F462428

General Info

Members Datasets Scaffolds Average Seq Length
549 354 1098 122

Family's Representative Sequence

Representative Sequence 3300053159|Ga0500630_045449|Ga0500630_045449_1652_2077
Length 141
Sequence MMTHTPCVNTLTHPRESIMTVTGPDFIALQVRDLEKAAHFYETRLGLRRAPGGPPHAVVFATTPITFAVREPLPGVDLDAATPNPGTGVVLWLRADDAQAVHDRLAGDGVAITVPPFDGPFGRTFTFTDPDGYAVTIHDQA

Samples

Sample ID Description Type Environment
1 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
80 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
81 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
82 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
83 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
84 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
85 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
160 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
161 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
175 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
178 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
224 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
232 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
235 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
336 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
337 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
338 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
339 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
342 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
343 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
344 2547132424 Nocardia nova SH22a Isolate Unclassified
345 2582580736 Prauserella sp. Am3 Isolate Unclassified
346 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
347 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
348 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
349 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
350 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
351 8002784119 Frankia sp. AgB1.9 Isolate Nodule
352 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
353 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
354 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 1.09
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0.18
Rhizoplane 5.65
Rhizosphere 81.24
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500630_045449 3300053159 Bacteria 2134
2 rootH1_10173147 3300003316 Bacteria 1115
3 rootH2_10043627 3300003320 Bacteria 4908
4 rootL2_10322489 3300003322 Bacteria 1122
5 Ga0065714_10524264 3300005288 Bacteria 511
6 Ga0070676_10487177 3300005328 Bacteria 873
7 Ga0070676_11041751 3300005328 Bacteria 616
8 Ga0070690_100117914 3300005330 Bacteria 1779
9 Ga0070690_100923915 3300005330 Bacteria 684
10 Ga0068869_100705787 3300005334 Bacteria 860
11 Ga0068869_101018814 3300005334 Bacteria 721
12 Ga0070666_10440848 3300005335 Bacteria 940
13 Ga0070682_100491654 3300005337 Bacteria 949
14 Ga0068868_100408222 3300005338 Bacteria 1173
15 Ga0068868_100491359 3300005338 Bacteria 1074
16 Ga0070660_100591324 3300005339 Bacteria 927
17 Ga0070691_10253609 3300005341 Bacteria 944
18 Ga0070669_100563959 3300005353 Bacteria 951
19 Ga0070675_100055481 3300005354 Bacteria 3262
20 Ga0070673_100100073 3300005364 Bacteria 2386
21 Ga0070688_100250069 3300005365 Bacteria 1262
22 Ga0070659_100226405 3300005366 Bacteria 1544
23 Ga0070667_100680645 3300005367 Bacteria 951
24 Ga0070703_10190335 3300005406 Bacteria 799
25 Ga0070709_10005893 3300005434 Bacteria 6646
26 Ga0070709_10031903 3300005434 Bacteria 3173
27 Ga0070709_10192857 3300005434 Bacteria 1438
28 Ga0070709_11041103 3300005434 Bacteria 652
29 Ga0070709_11054451 3300005434 Bacteria 648
30 Ga0070709_11111458 3300005434 Bacteria 632
31 Ga0070714_100219560 3300005435 Bacteria 1746
32 Ga0070714_100489072 3300005435 Bacteria 1172
33 Ga0070714_100502492 3300005435 Bacteria 1156
34 Ga0070714_101005432 3300005435 Bacteria 811
35 Ga0070713_100065275 3300005436 Bacteria 3057
36 Ga0070713_100081943 3300005436 Bacteria 2754
37 Ga0070713_100271416 3300005436 Bacteria 1553
38 Ga0070713_100847694 3300005436 Bacteria 877
39 Ga0070713_100986129 3300005436 Bacteria 812
40 Ga0070713_101113039 3300005436 Bacteria 763
41 Ga0070713_101828748 3300005436 Bacteria 589
42 Ga0070710_10041693 3300005437 Bacteria 2535
43 Ga0070710_10054499 3300005437 Bacteria 2256
44 Ga0070710_10061401 3300005437 Bacteria 2140
45 Ga0070710_10122873 3300005437 Bacteria 1573
46 Ga0070701_10654511 3300005438 Bacteria 702
47 Ga0070711_100324328 3300005439 Bacteria 1231
48 Ga0070711_100789902 3300005439 Bacteria 804
49 Ga0070705_100129006 3300005440 Bacteria 1646
50 Ga0070705_100880980 3300005440 Bacteria 718
51 Ga0070700_100576654 3300005441 Bacteria 878
52 Ga0070708_100176467 3300005445 Bacteria 1996
53 Ga0070708_100562198 3300005445 Bacteria 1076
54 Ga0070663_100067924 3300005455 Bacteria 2587
55 Ga0070663_100132653 3300005455 Bacteria 1893
56 Ga0070678_100121248 3300005456 Bacteria 2062
57 Ga0070681_10878781 3300005458 Bacteria 814
58 Ga0068867_100643119 3300005459 Bacteria 930
59 Ga0070706_100587331 3300005467 Bacteria 1035
60 Ga0070707_100022649 3300005468 Bacteria 5941
61 Ga0070707_100085329 3300005468 Bacteria 3052
62 Ga0070707_100514133 3300005468 Bacteria 1159
63 Ga0070698_100026873 3300005471 Bacteria 5985
64 Ga0070698_100657264 3300005471 Bacteria 989
65 Ga0070699_100326603 3300005518 Bacteria 1379
66 Ga0070699_100400089 3300005518 Bacteria 1241
67 Ga0070679_100525105 3300005530 Bacteria 1128
68 Ga0070679_101115685 3300005530 Bacteria 734
69 Ga0070684_100029951 3300005535 Bacteria 4620
70 Ga0070684_100804996 3300005535 Bacteria 878
71 Ga0070684_101450607 3300005535 Bacteria 646
72 Ga0068853_101276478 3300005539 Bacteria 710
73 Ga0070696_100277954 3300005546 Bacteria 1275
74 Ga0070693_100285740 3300005547 Bacteria 1106
75 Ga0070693_100673776 3300005547 Bacteria 754
76 Ga0070665_101356110 3300005548 Bacteria 721
77 Ga0070704_100523423 3300005549 Bacteria 1032
78 Ga0068855_100245088 3300005563 Bacteria 2000
79 Ga0068855_100509003 3300005563 Bacteria 1307
80 Ga0068855_101437795 3300005563 Bacteria 710
81 Ga0068857_100345671 3300005577 Bacteria 1377
82 Ga0068854_100125846 3300005578 Bacteria 1951
83 Ga0068856_100168067 3300005614 Bacteria 2204
84 Ga0070702_100327859 3300005615 Bacteria 1069
85 Ga0070702_101047137 3300005615 Bacteria 649
86 Ga0068866_11113736 3300005718 Bacteria 566
87 Ga0068861_100662412 3300005719 Bacteria 965
88 Ga0068851_10290770 3300005834 Bacteria 937
89 Ga0068870_10212746 3300005840 Bacteria 1179
90 Ga0068863_100106190 3300005841 Bacteria 2672
91 Ga0068863_100467275 3300005841 Bacteria 1239
92 Ga0068858_100459577 3300005842 Bacteria 1227
93 Ga0068858_100922099 3300005842 Bacteria 855
94 Ga0068858_101053968 3300005842 Bacteria 797
95 Ga0068860_100117076 3300005843 Bacteria 2549
96 Ga0068860_100854971 3300005843 Bacteria 924
97 Ga0070717_10047573 3300006028 Bacteria 3515
98 Ga0070717_11089557 3300006028 Bacteria 727
99 Ga0070717_11209699 3300006028 Bacteria 687
100 Ga0075364_10416669 3300006051 Bacteria 917
101 Ga0070715_10046130 3300006163 Bacteria 1851
102 Ga0070715_10199833 3300006163 Bacteria 1015
103 Ga0070715_10525471 3300006163 Bacteria 682
104 Ga0070716_100239937 3300006173 Bacteria 1229
105 Ga0070716_100810668 3300006173 Bacteria 725
106 Ga0070712_100057861 3300006175 Bacteria 2725
107 Ga0097621_100038878 3300006237 Bacteria 3819
108 Ga0097621_100049275 3300006237 Bacteria 3421
109 Ga0068871_100252174 3300006358 Bacteria 1537
110 Ga0075430_100023232 3300006846 Bacteria 5275
111 Ga0075434_100199682 3300006871 Bacteria 2019
112 Ga0068865_102075091 3300006881 Bacteria 517
113 Ga0099794_10463237 3300007265 Bacteria 665
114 Ga0099795_10043879 3300007788 Bacteria 1602
115 Ga0105244_10421226 3300009036 Bacteria 614
116 Ga0105240_10250933 3300009093 Bacteria 2046
117 Ga0105240_10475697 3300009093 Bacteria 1393
118 Ga0105245_10219832 3300009098 Bacteria 1832
119 Ga0105245_11369791 3300009098 Bacteria 757
120 Ga0114129_10783472 3300009147 Bacteria 1218
121 Ga0105242_12943892 3300009176 Bacteria 527
122 Ga0105248_10208476 3300009177 Bacteria 2202
123 Ga0105237_11960755 3300009545 Bacteria 594
124 Ga0105238_10493007 3300009551 Bacteria 1225
125 Ga0105249_10229555 3300009553 Bacteria 1830
126 Ga0105239_10167882 3300010375 Bacteria 2454
127 Ga0105239_11783325 3300010375 Bacteria 713
128 Ga0157336_1005164 3300012477 Bacteria 852
129 Ga0157335_1014491 3300012492 Bacteria 684
130 Ga0157347_1071684 3300012502 Bacteria 513
131 Ga0157339_1014905 3300012505 Bacteria 760
132 Ga0157324_1012844 3300012506 Bacteria 748
133 Ga0157342_1028926 3300012507 Bacteria 688
134 Ga0157338_1002553 3300012515 Bacteria 1438
135 Ga0157373_10185421 3300013100 Bacteria 1466
136 Ga0157371_10446451 3300013102 Bacteria 951
137 Ga0157370_10122604 3300013104 Bacteria 2427
138 Ga0157370_11799152 3300013104 Bacteria 550
139 Ga0157369_10061614 3300013105 Bacteria 4044
140 Ga0157369_10693568 3300013105 Bacteria 1049
141 Ga0157374_11597412 3300013296 Bacteria 676
142 Ga0163162_10704251 3300013306 Bacteria 1131
143 Ga0163162_12753749 3300013306 Bacteria 566
144 Ga0157372_10030723 3300013307 Bacteria 5878
145 Ga0157372_10398022 3300013307 Bacteria 1605
146 Ga0157372_10954117 3300013307 Bacteria 994
147 Ga0157372_12860032 3300013307 Bacteria 553
148 Ga0157375_11391257 3300013308 Bacteria 826
149 Ga0163163_10082418 3300014325 Bacteria 3220
150 Ga0163163_10153196 3300014325 Bacteria 2348
151 Ga0157380_12539708 3300014326 Bacteria 578
152 Ga0157377_10424062 3300014745 Bacteria 912
153 Ga0157377_10467691 3300014745 Bacteria 874
154 Ga0157379_10029007 3300014968 Bacteria 4920
155 Ga0157376_10016592 3300014969 Bacteria 5596
156 Ga0157376_10580027 3300014969 Bacteria 1114
157 Ga0197907_11223136 3300020069 Bacteria 739
158 Ga0206349_1772343 3300020075 Bacteria 535
159 Ga0206353_10684539 3300020082 Bacteria 1161
160 Ga0213876_10657169 3300021384 Bacteria 558
161 Ga0213875_10223813 3300021388 Bacteria 886
162 Ga0224571_105875 3300022734 Bacteria 811
163 Ga0207426_1004073 3300025302 Bacteria 7378
164 Ga0207426_1008207 3300025302 Bacteria 4251
165 Ga0207653_10011401 3300025885 Bacteria 2773
166 Ga0207692_10011367 3300025898 Bacteria 3785
167 Ga0207692_10026942 3300025898 Bacteria 2701
168 Ga0207692_10280931 3300025898 Bacteria 1007
169 Ga0207692_10335776 3300025898 Bacteria 928
170 Ga0207710_10336862 3300025900 Bacteria 767
171 Ga0207688_10021231 3300025901 Bacteria 3547
172 Ga0207680_10290075 3300025903 Bacteria 1138
173 Ga0207685_10019446 3300025905 Bacteria 2239
174 Ga0207699_10149567 3300025906 Bacteria 1543
175 Ga0207699_10173530 3300025906 Bacteria 1444
176 Ga0207699_10406777 3300025906 Bacteria 970
177 Ga0207699_10786351 3300025906 Bacteria 699
178 Ga0207645_10187414 3300025907 Bacteria 1359
179 Ga0207643_10115421 3300025908 Bacteria 1585
180 Ga0207705_10681771 3300025909 Bacteria 799
181 Ga0207684_10018290 3300025910 Bacteria 5998
182 Ga0207654_10368940 3300025911 Bacteria 992
183 Ga0207707_10412635 3300025912 Bacteria 1158
184 Ga0207695_10300241 3300025913 Bacteria 1497
185 Ga0207695_11017572 3300025913 Bacteria 708
186 Ga0207693_10036655 3300025915 Bacteria 3866
187 Ga0207663_10005994 3300025916 Bacteria 6179
188 Ga0207663_10169156 3300025916 Bacteria 1551
189 Ga0207663_10303155 3300025916 Bacteria 1194
190 Ga0207660_11437753 3300025917 Bacteria 558
191 Ga0207662_10190922 3300025918 Bacteria 1322
192 Ga0207657_10060448 3300025919 Bacteria 3252
193 Ga0207649_10330187 3300025920 Bacteria 1123
194 Ga0207652_10486781 3300025921 Bacteria 1111
195 Ga0207646_10071056 3300025922 Bacteria 3109
196 Ga0207646_10103205 3300025922 Bacteria 2557
197 Ga0207646_10992466 3300025922 Bacteria 742
198 Ga0207694_10295819 3300025924 Bacteria 1332
199 Ga0207650_10966465 3300025925 Bacteria 724
200 Ga0207659_10698516 3300025926 Bacteria 868
201 Ga0207687_10768278 3300025927 Bacteria 821
202 Ga0207700_10006238 3300025928 Bacteria 7189
203 Ga0207700_10650929 3300025928 Bacteria 939
204 Ga0207700_11040274 3300025928 Bacteria 732
205 Ga0207664_10004019 3300025929 Bacteria 9918
206 Ga0207664_10025998 3300025929 Bacteria 4418
207 Ga0207664_10031893 3300025929 Bacteria 4035
208 Ga0207664_10037739 3300025929 Bacteria 3742
209 Ga0207664_10097772 3300025929 Bacteria 2419
210 Ga0207664_10919635 3300025929 Bacteria 785
211 Ga0207686_10674992 3300025934 Bacteria 819
212 Ga0207709_11197709 3300025935 Bacteria 626
213 Ga0207670_10750805 3300025936 Bacteria 810
214 Ga0207669_10230656 3300025937 Bacteria 1366
215 Ga0207704_10977725 3300025938 Bacteria 715
216 Ga0207704_11345330 3300025938 Bacteria 611
217 Ga0207665_10054246 3300025939 Bacteria 2703
218 Ga0207691_10412857 3300025940 Bacteria 1151
219 Ga0207711_10652068 3300025941 Bacteria 982
220 Ga0207711_11882945 3300025941 Bacteria 541
221 Ga0207689_10069388 3300025942 Bacteria 2896
222 Ga0207661_11333769 3300025944 Bacteria 659
223 Ga0207679_10339368 3300025945 Bacteria 1306
224 Ga0207667_10422285 3300025949 Bacteria 1357
225 Ga0207712_11056813 3300025961 Bacteria 722
226 Ga0207658_10625130 3300025986 Bacteria 969
227 Ga0207677_11656396 3300026023 Bacteria 593
228 Ga0207703_11031632 3300026035 Bacteria 789
229 Ga0207678_10012701 3300026067 Bacteria 7397
230 Ga0207678_10667111 3300026067 Bacteria 914
231 Ga0207708_10840744 3300026075 Bacteria 792
232 Ga0207702_10043925 3300026078 Bacteria 3754
233 Ga0207702_10088757 3300026078 Bacteria 2702
234 Ga0207641_10095687 3300026088 Bacteria 2607
235 Ga0207648_10770824 3300026089 Bacteria 894
236 Ga0207674_10080982 3300026116 Bacteria 3249
237 Ga0207674_10379607 3300026116 Bacteria 1366
238 Ga0207683_10339752 3300026121 Bacteria 1377
239 Ga0207698_11040568 3300026142 Bacteria 830
240 Ga0209371_1084714 3300027312 Bacteria 542
241 Ga0265356_1034333 3300028017 Bacteria 554
242 Ga0265357_1006906 3300028023 Bacteria 1086
243 Ga0265355_1025085 3300028036 Bacteria 524
244 Ga0268266_10169825 3300028379 Bacteria 1979
245 Ga0268266_10900382 3300028379 Bacteria 855
246 Ga0268264_11866279 3300028381 Bacteria 611
247 Ga0265337_1004656 3300028556 Bacteria 5640
248 Ga0265326_10028346 3300028558 Bacteria 1595
249 Ga0265319_1028692 3300028563 Bacteria 1959
250 Ga0265334_10004271 3300028573 Bacteria 6374
251 Ga0265318_10249686 3300028577 Bacteria 647
252 Ga0265323_10003673 3300028653 Bacteria 6727
253 Ga0265322_10045310 3300028654 Bacteria 1251
254 Ga0265336_10004786 3300028666 Bacteria 5073
255 Ga0265336_10005059 3300028666 Bacteria 4908
256 Ga0307515_10039596 3300028794 Bacteria 7487
257 Ga0265338_10003091 3300028800 Bacteria 23877
258 Ga0265338_10007032 3300028800 Bacteria 14118
259 Ga0265338_10014314 3300028800 Bacteria 8835
260 Ga0265324_10171960 3300029957 Bacteria 735
261 Ga0268256_1093777 3300030500 Bacteria 542
262 Ga0307511_10003062 3300030521 Bacteria 17254
263 Ga0307512_10006188 3300030522 Bacteria 12210
264 Ga0265762_1055247 3300030760 Bacteria 805
265 Ga0265332_10034807 3300031238 Bacteria 2188
266 Ga0265320_10060527 3300031240 Bacteria 1807
267 Ga0265325_10027327 3300031241 Bacteria 3084
268 Ga0265340_10071461 3300031247 Bacteria 1645
269 Ga0265316_10157420 3300031344 Bacteria 1699
270 Ga0307509_10002102 3300031507 Bacteria 32828
271 Ga0307509_10029063 3300031507 Bacteria 6139
272 Ga0307509_10467497 3300031507 Bacteria 952
273 Ga0265313_10015107 3300031595 Bacteria 4520
274 Ga0307508_10908163 3300031616 Bacteria 508
275 Ga0307514_10001479 3300031649 Bacteria 28450
276 Ga0265314_10007420 3300031711 Bacteria 9510
277 Ga0265342_10001678 3300031712 Bacteria 20341
278 Ga0307405_10508048 3300031731 Bacteria 967
279 Ga0307413_10110561 3300031824 Bacteria 1839
280 Ga0307413_11537609 3300031824 Bacteria 589
281 Ga0307406_10206707 3300031901 Bacteria 1450
282 Ga0307407_10599398 3300031903 Bacteria 820
283 Ga0307412_10795847 3300031911 Bacteria 820
284 Ga0307409_101539253 3300031995 Bacteria 693
285 Ga0307416_100792801 3300032002 Bacteria 1043
286 Ga0307415_100157623 3300032126 Bacteria 1755
287 Ga0307415_100350582 3300032126 Bacteria 1242
288 Ga0307507_10508078 3300033179 Bacteria 647
289 Ga0307510_10361383 3300033180 Bacteria 900
290 Ga0373948_0044367 3300034817 Bacteria 940
291 Ga0373959_0049592 3300034820 Bacteria 903
292 Ga0373928_0029175 3300035084 Bacteria 1212
293 Ga0373934_0001168 3300035086 Bacteria 9584
294 Ga0373944_0021693 3300035089 Bacteria 1861
295 Ga0373923_0094928 3300035111 Bacteria 1309
296 Ga0373923_0117497 3300035111 Bacteria 1185
297 Ga0373932_0092672 3300035112 Bacteria 972
298 Ga0373932_0274797 3300035112 Bacteria 621
299 Ga0373941_0206229 3300035115 Bacteria 749
300 Ga0373945_0002724 3300035116 Bacteria 5547
301 Ga0373945_0064007 3300035116 Bacteria 1378
302 Ga0373953_0000283 3300035117 Bacteria 13960
303 Ga0373954_0021338 3300035118 Bacteria 2932
304 Ga0373956_0004989 3300035119 Bacteria 5318
305 Ga0373956_0155484 3300035119 Bacteria 1076
306 Ga0373957_0043501 3300035120 Bacteria 1697
307 Ga0373960_0211848 3300035121 Bacteria 689
308 Ga0373960_0237715 3300035121 Bacteria 657
309 Ga0373943_0047078 3300035170 Bacteria 2107
310 Ga0373955_0004224 3300035172 Bacteria 6340
311 Ga0373955_0092748 3300035172 Bacteria 1723
312 Ga0373962_0177067 3300035242 Bacteria 711
313 Ga0373924_0005873 3300035410 Bacteria 4373
314 Ga0373924_0260421 3300035410 Bacteria 768
315 Ga0373935_0005018 3300035692 Bacteria 7796
316 Ga0373935_0247503 3300035692 Bacteria 1246
317 Ga0373935_0443092 3300035692 Bacteria 937
318 Ga0373927_0008751 3300035695 Bacteria 6799
319 Ga0373933_0001632 3300035724 Bacteria 13062
320 Ga0373933_0181467 3300035724 Bacteria 1342
321 Ga0373947_0003535 3300035725 Bacteria 9230
322 Ga0373947_0437944 3300035725 Bacteria 884
323 Ga0373937_0002187 3300036401 Bacteria 16350
324 Ga0373937_0007786 3300036401 Bacteria 9286
325 Ga0373937_0030785 3300036401 Bacteria 4861
326 Ga0373937_0201769 3300036401 Bacteria 1869
327 Ga0373937_0745831 3300036401 Bacteria 926
328 Ga0310112_013462 3300036458 Bacteria 1166
329 Ga0372808_031693 3300036459 Bacteria 758
330 Ga0373925_0000725 3300037068 Bacteria 30619
331 Ga0373925_0009947 3300037068 Bacteria 6907
332 Ga0373925_0013089 3300037068 Bacteria 6005
333 Ga0373925_1674572 3300037068 Bacteria 519
334 Ga0436364_0620055 3300037853 Bacteria 1117
335 Ga0436364_0820693 3300037853 Bacteria 2159
336 Ga0436364_0830807 3300037853 Bacteria 578
337 Ga0436364_1079932 3300037853 Bacteria 1611
338 Ga0436364_1266426 3300037853 Bacteria 1996
339 Ga0395901_0595735 3300038443 Bacteria 1115
340 Ga0436360_0925995 3300039438 Bacteria 726
341 Ga0436361_0133635 3300039447 Bacteria 800
342 Ga0436363_0610257 3300039450 Bacteria 754
343 Ga0436362_0376449 3300039453 Bacteria 1050
344 Ga0436362_0641169 3300039453 Bacteria 776
345 Ga0451791_0615758 3300041451 Bacteria 574
346 Ga0451853_3560626 3300041512 Bacteria 758
347 Ga0439455_0178899 3300042012 Unclassified 610
348 Ga0450920_003200 3300042122 Bacteria 2828
349 Ga0495627_170673 3300046453 Bacteria 604
350 Ga0495592_0004429 3300046454 Bacteria 10280
351 Ga0495603_0004037 3300046455 Bacteria 8741
352 Ga0495629_0006062 3300046459 Bacteria 8985
353 Ga0495629_0497514 3300046459 Bacteria 822
354 Ga0495641_0003242 3300046461 Bacteria 12328
355 Ga0495651_0002623 3300046462 Bacteria 13920
356 Ga0495651_0003309 3300046462 Bacteria 12376
357 Ga0495651_0190136 3300046462 Bacteria 1445
358 Ga0495653_0004390 3300046463 Bacteria 11400
359 Ga0495653_0006054 3300046463 Bacteria 9907
360 Ga0495653_0098263 3300046463 Bacteria 2126
361 Ga0495653_0681613 3300046463 Bacteria 625
362 Ga0495580_0011915 3300046472 Bacteria 6702
363 Ga0495582_0004122 3300046473 Bacteria 8170
364 Ga0495639_0002463 3300046475 Bacteria 8091
365 Ga0495662_0000703 3300046476 Bacteria 15861
366 Ga0495664_0053377 3300046477 Bacteria 2403
367 Ga0495664_0763260 3300046477 Bacteria 569
368 Ga0495594_0061074 3300046499 Bacteria 2085
369 Ga0495594_0305709 3300046499 Bacteria 906
370 Ga0495608_0001419 3300046511 Bacteria 17051
371 Ga0495608_0003311 3300046511 Bacteria 11519
372 Ga0495618_0036587 3300046514 Bacteria 3080
373 Ga0495618_0041925 3300046514 Bacteria 2883
374 Ga0495628_0008387 3300046516 Bacteria 8862
375 Ga0495628_0036249 3300046516 Bacteria 3960
376 Ga0495628_0062336 3300046516 Bacteria 2922
377 Ga0495630_0007188 3300046517 Bacteria 7936
378 Ga0495630_0054078 3300046517 Bacteria 3007
379 Ga0495666_0006798 3300046526 Bacteria 5742
380 Ga0495652_0009274 3300046529 Bacteria 8942
381 Ga0495652_0013110 3300046529 Bacteria 7465
382 Ga0495652_0195089 3300046529 Bacteria 1542
383 Ga0495652_0544852 3300046529 Bacteria 798
384 Ga0495665_0001680 3300046531 Bacteria 11879
385 Ga0495665_0066118 3300046531 Bacteria 1908
386 Ga0495665_0568415 3300046531 Bacteria 568
387 Ga0495640_0002878 3300046533 Bacteria 13863
388 Ga0495640_0030589 3300046533 Bacteria 3853
389 Ga0495586_0001054 3300046535 Bacteria 15568
390 Ga0495587_0010222 3300046536 Bacteria 5981
391 Ga0495587_0010486 3300046536 Bacteria 5895
392 Ga0495587_0170086 3300046536 Bacteria 1238
393 Ga0495598_0098219 3300046537 Bacteria 965
394 Ga0495645_0010472 3300046543 Bacteria 6501
395 Ga0495645_0055390 3300046543 Bacteria 2879
396 Ga0495645_0071549 3300046543 Bacteria 2500
397 Ga0495645_0078158 3300046543 Bacteria 2378
398 Ga0495622_0022135 3300046557 Bacteria 2962
399 Ga0495633_0019023 3300046558 Bacteria 3478
400 Ga0495667_0006537 3300046559 Bacteria 7912
401 Ga0495667_0018263 3300046559 Bacteria 4737
402 Ga0495667_0119609 3300046559 Bacteria 1701
403 Ga0495667_0313312 3300046559 Bacteria 993
404 Ga0495634_0004533 3300046642 Bacteria 10873
405 Ga0495635_0005981 3300046663 Bacteria 8491
406 Ga0495635_0010028 3300046663 Bacteria 6624
407 Ga0495635_0684781 3300046663 Bacteria 665
408 Ga0495659_0072399 3300046664 Bacteria 1293
409 Ga0495657_0003776 3300046675 Bacteria 12263
410 Ga0495657_0004453 3300046675 Bacteria 11193
411 Ga0495657_0021008 3300046675 Bacteria 4691
412 Ga0495623_0020557 3300046679 Bacteria 4267
413 Ga0495623_0237258 3300046679 Bacteria 1031
414 Ga0495646_0000844 3300046680 Bacteria 17328
415 Ga0495646_0013992 3300046680 Bacteria 5100
416 Ga0495646_0194369 3300046680 Bacteria 1107
417 Ga0495658_0017155 3300046683 Bacteria 3736
418 Ga0495658_0348247 3300046683 Bacteria 941
419 Ga0495613_0008380 3300046689 Bacteria 7677
420 Ga0495613_0332241 3300046689 Bacteria 1047
421 Ga0495624_0001075 3300046690 Bacteria 21576
422 Ga0495670_0002186 3300046691 Bacteria 9673
423 Ga0495671_0170770 3300046692 Bacteria 1057
424 Ga0495649_0296861 3300046694 Bacteria 823
425 Ga0495600_0000820 3300046809 Bacteria 16511
426 Ga0495600_0182462 3300046809 Bacteria 1352
427 Ga0495581_0000564 3300047315 Bacteria 19236
428 Ga0495604_0005121 3300047317 Bacteria 10376
429 Ga0495604_0053644 3300047317 Bacteria 3114
430 Ga0495636_0002578 3300047318 Bacteria 6969
431 Ga0495674_0001803 3300047319 Bacteria 21091
432 Ga0495674_0097964 3300047319 Bacteria 2497
433 Ga0495674_0316749 3300047319 Bacteria 1272
434 Ga0495676_0009465 3300047321 Bacteria 8873
435 Ga0495680_0003721 3300047322 Bacteria 14873
436 Ga0495680_0005403 3300047322 Bacteria 12032
437 Ga0495680_0075812 3300047322 Bacteria 2551
438 Ga0495680_0194852 3300047322 Bacteria 1456
439 Ga0495675_0346485 3300047444 Bacteria 874
440 Ga0495685_181969 3300047447 Bacteria 677
441 Ga0495684_0006527 3300047471 Bacteria 9053
442 Ga0495684_0010870 3300047471 Bacteria 7038
443 Ga0495684_0033867 3300047471 Bacteria 3919
444 Ga0495684_0372809 3300047471 Bacteria 1008
445 Ga0495593_0000672 3300047673 Bacteria 19695
446 Ga0495602_0022027 3300048088 Bacteria 6249
447 Ga0495602_0028177 3300048088 Bacteria 5380
448 Ga0495602_0195067 3300048088 Bacteria 1549
449 Ga0495614_0093973 3300048089 Bacteria 1306
450 Ga0496100_0884130 3300048903 Bacteria 701
451 Ga0496102_0557900 3300048905 Bacteria 1068
452 Ga0496103_0499405 3300048906 Bacteria 778
453 Ga0496104_0018743 3300048907 Bacteria 6319
454 Ga0496104_0338919 3300048907 Bacteria 1416
455 Ga0496104_0373783 3300048907 Bacteria 1338
456 Ga0496104_0394836 3300048907 Bacteria 1295
457 Ga0496104_0623440 3300048907 Bacteria 988
458 Ga0496105_0014845 3300048908 Bacteria 6201
459 Ga0496105_0136550 3300048908 Bacteria 2020
460 Ga0496106_1177238 3300048909 Bacteria 598
461 Ga0496108_0024061 3300048911 Bacteria 5013
462 Ga0496108_0105987 3300048911 Bacteria 2400
463 Ga0496108_0693256 3300048911 Bacteria 883
464 Ga0496108_1069845 3300048911 Bacteria 686
465 Ga0496109_0396117 3300048912 Bacteria 1304
466 Ga0496109_0766918 3300048912 Bacteria 902
467 Ga0496109_1571566 3300048912 Bacteria 592
468 Ga0496110_0053543 3300048913 Bacteria 3548
469 Ga0496110_1090407 3300048913 Bacteria 706
470 Ga0496111_0051330 3300048914 Bacteria 2977
471 Ga0496111_0345017 3300048914 Bacteria 1102
472 Ga0496112_0248781 3300048915 Bacteria 1729
473 Ga0496112_0574119 3300048915 Bacteria 1060
474 Ga0496112_0771244 3300048915 Bacteria 887
475 Ga0496113_0816354 3300048916 Bacteria 740
476 Ga0496114_0822708 3300048917 Bacteria 808
477 Ga0496115_0212291 3300048918 Bacteria 1598
478 Ga0496115_0235785 3300048918 Bacteria 1508
479 Ga0496115_0334647 3300048918 Bacteria 1236
480 Ga0496116_0000099 3300048919 Bacteria 195607
481 Ga0496117_0117724 3300048920 Bacteria 1639
482 Ga0496118_0000465 3300048921 Bacteria 67189
483 Ga0496119_0012985 3300048922 Bacteria 6692
484 Ga0496120_0070219 3300048923 Bacteria 1927
485 Ga0496121_0030106 3300048924 Bacteria 4995
486 Ga0496121_0342425 3300048924 Bacteria 999
487 Ga0496121_0550400 3300048924 Bacteria 722
488 Ga0496122_0006608 3300048925 Bacteria 13232
489 Ga0496122_0013341 3300048925 Bacteria 8049
490 Ga0496122_0025624 3300048925 Bacteria 5115
491 Ga0496123_0013067 3300048926 Bacteria 7008
492 Ga0496124_0001775 3300048927 Bacteria 30001
493 Ga0496126_0240163 3300048929 Bacteria 1514
494 Ga0496126_0521051 3300048929 Bacteria 947
495 Ga0496126_0521053 3300048929 Bacteria 947
496 Ga0501031_0064248 3300049568 Bacteria 2390
497 Ga0501032_0061734 3300049569 Bacteria 2512
498 Ga0501033_0105366 3300049570 Bacteria 2055
499 Ga0501034_0268668 3300049571 Bacteria 1647
500 Ga0501034_0603385 3300049571 Bacteria 1003
501 Ga0501038_0715066 3300049574 Bacteria 749
502 Ga0501039_0439903 3300049575 Bacteria 1024
503 Ga0501043_0750755 3300049579 Bacteria 709
504 Ga0501046_0902373 3300049580 Bacteria 616
505 Ga0501047_0049280 3300049581 Bacteria 4067
506 Ga0501047_1253171 3300049581 Bacteria 555
507 Ga0501068_0382712 3300049584 Bacteria 906
508 Ga0501282_008853 3300049778 Bacteria 1081
509 Ga0501035_1207319 3300049822 Bacteria 586
510 Ga0501044_0243024 3300049823 Bacteria 1743
511 nmdc:mga00v17_831189_c1 3300050491 Bacteria 587
512 nmdc:mga0rr50_225580_c1 3300050513 Bacteria 1549
513 nmdc:mga0a205_27529_c1 3300050515 Bacteria 5428
514 Ga0495601_0003485 3300053077 Bacteria 9030
515 Ga0495601_0259934 3300053077 Bacteria 1133
516 Ga0495601_0449467 3300053077 Bacteria 833
517 Ga0495612_0004887 3300053078 Bacteria 5544
518 Ga0495595_0362378 3300053084 Bacteria 732
519 Ga0495619_0002912 3300053085 Bacteria 11119
520 Ga0500644_0088242 3300053088 Bacteria 1155
521 Ga0500566_0203611 3300053094 Bacteria 997
522 Ga0500650_0066261 3300053098 Bacteria 1687
523 Ga0500553_122009 3300053101 Bacteria 1071
524 Ga0500556_0000028 3300053104 Bacteria 165503
525 Ga0500560_014741 3300053107 Bacteria 2091
526 Ga0500560_054989 3300053107 Bacteria 1286
527 Ga0500559_0024781 3300053136 Bacteria 2553
528 Ga0500568_0044933 3300053139 Bacteria 1759
529 Ga0500573_0000024 3300053140 Bacteria 151713
530 Ga0500573_0003019 3300053140 Bacteria 8612
531 Ga0500573_0031040 3300053140 Bacteria 3083
532 Ga0500573_0180240 3300053140 Unclassified 1136
533 Ga0500573_0371371 3300053140 Bacteria 687
534 Ga0500573_0532648 3300053140 Bacteria 524
535 Ga0500577_0015151 3300053142 Bacteria 2402
536 Ga0500577_0039603 3300053142 Bacteria 1709
537 Ga0500577_0241892 3300053142 Bacteria 783
538 Ga0500603_052471 3300053150 Bacteria 1120
539 2548697958 2547132424 Bacteria 8348532
540 2583149534 2582580736 Bacteria 5325865
541 2644015594 2643221601 Bacteria 7493239
542 2644176998 2643221631 Bacteria 8168043
543 2644670638 2643221722 Bacteria 4247614
544 2852644235 2852643534 Bacteria 3013378
545 2870622379 2870622029 Bacteria 3643329
546 8002784897 8002784119 Bacteria 9788632
547 8047710457 8047710418 Bacteria 11023148
548 8048137420 8048127548 Bacteria 11053136
549 8054109362 8054107350 Bacteria 5022511
550 Ga0500630_045449
551 rootH1_10173147
552 rootH2_10043627
553 rootL2_10322489
554 Ga0065714_10524264
555 Ga0070676_10487177
556 Ga0070676_11041751
557 Ga0070690_100117914
558 Ga0070690_100923915
559 Ga0068869_100705787
560 Ga0068869_101018814
561 Ga0070666_10440848
562 Ga0070682_100491654
563 Ga0068868_100408222
564 Ga0068868_100491359
565 Ga0070660_100591324
566 Ga0070691_10253609
567 Ga0070669_100563959
568 Ga0070675_100055481
569 Ga0070673_100100073
570 Ga0070688_100250069
571 Ga0070659_100226405
572 Ga0070667_100680645
573 Ga0070703_10190335
574 Ga0070709_10005893
575 Ga0070709_10031903
576 Ga0070709_10192857
577 Ga0070709_11041103
578 Ga0070709_11054451
579 Ga0070709_11111458
580 Ga0070714_100219560
581 Ga0070714_100489072
582 Ga0070714_100502492
583 Ga0070714_101005432
584 Ga0070713_100065275
585 Ga0070713_100081943
586 Ga0070713_100271416
587 Ga0070713_100847694
588 Ga0070713_100986129
589 Ga0070713_101113039
590 Ga0070713_101828748
591 Ga0070710_10041693
592 Ga0070710_10054499
593 Ga0070710_10061401
594 Ga0070710_10122873
595 Ga0070701_10654511
596 Ga0070711_100324328
597 Ga0070711_100789902
598 Ga0070705_100129006
599 Ga0070705_100880980
600 Ga0070700_100576654
601 Ga0070708_100176467
602 Ga0070708_100562198
603 Ga0070663_100067924
604 Ga0070663_100132653
605 Ga0070678_100121248
606 Ga0070681_10878781
607 Ga0068867_100643119
608 Ga0070706_100587331
609 Ga0070707_100022649
610 Ga0070707_100085329
611 Ga0070707_100514133
612 Ga0070698_100026873
613 Ga0070698_100657264
614 Ga0070699_100326603
615 Ga0070699_100400089
616 Ga0070679_100525105
617 Ga0070679_101115685
618 Ga0070684_100029951
619 Ga0070684_100804996
620 Ga0070684_101450607
621 Ga0068853_101276478
622 Ga0070696_100277954
623 Ga0070693_100285740
624 Ga0070693_100673776
625 Ga0070665_101356110
626 Ga0070704_100523423
627 Ga0068855_100245088
628 Ga0068855_100509003
629 Ga0068855_101437795
630 Ga0068857_100345671
631 Ga0068854_100125846
632 Ga0068856_100168067
633 Ga0070702_100327859
634 Ga0070702_101047137
635 Ga0068866_11113736
636 Ga0068861_100662412
637 Ga0068851_10290770
638 Ga0068870_10212746
639 Ga0068863_100106190
640 Ga0068863_100467275
641 Ga0068858_100459577
642 Ga0068858_100922099
643 Ga0068858_101053968
644 Ga0068860_100117076
645 Ga0068860_100854971
646 Ga0070717_10047573
647 Ga0070717_11089557
648 Ga0070717_11209699
649 Ga0075364_10416669
650 Ga0070715_10046130
651 Ga0070715_10199833
652 Ga0070715_10525471
653 Ga0070716_100239937
654 Ga0070716_100810668
655 Ga0070712_100057861
656 Ga0097621_100038878
657 Ga0097621_100049275
658 Ga0068871_100252174
659 Ga0075430_100023232
660 Ga0075434_100199682
661 Ga0068865_102075091
662 Ga0099794_10463237
663 Ga0099795_10043879
664 Ga0105244_10421226
665 Ga0105240_10250933
666 Ga0105240_10475697
667 Ga0105245_10219832
668 Ga0105245_11369791
669 Ga0114129_10783472
670 Ga0105242_12943892
671 Ga0105248_10208476
672 Ga0105237_11960755
673 Ga0105238_10493007
674 Ga0105249_10229555
675 Ga0105239_10167882
676 Ga0105239_11783325
677 Ga0157336_1005164
678 Ga0157335_1014491
679 Ga0157347_1071684
680 Ga0157339_1014905
681 Ga0157324_1012844
682 Ga0157342_1028926
683 Ga0157338_1002553
684 Ga0157373_10185421
685 Ga0157371_10446451
686 Ga0157370_10122604
687 Ga0157370_11799152
688 Ga0157369_10061614
689 Ga0157369_10693568
690 Ga0157374_11597412
691 Ga0163162_10704251
692 Ga0163162_12753749
693 Ga0157372_10030723
694 Ga0157372_10398022
695 Ga0157372_10954117
696 Ga0157372_12860032
697 Ga0157375_11391257
698 Ga0163163_10082418
699 Ga0163163_10153196
700 Ga0157380_12539708
701 Ga0157377_10424062
702 Ga0157377_10467691
703 Ga0157379_10029007
704 Ga0157376_10016592
705 Ga0157376_10580027
706 Ga0197907_11223136
707 Ga0206349_1772343
708 Ga0206353_10684539
709 Ga0213876_10657169
710 Ga0213875_10223813
711 Ga0224571_105875
712 Ga0207426_1004073
713 Ga0207426_1008207
714 Ga0207653_10011401
715 Ga0207692_10011367
716 Ga0207692_10026942
717 Ga0207692_10280931
718 Ga0207692_10335776
719 Ga0207710_10336862
720 Ga0207688_10021231
721 Ga0207680_10290075
722 Ga0207685_10019446
723 Ga0207699_10149567
724 Ga0207699_10173530
725 Ga0207699_10406777
726 Ga0207699_10786351
727 Ga0207645_10187414
728 Ga0207643_10115421
729 Ga0207705_10681771
730 Ga0207684_10018290
731 Ga0207654_10368940
732 Ga0207707_10412635
733 Ga0207695_10300241
734 Ga0207695_11017572
735 Ga0207693_10036655
736 Ga0207663_10005994
737 Ga0207663_10169156
738 Ga0207663_10303155
739 Ga0207660_11437753
740 Ga0207662_10190922
741 Ga0207657_10060448
742 Ga0207649_10330187
743 Ga0207652_10486781
744 Ga0207646_10071056
745 Ga0207646_10103205
746 Ga0207646_10992466
747 Ga0207694_10295819
748 Ga0207650_10966465
749 Ga0207659_10698516
750 Ga0207687_10768278
751 Ga0207700_10006238
752 Ga0207700_10650929
753 Ga0207700_11040274
754 Ga0207664_10004019
755 Ga0207664_10025998
756 Ga0207664_10031893
757 Ga0207664_10037739
758 Ga0207664_10097772
759 Ga0207664_10919635
760 Ga0207686_10674992
761 Ga0207709_11197709
762 Ga0207670_10750805
763 Ga0207669_10230656
764 Ga0207704_10977725
765 Ga0207704_11345330
766 Ga0207665_10054246
767 Ga0207691_10412857
768 Ga0207711_10652068
769 Ga0207711_11882945
770 Ga0207689_10069388
771 Ga0207661_11333769
772 Ga0207679_10339368
773 Ga0207667_10422285
774 Ga0207712_11056813
775 Ga0207658_10625130
776 Ga0207677_11656396
777 Ga0207703_11031632
778 Ga0207678_10012701
779 Ga0207678_10667111
780 Ga0207708_10840744
781 Ga0207702_10043925
782 Ga0207702_10088757
783 Ga0207641_10095687
784 Ga0207648_10770824
785 Ga0207674_10080982
786 Ga0207674_10379607
787 Ga0207683_10339752
788 Ga0207698_11040568
789 Ga0209371_1084714
790 Ga0265356_1034333
791 Ga0265357_1006906
792 Ga0265355_1025085
793 Ga0268266_10169825
794 Ga0268266_10900382
795 Ga0268264_11866279
796 Ga0265337_1004656
797 Ga0265326_10028346
798 Ga0265319_1028692
799 Ga0265334_10004271
800 Ga0265318_10249686
801 Ga0265323_10003673
802 Ga0265322_10045310
803 Ga0265336_10004786
804 Ga0265336_10005059
805 Ga0307515_10039596
806 Ga0265338_10003091
807 Ga0265338_10007032
808 Ga0265338_10014314
809 Ga0265324_10171960
810 Ga0268256_1093777
811 Ga0307511_10003062
812 Ga0307512_10006188
813 Ga0265762_1055247
814 Ga0265332_10034807
815 Ga0265320_10060527
816 Ga0265325_10027327
817 Ga0265340_10071461
818 Ga0265316_10157420
819 Ga0307509_10002102
820 Ga0307509_10029063
821 Ga0307509_10467497
822 Ga0265313_10015107
823 Ga0307508_10908163
824 Ga0307514_10001479
825 Ga0265314_10007420
826 Ga0265342_10001678
827 Ga0307405_10508048
828 Ga0307413_10110561
829 Ga0307413_11537609
830 Ga0307406_10206707
831 Ga0307407_10599398
832 Ga0307412_10795847
833 Ga0307409_101539253
834 Ga0307416_100792801
835 Ga0307415_100157623
836 Ga0307415_100350582
837 Ga0307507_10508078
838 Ga0307510_10361383
839 Ga0373948_0044367
840 Ga0373959_0049592
841 Ga0373928_0029175
842 Ga0373934_0001168
843 Ga0373944_0021693
844 Ga0373923_0094928
845 Ga0373923_0117497
846 Ga0373932_0092672
847 Ga0373932_0274797
848 Ga0373941_0206229
849 Ga0373945_0002724
850 Ga0373945_0064007
851 Ga0373953_0000283
852 Ga0373954_0021338
853 Ga0373956_0004989
854 Ga0373956_0155484
855 Ga0373957_0043501
856 Ga0373960_0211848
857 Ga0373960_0237715
858 Ga0373943_0047078
859 Ga0373955_0004224
860 Ga0373955_0092748
861 Ga0373962_0177067
862 Ga0373924_0005873
863 Ga0373924_0260421
864 Ga0373935_0005018
865 Ga0373935_0247503
866 Ga0373935_0443092
867 Ga0373927_0008751
868 Ga0373933_0001632
869 Ga0373933_0181467
870 Ga0373947_0003535
871 Ga0373947_0437944
872 Ga0373937_0002187
873 Ga0373937_0007786
874 Ga0373937_0030785
875 Ga0373937_0201769
876 Ga0373937_0745831
877 Ga0310112_013462
878 Ga0372808_031693
879 Ga0373925_0000725
880 Ga0373925_0009947
881 Ga0373925_0013089
882 Ga0373925_1674572
883 Ga0436364_0620055
884 Ga0436364_0820693
885 Ga0436364_0830807
886 Ga0436364_1079932
887 Ga0436364_1266426
888 Ga0395901_0595735
889 Ga0436360_0925995
890 Ga0436361_0133635
891 Ga0436363_0610257
892 Ga0436362_0376449
893 Ga0436362_0641169
894 Ga0451791_0615758
895 Ga0451853_3560626
896 Ga0439455_0178899
897 Ga0450920_003200
898 Ga0495627_170673
899 Ga0495592_0004429
900 Ga0495603_0004037
901 Ga0495629_0006062
902 Ga0495629_0497514
903 Ga0495641_0003242
904 Ga0495651_0002623
905 Ga0495651_0003309
906 Ga0495651_0190136
907 Ga0495653_0004390
908 Ga0495653_0006054
909 Ga0495653_0098263
910 Ga0495653_0681613
911 Ga0495580_0011915
912 Ga0495582_0004122
913 Ga0495639_0002463
914 Ga0495662_0000703
915 Ga0495664_0053377
916 Ga0495664_0763260
917 Ga0495594_0061074
918 Ga0495594_0305709
919 Ga0495608_0001419
920 Ga0495608_0003311
921 Ga0495618_0036587
922 Ga0495618_0041925
923 Ga0495628_0008387
924 Ga0495628_0036249
925 Ga0495628_0062336
926 Ga0495630_0007188
927 Ga0495630_0054078
928 Ga0495666_0006798
929 Ga0495652_0009274
930 Ga0495652_0013110
931 Ga0495652_0195089
932 Ga0495652_0544852
933 Ga0495665_0001680
934 Ga0495665_0066118
935 Ga0495665_0568415
936 Ga0495640_0002878
937 Ga0495640_0030589
938 Ga0495586_0001054
939 Ga0495587_0010222
940 Ga0495587_0010486
941 Ga0495587_0170086
942 Ga0495598_0098219
943 Ga0495645_0010472
944 Ga0495645_0055390
945 Ga0495645_0071549
946 Ga0495645_0078158
947 Ga0495622_0022135
948 Ga0495633_0019023
949 Ga0495667_0006537
950 Ga0495667_0018263
951 Ga0495667_0119609
952 Ga0495667_0313312
953 Ga0495634_0004533
954 Ga0495635_0005981
955 Ga0495635_0010028
956 Ga0495635_0684781
957 Ga0495659_0072399
958 Ga0495657_0003776
959 Ga0495657_0004453
960 Ga0495657_0021008
961 Ga0495623_0020557
962 Ga0495623_0237258
963 Ga0495646_0000844
964 Ga0495646_0013992
965 Ga0495646_0194369
966 Ga0495658_0017155
967 Ga0495658_0348247
968 Ga0495613_0008380
969 Ga0495613_0332241
970 Ga0495624_0001075
971 Ga0495670_0002186
972 Ga0495671_0170770
973 Ga0495649_0296861
974 Ga0495600_0000820
975 Ga0495600_0182462
976 Ga0495581_0000564
977 Ga0495604_0005121
978 Ga0495604_0053644
979 Ga0495636_0002578
980 Ga0495674_0001803
981 Ga0495674_0097964
982 Ga0495674_0316749
983 Ga0495676_0009465
984 Ga0495680_0003721
985 Ga0495680_0005403
986 Ga0495680_0075812
987 Ga0495680_0194852
988 Ga0495675_0346485
989 Ga0495685_181969
990 Ga0495684_0006527
991 Ga0495684_0010870
992 Ga0495684_0033867
993 Ga0495684_0372809
994 Ga0495593_0000672
995 Ga0495602_0022027
996 Ga0495602_0028177
997 Ga0495602_0195067
998 Ga0495614_0093973
999 Ga0496100_0884130
1000 Ga0496102_0557900
1001 Ga0496103_0499405
1002 Ga0496104_0018743
1003 Ga0496104_0338919
1004 Ga0496104_0373783
1005 Ga0496104_0394836
1006 Ga0496104_0623440
1007 Ga0496105_0014845
1008 Ga0496105_0136550
1009 Ga0496106_1177238
1010 Ga0496108_0024061
1011 Ga0496108_0105987
1012 Ga0496108_0693256
1013 Ga0496108_1069845
1014 Ga0496109_0396117
1015 Ga0496109_0766918
1016 Ga0496109_1571566
1017 Ga0496110_0053543
1018 Ga0496110_1090407
1019 Ga0496111_0051330
1020 Ga0496111_0345017
1021 Ga0496112_0248781
1022 Ga0496112_0574119
1023 Ga0496112_0771244
1024 Ga0496113_0816354
1025 Ga0496114_0822708
1026 Ga0496115_0212291
1027 Ga0496115_0235785
1028 Ga0496115_0334647
1029 Ga0496116_0000099
1030 Ga0496117_0117724
1031 Ga0496118_0000465
1032 Ga0496119_0012985
1033 Ga0496120_0070219
1034 Ga0496121_0030106
1035 Ga0496121_0342425
1036 Ga0496121_0550400
1037 Ga0496122_0006608
1038 Ga0496122_0013341
1039 Ga0496122_0025624
1040 Ga0496123_0013067
1041 Ga0496124_0001775
1042 Ga0496126_0240163
1043 Ga0496126_0521051
1044 Ga0496126_0521053
1045 Ga0501031_0064248
1046 Ga0501032_0061734
1047 Ga0501033_0105366
1048 Ga0501034_0268668
1049 Ga0501034_0603385
1050 Ga0501038_0715066
1051 Ga0501039_0439903
1052 Ga0501043_0750755
1053 Ga0501046_0902373
1054 Ga0501047_0049280
1055 Ga0501047_1253171
1056 Ga0501068_0382712
1057 Ga0501282_008853
1058 Ga0501035_1207319
1059 Ga0501044_0243024
1060 nmdc:mga00v17_831189_c1
1061 nmdc:mga0rr50_225580_c1
1062 nmdc:mga0a205_27529_c1
1063 Ga0495601_0003485
1064 Ga0495601_0259934
1065 Ga0495601_0449467
1066 Ga0495612_0004887
1067 Ga0495595_0362378
1068 Ga0495619_0002912
1069 Ga0500644_0088242
1070 Ga0500566_0203611
1071 Ga0500650_0066261
1072 Ga0500553_122009
1073 Ga0500556_0000028
1074 Ga0500560_014741
1075 Ga0500560_054989
1076 Ga0500559_0024781
1077 Ga0500568_0044933
1078 Ga0500573_0000024
1079 Ga0500573_0003019
1080 Ga0500573_0031040
1081 Ga0500573_0180240
1082 Ga0500573_0371371
1083 Ga0500573_0532648
1084 Ga0500577_0015151
1085 Ga0500577_0039603
1086 Ga0500577_0241892
1087 Ga0500603_052471
1088 2548697958
1089 2583149534
1090 2644015594
1091 2644176998
1092 2644670638
1093 2852644235
1094 2870622379
1095 8002784897
1096 8047710457
1097 8048137420
1098 8054109362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

137

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.7746 1 122
4naz-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with zn and sulfate at 1.15 angstrom resolution 0.7714 1 122
1kll-assembly1.cif.gz_A-2 molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7688 7 120
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7665 1 122
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7653 1 122
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.896 69 119 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8643 69 119 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8406 70 120 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8349 71 117 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8022 71 119 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6B3EMP5-F1-model_v4 VOC family protein 0.9858 19 116
AF-A0A6H9YTM5-F1-model_v4 VOC family protein 0.9688 16 121
AF-A0A6B3EMP5-F1-model_v4 VOC family protein 0.9663 19 116
AF-A0A841AJY4-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9654 3 122 GO:0016829
AF-A0A7K1W6L4-F1-model_v4 VOC family protein 0.9653 1 122

Map