3300005546 | Ga0070696_100000560 | Ga0070696_10000056014 | 169 |
| 89 | 3300005547 | Ga0070693_100000003 | Ga0070693_10000000359 | 169 |
| 90 | 3300005549 | Ga0070704_100000504 | Ga0070704_10000050412 | 169 |
| 91 | 3300005549 | Ga0070704_100699372 | Ga0070704_1006993721 | 169 |
| 92 | 3300005563 | Ga0068855_100005492 | Ga0068855_1000054926 | 169 |
| 93 | 3300005578 | Ga0068854_100003450 | Ga0068854_1000034509 | 169 |
| 94 | 3300005615 | Ga0070702_100000004 | Ga0070702_10000000455 | 169 |
| 95 | 3300005616 | Ga0068852_100037238 | Ga0068852_1000372382 | 169 |
| 96 | 3300005617 | Ga0068859_100002292 | Ga0068859_10000229216 | 169 |
| 97 | 3300005718 | Ga0068866_10000342 | Ga0068866_1000034219 | 169 |
| 98 | 3300005719 | Ga0068861_100001170 | Ga0068861_1000011709 | 169 |
| 99 | 3300005840 | Ga0068870_10004636 | Ga0068870_100046362 | 169 |
| 100 | 3300005842 | Ga0068858_100002734 | Ga0068858_10000273414 | 169 |
| 101 | 3300005843 | Ga0068860_100002098 | Ga0068860_1000020989 | 169 |
| 102 | 3300005843 | Ga0068860_100389607 | Ga0068860_1003896072 | 169 |
| 103 | 3300005844 | Ga0068862_100001419 | Ga0068862_1000014195 | 169 |
| 104 | 3300006237 | Ga0097621_100000024 | Ga0097621_1000000243 | 169 |
| 105 | 3300006237 | Ga0097621_100659538 | Ga0097621_1006595382 | 169 |
| 106 | 3300006358 | Ga0068871_100002217 | Ga0068871_1000022178 | 169 |
| 107 | 3300006358 | Ga0068871_100459946 | Ga0068871_1004599462 | 169 |
| 108 | 3300006881 | Ga0068865_100000417 | Ga0068865_1000004178 | 169 |
| 109 | 3300006931 | Ga0097620_100002292 | Ga0097620_10000229216 | 169 |
| 110 | 3300009098 | Ga0105245_10001245 | Ga0105245_100012452 | 169 |
| 111 | 3300009176 | Ga0105242_10000346 | Ga0105242_1000034625 | 169 |
| 112 | 3300009177 | Ga0105248_10212527 | Ga0105248_102125272 | 169 |
| 113 | 3300012476 | Ga0157344_1009928 | Ga0157344_10099281 | 169 |
| 114 | 3300013306 | Ga0163162_10233824 | Ga0163162_102338242 | 169 |
| 115 | 3300014326 | Ga0157380_10007200 | Ga0157380_100072005 | 169 |
| 116 | 3300014745 | Ga0157377_10219906 | Ga0157377_102199063 | 169 |
| 117 | 3300025885 | Ga0207653_10008181 | Ga0207653_100081815 | 169 |
| 118 | 3300025899 | Ga0207642_10001562 | Ga0207642_100015629 | 169 |
| 119 | 3300025908 | Ga0207643_10022819 | Ga0207643_100228193 | 169 |
| 120 | 3300025912 | Ga0207707_10026336 | Ga0207707_100263366 | 169 |
| 121 | 3300025917 | Ga0207660_10006379 | Ga0207660_100063793 | 169 |
| 122 | 3300025917 | Ga0207660_10084472 | Ga0207660_100844722 | 169 |
| 123 | 3300025918 | Ga0207662_10000653 | Ga0207662_1000065313 | 169 |
| 124 | 3300025921 | Ga0207652_10017093 | Ga0207652_100170937 | 169 |
| 125 | 3300025927 | Ga0207687_10000454 | Ga0207687_100004549 | 169 |
| 126 | 3300025931 | Ga0207644_10371029 | Ga0207644_103710291 | 169 |
| 127 | 3300025933 | Ga0207706_10036461 | Ga0207706_100364614 | 169 |
| 128 | 3300025934 | Ga0207686_10000806 | Ga0207686_100008065 | 169 |
| 129 | 3300025935 | Ga0207709_10000297 | Ga0207709_1000029722 | 169 |
| 130 | 3300025936 | Ga0207670_10000590 | Ga0207670_1000059012 | 169 |
| 131 | 3300025938 | Ga0207704_10000251 | Ga0207704_100002513 | 169 |
| 132 | 3300025940 | Ga0207691_10013055 | Ga0207691_100130556 | 169 |
| 133 | 3300025942 | Ga0207689_10000103 | Ga0207689_1000010319 | 169 |
| 134 | 3300025949 | Ga0207667_10007221 | Ga0207667_1000722112 | 169 |
| 135 | 3300025960 | Ga0207651_10162940 | Ga0207651_101629402 | 169 |
| 136 | 3300025961 | Ga0207712_10007693 | Ga0207712_100076939 | 169 |
| 137 | 3300025972 | Ga0207668_10542192 | Ga0207668_105421922 | 169 |
| 138 | 3300025981 | Ga0207640_10003140 | Ga0207640_1000314010 | 169 |
| 139 | 3300026023 | Ga0207677_10000533 | Ga0207677_100005339 | 169 |
| 140 | 3300026035 | Ga0207703_10000898 | Ga0207703_1000089821 | 169 |
| 141 | 3300026041 | Ga0207639_10086040 | Ga0207639_100860402 | 169 |
| 142 | 3300026075 | Ga0207708_10000048 | Ga0207708_1000004873 | 169 |
| 143 | 3300026075 | Ga0207708_10877416 | Ga0207708_108774162 | 169 |
| 144 | 3300026088 | Ga0207641_10201148 | Ga0207641_102011483 | 169 |
| 145 | 3300026089 | Ga0207648_10001181 | Ga0207648_1000118119 | 169 |
| 146 | 3300026089 | Ga0207648_10325132 | Ga0207648_103251322 | 169 |
| 147 | 3300026118 | Ga0207675_100000593 | Ga0207675_10000059332 | 169 |
| 148 | 3300026121 | Ga0207683_10045055 | Ga0207683_100450555 | 169 |
| 149 | 3300026121 | Ga0207683_10238169 | Ga0207683_102381692 | 169 |
| 150 | 3300026142 | Ga0207698_10129826 | Ga0207698_101298263 | 169 |
| 151 | 3300028379 | Ga0268266_10229121 | Ga0268266_102291212 | 169 |
| 152 | 3300028380 | Ga0268265_10001097 | Ga0268265_1000109711 | 169 |
| 153 | 3300028381 | Ga0268264_10001229 | Ga0268264_1000122921 | 169 |
| 154 | 3300028381 | Ga0268264_10477935 | Ga0268264_104779352 | 169 |
| 155 | 3300028666 | Ga0265336_10001259 | Ga0265336_100012596 | 169 |
| 156 | 3300029957 | Ga0265324_10000006 | Ga0265324_10000006164 | 169 |
| 157 | 3300029957 | Ga0265324_10153637 | Ga0265324_101536372 | 169 |
| 158 | 3300031241 | Ga0265325_10000110 | Ga0265325_1000011053 | 169 |
| 159 | 3300031665 | Ga0316575_10000027 | Ga0316575_1000002728 | 169 |
| 160 | 3300031711 | Ga0265314_10044054 | Ga0265314_100440542 | 169 |
| 161 | 3300031911 | Ga0307412_10346285 | Ga0307412_103462852 | 169 |
| 162 | 3300035119 | Ga0373956_0444363 | Ga0373956_0444363_29_538 | 169 |
| 163 | 3300035121 | Ga0373960_0145145 | Ga0373960_0145145_269_778 | 169 |
| 164 | 3300042876 | Ga0451577_0002897 | Ga0451577_0002897_12173_12694 | 169 |
| 165 | 3300042876 | Ga0451577_0053947 | Ga0451577_0053947_487_996 | 169 |
| 166 | 3300049584 | Ga0501068_0591921 | Ga0501068_0591921_16_525 | 169 |
| 167 | 3300049742 | Ga0501080_0812180 | Ga0501080_0812180_296_805 | 169 |
| 168 | 3300014326 | Ga0157380_10393396 | Ga0157380_103933962 | 170 |
| 169 | 3300032002 | Ga0307416_101083174 | Ga0307416_1010831742 | 172 |
| 170 | 3300005440 | Ga0070705_100026329 | Ga0070705_1000263293 | 173 |
| 171 | 3300031995 | Ga0307409_101355300 | Ga0307409_1013553002 | 173 |
| 172 | 3300005545 | Ga0070695_100036956 | Ga0070695_1000369563 | 174 |
| 173 | 3300005546 | Ga0070696_100103355 | Ga0070696_1001033552 | 174 |
| 174 | 3300005549 | Ga0070704_100056791 | Ga0070704_1000567915 | 174 |
| 175 | 3300035115 | Ga0373941_0008866 | Ga0373941_0008866_37_564 | 175 |
| 176 | iso_pu_bacteria | 2846037992 | 2846041043 | 177 |
| 177 | iso_pu_bacteria | 2998344455 | 2998347311 | 177 |
| 178 | 3300005339 | Ga0070660_100158284 | Ga0070660_1001582842 | 178 |
| 179 | 3300005366 | Ga0070659_100099548 | Ga0070659_1000995482 | 178 |
| 180 | 3300005577 | Ga0068857_100205536 | Ga0068857_1002055362 | 179 |
| 181 | 3300006844 | Ga0075428_100023622 | Ga0075428_1000236222 | 179 |
| 182 | 3300007076 | Ga0075435_100004636 | Ga0075435_1000046362 | 179 |
| 183 | 3300009094 | Ga0111539_10105719 | Ga0111539_101057193 | 179 |
| 184 | 3300009094 | Ga0111539_10262662 | Ga0111539_102626622 | 179 |
| 185 | 3300009147 | Ga0114129_10111438 | Ga0114129_101114383 | 179 |
| 186 | 3300014326 | Ga0157380_10006145 | Ga0157380_100061452 | 179 |
| 187 | 3300026116 | Ga0207674_10226051 | Ga0207674_102260512 | 179 |
| 188 | 3300027907 | Ga0207428_10322976 | Ga0207428_103229761 | 179 |
| 189 | 3300031665 | Ga0316575_10001046 | Ga0316575_100010466 | 179 |
| 190 | 3300031665 | Ga0316575_10132663 | Ga0316575_101326631 | 179 |
| 191 | 3300031691 | Ga0316579_10002999 | Ga0316579_100029995 | 179 |
| 192 | 3300031691 | Ga0316579_10146874 | Ga0316579_101468742 | 179 |
| 193 | 3300031727 | Ga0316576_10001219 | Ga0316576_100012196 | 179 |
| 194 | 3300031727 | Ga0316576_10001522 | Ga0316576_100015226 | 179 |
| 195 | 3300031727 | Ga0316576_10246508 | Ga0316576_102465082 | 179 |
| 196 | 3300031727 | Ga0316576_10412973 | Ga0316576_104129732 | 179 |
| 197 | 3300031727 | Ga0316576_10465449 | Ga0316576_104654492 | 179 |
| 198 | 3300031727 | Ga0316576_10633651 | Ga0316576_106336511 | 179 |
| 199 | 3300031728 | Ga0316578_10008889 | Ga0316578_100088898 | 179 |
| 200 | 3300031728 | Ga0316578_10138349 | Ga0316578_101383492 | 179 |
| 201 | 3300031728 | Ga0316578_10229127 | Ga0316578_102291272 | 179 |
| 202 | 3300031728 | Ga0316578_10305627 | Ga0316578_103056271 | 179 |
| 203 | 3300031733 | Ga0316577_10000993 | Ga0316577_100009936 | 179 |
| 204 | 3300031733 | Ga0316577_10003659 | Ga0316577_100036598 | 179 |
| 205 | 3300031733 | Ga0316577_10050280 | Ga0316577_100502802 | 179 |
| 206 | 3300031733 | Ga0316577_10094392 | Ga0316577_100943922 | 179 |
| 207 | 3300032133 | Ga0316583_10008512 | Ga0316583_100085122 | 179 |
| 208 | 3300032137 | Ga0316585_10002191 | Ga0316585_100021917 | 179 |
| 209 | 3300032137 | Ga0316585_10018515 | Ga0316585_100185152 | 179 |
| 210 | 3300032139 | Ga0316580_10000494 | Ga0316580_100004949 | 179 |
| 211 | 3300032168 | Ga0316593_10013132 | Ga0316593_100131322 | 179 |
| 212 | 3300032168 | Ga0316593_10250246 | Ga0316593_102502461 | 179 |
| 213 | 3300033524 | Ga0316592_1001349 | Ga0316592_10013494 | 179 |
| 214 | 3300033524 | Ga0316592_1003844 | Ga0316592_10038441 | 179 |
| 215 | 3300033527 | Ga0316586_1001181 | Ga0316586_10011813 | 179 |
| 216 | 3300033528 | Ga0316588_1000401 | Ga0316588_10004015 | 179 |
| 217 | 3300033528 | Ga0316588_1083550 | Ga0316588_10835501 | 179 |
| 218 | 3300033541 | Ga0316596_1002912 | Ga0316596_10029125 | 179 |
| 219 | 3300033541 | Ga0316596_1003215 | Ga0316596_10032153 | 179 |
| 220 | 3300035398 | Ga0316574_0078623 | Ga0316574_0078623_1296_1847 | 179 |
| 221 | 3300036647 | Ga0316582_0000206 | Ga0316582_0000206_12772_13317 | 179 |
| 222 | 3300036647 | Ga0316582_0019895 | Ga0316582_0019895_418_969 | 179 |
| 223 | 3300036647 | Ga0316582_0252662 | Ga0316582_0252662_463_1011 | 179 |
| 224 | 3300036712 | Ga0316584_0005625 | Ga0316584_0005625_285_833 | 179 |
| 225 | 3300036712 | Ga0316584_0007251 | Ga0316584_0007251_5379_5921 | 179 |
| 226 | 3300036712 | Ga0316584_0014866 | Ga0316584_0014866_1875_2420 | 179 |
| 227 | 3300036712 | Ga0316584_0061821 | Ga0316584_0061821_1335_1880 | 179 |
| 228 | 3300036712 | Ga0316584_0091946 | Ga0316584_0091946_108_659 | 179 |
| 229 | 3300042121 | Ga0450919_008840 | Ga0450919_008840_422_982 | 179 |
| 230 | 3300042122 | Ga0450920_024462 | Ga0450920_024462_547_1113 | 179 |
| 231 | 3300042125 | Ga0450923_000777 | Ga0450923_000777_720_1286 | 179 |
| 232 | 3300042127 | Ga0450890_016187 | Ga0450890_016187_157_720 | 179 |
| 233 | 3300042131 | Ga0450894_005040 | Ga0450894_005040_1078_1644 | 179 |
| 234 | 3300042146 | Ga0450907_012001 | Ga0450907_012001_109_675 | 179 |
| 235 | 3300042146 | Ga0450907_035563 | Ga0450907_035563_134_694 | 179 |
| 236 | 3300042184 | Ga0450908_003350 | Ga0450908_003350_299_865 | 179 |
| 237 | 3300049575 | Ga0501039_0140514 | Ga0501039_0140514_523_1086 | 179 |
| 238 | 3300049578 | Ga0501042_0369925 | Ga0501042_0369925_150_713 | 179 |
| 239 | 3300050513 | nmdc:mga0rr50_68912_c1 | nmdc:mga0rr50_68912_c1_431_994 | 179 |
| 240 | 3300050515 | nmdc:mga0a205_188_c1 | nmdc:mga0a205_188_c1_11314_11877 | 179 |
| 241 | 3300005548 | Ga0070665_100775083 | Ga0070665_1007750832 | 180 |
| 242 | 3300009093 | Ga0105240_10032705 | Ga0105240_100327057 | 180 |
| 243 | 3300009545 | Ga0105237_10084351 | Ga0105237_100843512 | 180 |
| 244 | 3300013306 | Ga0163162_11417460 | Ga0163162_114174601 | 180 |
| 245 | 3300025913 | Ga0207695_10155922 | Ga0207695_101559222 | 180 |
| 246 | 3300025914 | Ga0207671_10267220 | Ga0207671_102672202 | 180 |
| 247 | 3300026041 | Ga0207639_10107052 | Ga0207639_101070522 | 180 |
| 248 | 3300028380 | Ga0268265_10803491 | Ga0268265_108034911 | 180 |
| 249 | 3300044673 | Ga0453683_0624084 | Ga0453683_0624084_65_607 | 180 |
| 250 | 3300049570 | Ga0501033_0339895 | Ga0501033_0339895_243_785 | 180 |
| 251 | 3300049572 | Ga0501036_0035298 | Ga0501036_0035298_3373_3915 | 180 |
| 252 | 3300049573 | Ga0501037_0337153 | Ga0501037_0337153_148_690 | 180 |
| 253 | 3300049574 | Ga0501038_0099114 | Ga0501038_0099114_299_841 | 180 |
| 254 | 3300049576 | Ga0501040_0004980 | Ga0501040_0004980_435_977 | 180 |
| 255 | 3300049576 | Ga0501040_0508868 | Ga0501040_0508868_201_743 | 180 |
| 256 | 3300049577 | Ga0501041_0009824 | Ga0501041_0009824_1601_2143 | 180 |
| 257 | 3300049577 | Ga0501041_0293288 | Ga0501041_0293288_459_1001 | 180 |
| 258 | 3300049578 | Ga0501042_0070834 | Ga0501042_0070834_376_918 | 180 |
| 259 | 3300049578 | Ga0501042_0543946 | Ga0501042_0543946_184_726 | 180 |
| 260 | 3300049579 | Ga0501043_0123349 | Ga0501043_0123349_1088_1630 | 180 |
| 261 | 3300049579 | Ga0501043_0239999 | Ga0501043_0239999_271_813 | 180 |
| 262 | 3300049580 | Ga0501046_0057870 | Ga0501046_0057870_863_1405 | 180 |
| 263 | 3300049581 | Ga0501047_0036663 | Ga0501047_0036663_314_856 | 180 |
| 264 | 3300049582 | Ga0501048_0032779 | Ga0501048_0032779_1612_2154 | 180 |
| 265 | 3300049584 | Ga0501068_0305730 | Ga0501068_0305730_80_622 | 180 |
| 266 | 3300049586 | Ga0501070_0012503 | Ga0501070_0012503_2706_3248 | 180 |
| 267 | 3300049588 | Ga0501072_0020103 | Ga0501072_0020103_1156_1698 | 180 |
| 268 | 3300049589 | Ga0501073_0056780 | Ga0501073_0056780_421_963 | 180 |
| 269 | 3300049590 | Ga0501074_0041328 | Ga0501074_0041328_1586_2128 | 180 |
| 270 | 3300049590 | Ga0501074_0482654 | Ga0501074_0482654_27_569 | 180 |
| 271 | 3300049591 | Ga0501075_0020908 | Ga0501075_0020908_3484_4026 | 180 |
| 272 | 3300049592 | Ga0501076_0020590 | Ga0501076_0020590_882_1424 | 180 |
| 273 | 3300049592 | Ga0501076_0356519 | Ga0501076_0356519_513_1055 | 180 |
| 274 | 3300049592 | Ga0501076_0712571 | Ga0501076_0712571_34_576 | 180 |
| 275 | 3300049593 | Ga0501077_0492428 | Ga0501077_0492428_199_741 | 180 |
| 276 | 3300049741 | Ga0501079_0002756 | Ga0501079_0002756_4910_5452 | 180 |
| 277 | 3300049741 | Ga0501079_0121363 | Ga0501079_0121363_1396_1938 | 180 |
| 278 | 3300049741 | Ga0501079_0431575 | Ga0501079_0431575_479_1021 | 180 |
| 279 | 3300049742 | Ga0501080_0042781 | Ga0501080_0042781_714_1256 | 180 |
| 280 | 3300049742 | Ga0501080_0281456 | Ga0501080_0281456_150_692 | 180 |
| 281 | 3300049743 | Ga0501081_0168109 | Ga0501081_0168109_921_1463 | 180 |
| 282 | 3300049744 | Ga0501083_0033389 | Ga0501083_0033389_2540_3082 | 180 |
| 283 | 3300049822 | Ga0501035_0115279 | Ga0501035_0115279_77_619 | 180 |
| 284 | 3300049822 | Ga0501035_0617050 | Ga0501035_0617050_101_643 | 180 |
| 285 | 3300049823 | Ga0501044_0699929 | Ga0501044_0699929_166_708 | 180 |
| 286 | 3300054114 | Ga0501084_0125888 | Ga0501084_0125888_336_878 | 180 |
| 287 | 3300054114 | Ga0501084_1200137 | Ga0501084_1200137_51_593 | 180 |
| 288 | 3300060353 | Ga0501082_0096533 | Ga0501082_0096533_588_1130 | 180 |
| 289 | 3300061734 | Ga0530510_0004302 | Ga0530510_0004302_4265_4807 | 180 |
| 290 | 3300005293 | Ga0065715_10791798 | Ga0065715_107917981 | 181 |
| 291 | 3300005295 | Ga0065707_10004016 | Ga0065707_100040164 | 181 |
| 292 | 3300005328 | Ga0070676_10176593 | Ga0070676_101765931 | 181 |
| 293 | 3300005330 | Ga0070690_100189099 | Ga0070690_1001890992 | 181 |
| 294 | 3300005331 | Ga0070670_100021978 | Ga0070670_1000219785 | 181 |
| 295 | 3300005331 | Ga0070670_100022354 | Ga0070670_1000223546 | 181 |
| 296 | 3300005331 | Ga0070670_100554055 | Ga0070670_1005540551 | 181 |
| 297 | 3300005336 | Ga0070680_100044326 | Ga0070680_1000443263 | 181 |
| 298 | 3300005340 | Ga0070689_100213174 | Ga0070689_1002131742 | 181 |
| 299 | 3300005347 | Ga0070668_100028612 | Ga0070668_1000286122 | 181 |
| 300 | 3300005347 | Ga0070668_100211002 | Ga0070668_1002110022 | 181 |
| 301 | 3300005354 | Ga0070675_100035578 | Ga0070675_1000355784 | 181 |
| 302 | 3300005356 | Ga0070674_100573491 | Ga0070674_1005734912 | 181 |
| 303 | 3300005364 | Ga0070673_100110107 | Ga0070673_1001101074 | 181 |
| 304 | 3300005365 | Ga0070688_100034314 | Ga0070688_1000343142 | 181 |
| 305 | 3300005440 | Ga0070705_100172034 | Ga0070705_1001720341 | 181 |
| 306 | 3300005440 | Ga0070705_100282480 | Ga0070705_1002824802 | 181 |
| 307 | 3300005440 | Ga0070705_100409054 | Ga0070705_1004090542 | 181 |
| 308 | 3300005444 | Ga0070694_100007671 | Ga0070694_1000076716 | 181 |
| 309 | 3300005458 | Ga0070681_10000372 | Ga0070681_1000037212 | 181 |
| 310 | 3300005459 | Ga0068867_100180993 | Ga0068867_1001809932 | 181 |
| 311 | 3300005459 | Ga0068867_100196166 | Ga0068867_1001961662 | 181 |
| 312 | 3300005518 | Ga0070699_100094917 | Ga0070699_1000949173 | 181 |
| 313 | 3300005536 | Ga0070697_100027227 | Ga0070697_1000272275 | 181 |
| 314 | 3300005543 | Ga0070672_101226629 | Ga0070672_1012266291 | 181 |
| 315 | 3300005544 | Ga0070686_100076937 | Ga0070686_1000769371 | 181 |
| 316 | 3300005545 | Ga0070695_100010236 | Ga0070695_1000102365 | 181 |
| 317 | 3300005545 | Ga0070695_100021715 | Ga0070695_1000217152 | 181 |
| 318 | 3300005546 | Ga0070696_100005584 | Ga0070696_1000055842 | 181 |
| 319 | 3300005546 | Ga0070696_100670226 | Ga0070696_1006702261 | 181 |
| 320 | 3300005548 | Ga0070665_100414560 | Ga0070665_1004145602 | 181 |
| 321 | 3300005549 | Ga0070704_100677403 | Ga0070704_1006774032 | 181 |
| 322 | 3300005617 | Ga0068859_100085987 | Ga0068859_1000859872 | 181 |
| 323 | 3300005618 | Ga0068864_100032992 | Ga0068864_1000329924 | 181 |
| 324 | 3300005618 | Ga0068864_100051810 | Ga0068864_1000518102 | 181 |
| 325 | 3300005618 | Ga0068864_100199350 | Ga0068864_1001993502 | 181 |
| 326 | 3300005719 | Ga0068861_100256670 | Ga0068861_1002566702 | 181 |
| 327 | 3300005834 | Ga0068851_10145136 | Ga0068851_101451362 | 181 |
| 328 | 3300005841 | Ga0068863_100471589 | Ga0068863_1004715892 | 181 |
| 329 | 3300005841 | Ga0068863_101240586 | Ga0068863_1012405861 | 181 |
| 330 | 3300005842 | Ga0068858_100288953 | Ga0068858_1002889532 | 181 |
| 331 | 3300005844 | Ga0068862_100007767 | Ga0068862_1000077676 | 181 |
| 332 | 3300006844 | Ga0075428_100004856 | Ga0075428_10000485618 | 181 |
| 333 | 3300006852 | Ga0075433_10002500 | Ga0075433_1000250015 | 181 |
| 334 | 3300006852 | Ga0075433_10030077 | Ga0075433_100300777 | 181 |
| 335 | 3300006852 | Ga0075433_10137140 | Ga0075433_101371401 | 181 |
| 336 | 3300006852 | Ga0075433_10677626 | Ga0075433_106776262 | 181 |
| 337 | 3300006871 | Ga0075434_100001724 | Ga0075434_10000172414 | 181 |
| 338 | 3300006871 | Ga0075434_100172137 | Ga0075434_1001721372 | 181 |
| 339 | 3300006871 | Ga0075434_100301160 | Ga0075434_1003011601 | 181 |
| 340 | 3300006880 | Ga0075429_100000496 | Ga0075429_1000004969 | 181 |
| 341 | 3300006914 | Ga0075436_100000142 | Ga0075436_10000014232 | 181 |
| 342 | 3300006914 | Ga0075436_100168868 | Ga0075436_1001688682 | 181 |
| 343 | 3300006931 | Ga0097620_100085985 | Ga0097620_1000859852 | 181 |
| 344 | 3300007076 | Ga0075435_100008441 | Ga0075435_1000084413 | 181 |
| 345 | 3300007076 | Ga0075435_100023958 | Ga0075435_1000239584 | 181 |
| 346 | 3300007265 | Ga0099794_10228772 | Ga0099794_102287722 | 181 |
| 347 | 3300009094 | Ga0111539_10028668 | Ga0111539_100286689 | 181 |
| 348 | 3300009094 | Ga0111539_10046437 | Ga0111539_100464375 | 181 |
| 349 | 3300009094 | Ga0111539_10128179 | Ga0111539_101281792 | 181 |
| 350 | 3300009094 | Ga0111539_10233688 | Ga0111539_102336882 | 181 |
| 351 | 3300009098 | Ga0105245_10529449 | Ga0105245_105294492 | 181 |
| 352 | 3300009147 | Ga0114129_10001872 | Ga0114129_1000187220 | 181 |
| 353 | 3300009147 | Ga0114129_10480138 | Ga0114129_104801383 | 181 |
| 354 | 3300009148 | Ga0105243_10000339 | Ga0105243_1000033914 | 181 |
| 355 | 3300009148 | Ga0105243_10489249 | Ga0105243_104892492 | 181 |
| 356 | 3300009174 | Ga0105241_10015808 | Ga0105241_100158084 | 181 |
| 357 | 3300009176 | Ga0105242_10006022 | Ga0105242_100060229 | 181 |
| 358 | 3300009553 | Ga0105249_10012564 | Ga0105249_100125643 | 181 |
| 359 | 3300010375 | Ga0105239_10817261 | Ga0105239_108172612 | 181 |
| 360 | 3300013297 | Ga0157378_10000192 | Ga0157378_1000019255 | 181 |
| 361 | 3300013306 | Ga0163162_10848988 | Ga0163162_108489882 | 181 |
| 362 | 3300013308 | Ga0157375_10159663 | Ga0157375_101596633 | 181 |
| 363 | 3300014326 | Ga0157380_10316039 | Ga0157380_103160392 | 181 |
| 364 | 3300014968 | Ga0157379_10107088 | Ga0157379_101070882 | 181 |
| 365 | 3300014969 | Ga0157376_10021789 | Ga0157376_100217893 | 181 |
| 366 | 3300025321 | Ga0207656_10006815 | Ga0207656_100068154 | 181 |
| 367 | 3300025898 | Ga0207692_10607292 | Ga0207692_106072922 | 181 |
| 368 | 3300025904 | Ga0207647_10036448 | Ga0207647_100364481 | 181 |
| 369 | 3300025906 | Ga0207699_10412728 | Ga0207699_104127282 | 181 |
| 370 | 3300025907 | Ga0207645_10119939 | Ga0207645_101199392 | 181 |
| 371 | 3300025912 | Ga0207707_10000590 | Ga0207707_1000059029 | 181 |
| 372 | 3300025917 | Ga0207660_10011374 | Ga0207660_100113744 | 181 |
| 373 | 3300025921 | Ga0207652_10390397 | Ga0207652_103903972 | 181 |
| 374 | 3300025925 | Ga0207650_10084585 | Ga0207650_100845852 | 181 |
| 375 | 3300025925 | Ga0207650_10286002 | Ga0207650_102860022 | 181 |
| 376 | 3300025925 | Ga0207650_10444079 | Ga0207650_104440792 | 181 |
| 377 | 3300025926 | Ga0207659_10044601 | Ga0207659_100446012 | 181 |
| 378 | 3300025929 | Ga0207664_10291481 | Ga0207664_102914812 | 181 |
| 379 | 3300025937 | Ga0207669_10022176 | Ga0207669_100221761 | 181 |
| 380 | 3300025940 | Ga0207691_10059115 | Ga0207691_100591154 | 181 |
| 381 | 3300025940 | Ga0207691_10112758 | Ga0207691_101127582 | 181 |
| 382 | 3300025942 | Ga0207689_10236570 | Ga0207689_102365702 | 181 |
| 383 | 3300025942 | Ga0207689_10546149 | Ga0207689_105461492 | 181 |
| 384 | 3300025945 | Ga0207679_10372014 | Ga0207679_103720142 | 181 |
| 385 | 3300025972 | Ga0207668_10009666 | Ga0207668_100096664 | 181 |
| 386 | 3300025972 | Ga0207668_10011288 | Ga0207668_100112885 | 181 |
| 387 | 3300026035 | Ga0207703_10633602 | Ga0207703_106336022 | 181 |
| 388 | 3300026067 | Ga0207678_10030236 | Ga0207678_100302364 | 181 |
| 389 | 3300026075 | Ga0207708_10897270 | Ga0207708_108972701 | 181 |
| 390 | 3300026088 | Ga0207641_10121879 | Ga0207641_101218792 | 181 |
| 391 | 3300026088 | Ga0207641_10833905 | Ga0207641_108339052 | 181 |
| 392 | 3300026095 | Ga0207676_10201540 | Ga0207676_102015401 | 181 |
| 393 | 3300026118 | Ga0207675_100077563 | Ga0207675_1000775632 | 181 |
| 394 | 3300026142 | Ga0207698_10173506 | Ga0207698_101735062 | 181 |
| 395 | 3300027360 | Ga0209969_1042461 | Ga0209969_10424611 | 181 |
| 396 | 3300027378 | Ga0209981_1002474 | Ga0209981_10024741 | 181 |
| 397 | 3300027907 | Ga0207428_10001315 | Ga0207428_1000131520 | 181 |
| 398 | 3300027907 | Ga0207428_10085269 | Ga0207428_100852692 | 181 |
| 399 | 3300031344 | Ga0265316_10080901 | Ga0265316_100809013 | 181 |
| 400 | 3300031665 | Ga0316575_10006576 | Ga0316575_100065764 | 181 |
| 401 | 3300031728 | Ga0316578_10208961 | Ga0316578_102089612 | 181 |
| 402 | 3300034819 | Ga0373958_0031256 | Ga0373958_0031256_284_829 | 181 |
| 403 | 3300034820 | Ga0373959_0008987 | Ga0373959_0008987_972_1517 | 181 |
| 404 | 3300034957 | Ga0373938_0002224 | Ga0373938_0002224_401_946 | 181 |
| 405 | 3300034957 | Ga0373938_0054377 | Ga0373938_0054377_199_765 | 181 |
| 406 | 3300035083 | Ga0373926_0001853 | Ga0373926_0001853_1569_2114 | 181 |
| 407 | 3300035085 | Ga0373929_0015567 | Ga0373929_0015567_590_1135 | 181 |
| 408 | 3300035085 | Ga0373929_0054455 | Ga0373929_0054455_249_794 | 181 |
| 409 | 3300035089 | Ga0373944_0016793 | Ga0373944_0016793_588_1133 | 181 |
| 410 | 3300035090 | Ga0373949_0003719 | Ga0373949_0003719_2437_2982 | 181 |
| 411 | 3300035111 | Ga0373923_0041652 | Ga0373923_0041652_992_1537 | 181 |
| 412 | 3300035112 | Ga0373932_0004698 | Ga0373932_0004698_845_1390 | 181 |
| 413 | 3300035113 | Ga0373936_0012274 | Ga0373936_0012274_2273_2818 | 181 |
| 414 | 3300035113 | Ga0373936_0035417 | Ga0373936_0035417_776_1321 | 181 |
| 415 | 3300035115 | Ga0373941_0006424 | Ga0373941_0006424_2110_2655 | 181 |
| 416 | 3300035116 | Ga0373945_0041557 | Ga0373945_0041557_804_1349 | 181 |
| 417 | 3300035170 | Ga0373943_0058874 | Ga0373943_0058874_1235_1780 | 181 |
| 418 | 3300035170 | Ga0373943_0100389 | Ga0373943_0100389_492_1037 | 181 |
| 419 | 3300035207 | Ga0373942_0014175 | Ga0373942_0014175_212_757 | 181 |
| 420 | 3300035242 | Ga0373962_0041398 | Ga0373962_0041398_113_658 | 181 |
| 421 | 3300035398 | Ga0316574_0009469 | Ga0316574_0009469_46_591 | 181 |
| 422 | 3300035410 | Ga0373924_0017981 | Ga0373924_0017981_1494_2039 | 181 |
| 423 | 3300035410 | Ga0373924_0104578 | Ga0373924_0104578_387_932 | 181 |
| 424 | 3300035691 | Ga0373931_0014482 | Ga0373931_0014482_63_608 | 181 |
| 425 | 3300035692 | Ga0373935_0038687 | Ga0373935_0038687_2161_2706 | 181 |
| 426 | 3300035692 | Ga0373935_0091104 | Ga0373935_0091104_1418_1963 | 181 |
| 427 | 3300035692 | Ga0373935_0164688 | Ga0373935_0164688_935_1480 | 181 |
| 428 | 3300035695 | Ga0373927_0060202 | Ga0373927_0060202_631_1176 | 181 |
| 429 | 3300035695 | Ga0373927_0097951 | Ga0373927_0097951_1002_1547 | 181 |
| 430 | 3300035725 | Ga0373947_0144024 | Ga0373947_0144024_493_1038 | 181 |
| 431 | 3300036401 | Ga0373937_0201695 | Ga0373937_0201695_1077_1637 | 181 |
| 432 | 3300036401 | Ga0373937_0580923 | Ga0373937_0580923_283_843 | 181 |
| 433 | 3300037068 | Ga0373925_0046190 | Ga0373925_0046190_2161_2706 | 181 |
| 434 | 3300037068 | Ga0373925_0380285 | Ga0373925_0380285_501_1046 | 181 |
| 435 | 3300037471 | Ga0395905_0682176 | Ga0395905_0682176_113_658 | 181 |
| 436 | 3300037588 | Ga0316581_0007984 | Ga0316581_0007984_1639_2184 | 181 |
| 437 | 3300041512 | Ga0451853_2332119 | Ga0451853_2332119_169_750 | 181 |
| 438 | 3300042461 | Ga0439460_0039633 | Ga0439460_0039633_530_1090 | 181 |
| 439 | 3300042876 | Ga0451577_0066293 | Ga0451577_0066293_1337_1882 | 181 |
| 440 | 3300044712 | Ga0453684_0046258 | Ga0453684_0046258_4719_5264 | 181 |
| 441 | 3300044712 | Ga0453684_0341393 | Ga0453684_0341393_693_1238 | 181 |
| 442 | 3300044735 | Ga0466968_0259924 | Ga0466968_0259924_199_744 | 181 |
| 443 | 3300045051 | Ga0451576_0007423 | Ga0451576_0007423_10372_10917 | 181 |
| 444 | 3300046455 | Ga0495603_0004362 | Ga0495603_0004362_1499_2044 | 181 |
| 445 | 3300046463 | Ga0495653_0056651 | Ga0495653_0056651_1399_1944 | 181 |
| 446 | 3300046472 | Ga0495580_0064097 | Ga0495580_0064097_298_843 | 181 |
| 447 | 3300046473 | Ga0495582_0041039 | Ga0495582_0041039_1855_2400 | 181 |
| 448 | 3300046499 | Ga0495594_0141289 | Ga0495594_0141289_174_719 | 181 |
| 449 | 3300046516 | Ga0495628_0287336 | Ga0495628_0287336_138_683 | 181 |
| 450 | 3300046517 | Ga0495630_0044545 | Ga0495630_0044545_2581_3126 | 181 |
| 451 | 3300046517 | Ga0495630_0050296 | Ga0495630_0050296_1733_2278 | 181 |
| 452 | 3300046526 | Ga0495666_0012336 | Ga0495666_0012336_1545_2090 | 181 |
| 453 | 3300046535 | Ga0495586_0001122 | Ga0495586_0001122_4165_4710 | 181 |
| 454 | 3300046642 | Ga0495634_0400719 | Ga0495634_0400719_94_639 | 181 |
| 455 | 3300046674 | Ga0495588_0008579 | Ga0495588_0008579_1452_1997 | 181 |
| 456 | 3300046681 | Ga0495647_0001029 | Ga0495647_0001029_1334_1879 | 181 |
| 457 | 3300046683 | Ga0495658_0002217 | Ga0495658_0002217_585_1130 | 181 |
| 458 | 3300046683 | Ga0495658_0041748 | Ga0495658_0041748_1320_1865 | 181 |
| 459 | 3300047319 | Ga0495674_0726149 | Ga0495674_0726149_43_588 | 181 |
| 460 | 3300047673 | Ga0495593_0308369 | Ga0495593_0308369_131_676 | 181 |
| 461 | 3300049568 | Ga0501031_0081169 | Ga0501031_0081169_1537_2082 | 181 |
| 462 | 3300049570 | Ga0501033_0025955 | Ga0501033_0025955_3815_4360 | 181 |
| 463 | 3300049577 | Ga0501041_0272908 | Ga0501041_0272908_176_727 | 181 |
| 464 | 3300049580 | Ga0501046_0045838 | Ga0501046_0045838_1530_2075 | 181 |
| 465 | 3300049585 | Ga0501069_0273398 | Ga0501069_0273398_159_704 | 181 |
| 466 | 3300049587 | Ga0501071_0003199 | Ga0501071_0003199_1061_1606 | 181 |
| 467 | 3300049587 | Ga0501071_0992479 | Ga0501071_0992479_17_562 | 181 |
| 468 | 3300049588 | Ga0501072_0043357 | Ga0501072_0043357_548_1093 | 181 |
| 469 | 3300049589 | Ga0501073_0158154 | Ga0501073_0158154_753_1298 | 181 |
| 470 | 3300049591 | Ga0501075_0093631 | Ga0501075_0093631_80_625 | 181 |
| 471 | 3300049592 | Ga0501076_0025702 | Ga0501076_0025702_214_759 | 181 |
| 472 | 3300049593 | Ga0501077_0037025 | Ga0501077_0037025_1933_2484 | 181 |
| 473 | 3300049741 | Ga0501079_0050908 | Ga0501079_0050908_2345_2890 | 181 |
| 474 | 3300049742 | Ga0501080_0000692 | Ga0501080_0000692_14307_14852 | 181 |
| 475 | 3300049743 | Ga0501081_0039707 | Ga0501081_0039707_2157_2702 | 181 |
| 476 | 3300049743 | Ga0501081_0068203 | Ga0501081_0068203_508_1053 | 181 |
| 477 | 3300049824 | Ga0501045_0018274 | Ga0501045_0018274_994_1539 | 181 |
| 478 | 3300050507 | nmdc:mga05p37_128747_c1 | nmdc:mga05p37_128747_c1_535_1080 | 181 |
| 479 | 3300050507 | nmdc:mga05p37_15060_c1 | nmdc:mga05p37_15060_c1_1499_2044 | 181 |
| 480 | 3300050507 | nmdc:mga05p37_732274_c1 | nmdc:mga05p37_732274_c1_474_1019 | 181 |
| 481 | 3300050508 | nmdc:mga09592_124522_c1 | nmdc:mga09592_124522_c1_740_1285 | 181 |
| 482 | 3300050508 | nmdc:mga09592_2325_c1 | nmdc:mga09592_2325_c1_13079_13624 | 181 |
| 483 | 3300050508 | nmdc:mga09592_355891_c1 | nmdc:mga09592_355891_c1_565_1110 | 181 |
| 484 | 3300050509 | nmdc:mga0qj67_243665_c1 | nmdc:mga0qj67_243665_c1_858_1403 | 181 |
| 485 | 3300050510 | nmdc:mga06r32_90108_c1 | nmdc:mga06r32_90108_c1_1498_2043 | 181 |
| 486 | 3300050511 | nmdc:mga08y16_1707_c1 | nmdc:mga08y16_1707_c1_7416_7961 | 181 |
| 487 | 3300050511 | nmdc:mga08y16_232561_c1 | nmdc:mga08y16_232561_c1_1331_1876 | 181 |
| 488 | 3300050511 | nmdc:mga08y16_32909_c1 | nmdc:mga08y16_32909_c1_3283_3828 | 181 |
| 489 | 3300050512 | nmdc:mga0n895_333_c1 | nmdc:mga0n895_333_c1_18738_19283 | 181 |
| 490 | 3300050513 | nmdc:mga0rr50_569_c1 | nmdc:mga0rr50_569_c1_12681_13226 | 181 |
| 491 | 3300050513 | nmdc:mga0rr50_59239_c1 | nmdc:mga0rr50_59239_c1_570_1115 | 181 |
| 492 | 3300050514 | nmdc:mga08x19_1192_c1 | nmdc:mga08x19_1192_c1_3238_3783 | 181 |
| 493 | 3300050514 | nmdc:mga08x19_260393_c1 | nmdc:mga08x19_260393_c1_266_811 | 181 |
| 494 | 3300050514 | nmdc:mga08x19_28528_c1 | nmdc:mga08x19_28528_c1_2619_3164 | 181 |
| 495 | 3300050515 | nmdc:mga0a205_13415_c1 | nmdc:mga0a205_13415_c1_761_1306 | 181 |
| 496 | 3300050515 | nmdc:mga0a205_1994_c1 | nmdc:mga0a205_1994_c1_16207_16752 | 181 |
| 497 | 3300059423 | Ga0590074_048058 | Ga0590074_048058_109_666 | 181 |
| 498 | 3300059426 | Ga0590077_018187 | Ga0590077_018187_286_831 | 181 |
| 499 | 3300060353 | Ga0501082_0496108 | Ga0501082_0496108_294_839 | 181 |
| 500 | 3300049569 | Ga0501032_0177934 | Ga0501032_0177934_781_1338 | 182 |
| 501 | 3300049570 | Ga0501033_0016265 | Ga0501033_0016265_893_1450 | 182 |
| 502 | 3300049572 | Ga0501036_0002538 | Ga0501036_0002538_554_1111 | 182 |
| 503 | 3300049573 | Ga0501037_0011042 | Ga0501037_0011042_742_1299 | 182 |
| 504 | 3300049574 | Ga0501038_0002348 | Ga0501038_0002348_13460_14017 | 182 |
| 505 | 3300049576 | Ga0501040_0001256 | Ga0501040_0001256_15000_15557 | 182 |
| 506 | 3300049577 | Ga0501041_0002453 | Ga0501041_0002453_7947_8504 | 182 |
| 507 | 3300049578 | Ga0501042_0000735 | Ga0501042_0000735_8064_8621 | 182 |
| 508 | 3300049579 | Ga0501043_0007575 | Ga0501043_0007575_4809_5366 | 182 |
| 509 | 3300049580 | Ga0501046_0003327 | Ga0501046_0003327_32_589 | 182 |
| 510 | 3300049582 | Ga0501048_0053282 | Ga0501048_0053282_1927_2484 | 182 |
| 511 | 3300049588 | Ga0501072_0058598 | Ga0501072_0058598_72_629 | 182 |
| 512 | 3300049590 | Ga0501074_0024589 | Ga0501074_0024589_3424_3981 | 182 |
| 513 | 3300049591 | Ga0501075_0002051 | Ga0501075_0002051_7646_8203 | 182 |
| 514 | 3300049592 | Ga0501076_0002867 | Ga0501076_0002867_5588_6145 | 182 |
| 515 | 3300049593 | Ga0501077_0000443 | Ga0501077_0000443_11394_11951 | 182 |
| 516 | 3300049741 | Ga0501079_0000827 | Ga0501079_0000827_6543_7100 | 182 |
| 517 | 3300049742 | Ga0501080_0169487 | Ga0501080_0169487_854_1411 | 182 |
| 518 | 3300049743 | Ga0501081_0001598 | Ga0501081_0001598_12874_13431 | 182 |
| 519 | 3300049744 | Ga0501083_0187571 | Ga0501083_0187571_120_677 | 182 |
| 520 | 3300049822 | Ga0501035_0013485 | Ga0501035_0013485_5405_5962 | 182 |
| 521 | 3300049824 | Ga0501045_0064364 | Ga0501045_0064364_1559_2116 | 182 |
| 522 | 3300054114 | Ga0501084_0002718 | Ga0501084_0002718_11585_12148 | 182 |
| 523 | 3300060353 | Ga0501082_0018622 | Ga0501082_0018622_89_646 | 182 |
| 524 | 3300061734 | Ga0530510_0002712 | Ga0530510_0002712_2118_2675 | 182 |
| 525 | 3300005577 | Ga0068857_100671624 | Ga0068857_1006716242 | 183 |
| 526 | 3300006871 | Ga0075434_100002486 | Ga0075434_10000248612 | 183 |
| 527 | 3300006914 | Ga0075436_100077534 | Ga0075436_1000775342 | 183 |
| 528 | 3300007076 | Ga0075435_100006910 | Ga0075435_1000069109 | 183 |
| 529 | 3300042876 | Ga0451577_0037595 | Ga0451577_0037595_2110_2703 | 183 |
| 530 | 3300045051 | Ga0451576_0002487 | Ga0451576_0002487_4041_4634 | 183 |
| 531 | 3300049571 | Ga0501034_0459443 | Ga0501034_0459443_556_1137 | 183 |
| 532 | 3300049572 | Ga0501036_0660338 | Ga0501036_0660338_228_809 | 183 |
| 533 | 3300049573 | Ga0501037_0233113 | Ga0501037_0233113_642_1223 | 183 |
| 534 | 3300049574 | Ga0501038_0320777 | Ga0501038_0320777_373_954 | 183 |
| 535 | 3300049577 | Ga0501041_0155463 | Ga0501041_0155463_475_1050 | 183 |
| 536 | 3300049577 | Ga0501041_0169055 | Ga0501041_0169055_17_574 | 183 |
| 537 | 3300049582 | Ga0501048_0352102 | Ga0501048_0352102_290_847 | 183 |
| 538 | 3300049587 | Ga0501071_0242156 | Ga0501071_0242156_580_1137 | 183 |
| 539 | 3300049587 | Ga0501071_0245031 | Ga0501071_0245031_758_1333 | 183 |
| 540 | 3300049588 | Ga0501072_0053110 | Ga0501072_0053110_2073_2630 | 183 |
| 541 | 3300049591 | Ga0501075_0243164 | Ga0501075_0243164_33_590 | 183 |
| 542 | 3300049591 | Ga0501075_0248818 | Ga0501075_0248818_128_703 | 183 |
| 543 | 3300049741 | Ga0501079_0717128 | Ga0501079_0717128_65_640 | 183 |
| 544 | 3300049823 | Ga0501044_0074090 | Ga0501044_0074090_2666_3247 | 183 |
| 545 | 3300050512 | nmdc:mga0n895_127974_c1 | nmdc:mga0n895_127974_c1_1435_1992 | 183 |
| 546 | 3300050513 | nmdc:mga0rr50_4041_c1 | nmdc:mga0rr50_4041_c1_5217_5774 | 183 |
| 547 | 3300061734 | Ga0530510_0322704 | Ga0530510_0322704_440_1015 | 183 |
| 548 | 3300061734 | Ga0530510_0742737 | Ga0530510_0742737_123_680 | 183 |
| 549 | 3300046537 | Ga0495598_0092283 | Ga0495598_0092283_24_593 | 184 |
| 550 | 3300000044 | ARSoilOldRDRAFT_c011124 | ARSoilOldRDRAFT_0111241 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j9a-assembly1.cif.gz_A-2 | oligoribonuclease | 0.9741 | 9 | 185 |
| 5cy4-assembly1.cif.gz_B | crystal structure of an oligoribonuclease from acinetobacter baumannii | 0.9739 | 5 | 181 |
| 7vh4-assembly1.cif.gz_C | crystal structure of oligoribonuclease of escherichia coli | 0.9727 | 9 | 185 |
| 7va3-assembly1.cif.gz_A | paorn oligoribonuclease d11a mutant with substrate pgpg complex structure | 0.9726 | 9 | 185 |
| 7vh4-assembly1.cif.gz_D-2 | crystal structure of oligoribonuclease of escherichia coli | 0.9718 | 9 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q556Y2_11_190_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9778 | 7 | 184 | 3.30.420.10 |
| af_P9WIU1_1_181_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9678 | 9 | 185 | 3.30.420.10 |
| 1ytaA00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9624 | 6 | 185 | 3.30.420.10 |
| af_Q6K4V8_62_244_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9587 | 10 | 185 | 3.30.420.10 |
| 1ytaA00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9571 | 6 | 185 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1BLJ9-F1-model_v4 | Exonuclease domain-containing protein | 0.9947 | 8 | 108 |
GO:0000175
GO:0003676 |
| AF-A0A3D2DDW7-F1-model_v4 | deleted | 0.9944 | 9 | 102 |
|
| AF-A0A182K888-F1-model_v4 | Exonuclease domain-containing protein | 0.9884 | 9 | 108 |
GO:0000175
GO:0003676 GO:0005739 |
| AF-A0A847E1P4-F1-model_v4 | Oligoribonuclease (EC 3.1.-.-) | 0.9848 | 9 | 185 |
GO:0000175
GO:0003676 GO:0005737 GO:0006259 |
| AF-A0A4Z0M0X9-F1-model_v4 | Oligoribonuclease (EC 3.1.-.-) | 0.9848 | 9 | 181 |
GO:0000175
GO:0003676 GO:0005737 GO:0006259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar