F462414

General Info

Members Datasets Scaffolds Average Seq Length
549 300 493 283

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0001581|Ga0495661_0001581_14140_15180
Length 337
Sequence MRFKILDESFFGILLIFLLSIYFGITNSNVKYFVSLHYLKDLEIDMAWFKREIKGIITTTEEKKEAPDGIWNKCPNCKKPLHYSEQVENQYVCHYCGFHLRIGSKEYFSVLFDDNQFTELFTNLHSGDPLQFTDSKKYTDRVAETQKKTGLQDAIRTAHGKMNGQELIIACMDFNFIGGSMGSVVGEKIARSIDYAIANKVPFLMISKSGGARMMEAAFSLMQMAKTSAKLALLSQAKVPYISLLTDPTTGGVTASYAMLGDINIAEPGALIGFAGPRVIKETIKKDLPKGFQTAEFVQEHGFLDFIVDRREMKEKLASFLKMLTPVSEKEKPEPQV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
13 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
14 2818991437 Pedobacter terrae 518 Isolate Unclassified
15 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
16 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
17 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
18 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
19 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
20 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
21 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
22 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
23 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
24 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
25 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
26 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
27 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
28 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
29 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
30 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
31 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
32 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
33 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
34 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
35 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
36 2914759650 Rhizosphaericola mali Isolate Rhizosphere
37 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
38 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
39 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
40 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
41 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
42 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
43 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
44 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
45 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
46 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
47 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
48 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
49 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
50 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
51 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
52 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
53 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
54 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
55 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
56 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
57 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
58 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
59 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
60 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
61 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
62 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
67 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
68 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
69 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
70 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
71 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
82 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
83 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
89 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
94 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
156 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
206 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
207 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
208 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
209 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
236 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
263 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
279 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
280 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
281 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
282 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
283 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
284 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
292 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
293 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
296 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
297 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
298 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
299 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
300 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 0.55
Isolates 10.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.02
Nodule 0
Rhizoplane 0.73
Rhizosphere 76.5
Stem 0
Stem Tuber 0
Unclassified 12.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1886170 2162886007 Bacteria 206362
2 JGI24736J21556_1001968 3300001904 Bacteria 3649
3 JGI24739J22299_10004404 3300001989 Bacteria 5396
4 JGI24737J22298_10001541 3300001990 Bacteria 8204
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI25162J39368_1000062 3300002737 Bacteria 135587
7 JGI25162J39368_1001209 3300002737 Bacteria 15032
8 JGI25154J39366_1000070 3300002738 Bacteria 94929
9 JGI25157J39369_1005251 3300002741 Bacteria 2143
10 JGI25164J39214_1001080 3300002772 Bacteria 8007
11 JGI25152J39213_1000228 3300002773 Bacteria 37959
12 JGI25150J39212_1000002 3300002774 Bacteria 537631
13 JGI25151J46595_10000003 3300003187 Bacteria 715330
14 JGI25165J46597_1000862 3300003214 Bacteria 21841
15 JGI25153J46596_10000003 3300003215 Bacteria 553253
16 rootH1_10054021 3300003316 Bacteria 3940
17 rootH2_10010799 3300003320 Bacteria 73291
18 rootH2_10016472 3300003320 Bacteria 21539
19 rootH2_10115657 3300003320 Bacteria 3789
20 rootH2_10129398 3300003320 Bacteria 1930
21 rootL2_10000697 3300003322 Bacteria 31272
22 rootL2_10014627 3300003322 Bacteria 7627
23 rootL2_10061513 3300003322 Bacteria 9713
24 rootL2_10184829 3300003322 Bacteria 3136
25 rootH1_10004448 3300003323 Bacteria 17228
26 rootH1_10018482 3300003323 Bacteria 48371
27 rootH1_10030641 3300003323 Bacteria 9103
28 rootH1_10065780 3300003323 Bacteria 2414
29 rootH1_10067209 3300003323 Bacteria 2856
30 rootH1_10189091 3300003323 Bacteria 8329
31 rootH1_10191902 3300003323 Bacteria 3342
32 rootH1_10208198 3300003323 Bacteria 3888
33 JGI25160J50197_1005737 3300003354 Bacteria 5120
34 JGI25160J50197_1005862 3300003354 Bacteria 5056
35 Ga0055536_1000007 3300003781 Bacteria 345133
36 Ga0055528_1000123 3300003790 Bacteria 61846
37 Ga0055530_10000315 3300003791 Bacteria 43745
38 Ga0055531_10000199 3300003794 Bacteria 66228
39 Ga0058863_11867852 3300004799 Bacteria 1612
40 Ga0065165_1000964 3300005262 Bacteria 36144
41 Ga0065165_1001006 3300005262 Bacteria 34463
42 Ga0065714_10021073 3300005288 Bacteria 1602
43 Ga0065714_10064736 3300005288 Bacteria 20673
44 Ga0065714_10064842 3300005288 Bacteria 17197
45 Ga0065714_10064999 3300005288 Bacteria 14257
46 Ga0065714_10067791 3300005288 Bacteria 5192
47 Ga0065714_10122169 3300005288 Bacteria 1335
48 Ga0065714_10140281 3300005288 Bacteria 1177
49 Ga0065704_10000196 3300005289 Bacteria 186428
50 Ga0065704_10070159 3300005289 Bacteria 207348
51 Ga0070658_10000018 3300005327 Bacteria 200558
52 Ga0070658_10052697 3300005327 Bacteria 3301
53 Ga0070658_10067457 3300005327 Bacteria 2923
54 Ga0070676_10000592 3300005328 Bacteria 17567
55 Ga0070683_100018345 3300005329 Bacteria 6195
56 Ga0070666_10274502 3300005335 Bacteria 1197
57 Ga0068868_100204443 3300005338 Bacteria 1648
58 Ga0070660_100013515 3300005339 Bacteria 5858
59 Ga0070660_100240772 3300005339 Bacteria 1474
60 Ga0070671_100054322 3300005355 Bacteria 3330
61 Ga0070671_100063852 3300005355 Bacteria 3067
62 Ga0070673_100000909 3300005364 Bacteria 16718
63 Ga0070659_100000899 3300005366 Bacteria 21771
64 Ga0070659_100005511 3300005366 Bacteria 9090
65 Ga0070667_100011017 3300005367 Bacteria 7479
66 Ga0070667_100116903 3300005367 Bacteria 2316
67 Ga0070678_100000238 3300005456 Bacteria 25199
68 Ga0070678_100310567 3300005456 Unclassified 1343
69 Ga0070662_100000343 3300005457 Bacteria 27936
70 Ga0070681_10039739 3300005458 Bacteria 4715
71 Ga0068867_100001894 3300005459 Bacteria 14557
72 Ga0070679_100005153 3300005530 Bacteria 12090
73 Ga0070679_100047159 3300005530 Bacteria 4296
74 Ga0070684_100052825 3300005535 Bacteria 3535
75 Ga0068853_100132257 3300005539 Bacteria 2235
76 Ga0070672_100239621 3300005543 Bacteria 1525
77 Ga0070686_100174142 3300005544 Bacteria 1524
78 Ga0070665_100000072 3300005548 Bacteria 198575
79 Ga0068855_100000019 3300005563 Bacteria 205963
80 Ga0068855_100000268 3300005563 Bacteria 64693
81 Ga0068855_100172836 3300005563 Bacteria 2446
82 Ga0068855_100218561 3300005563 Bacteria 2138
83 Ga0068855_100226241 3300005563 Bacteria 2096
84 Ga0068855_100380335 3300005563 Bacteria 1550
85 Ga0068855_100881177 3300005563 Bacteria 947
86 Ga0068857_100046936 3300005577 Bacteria 3834
87 Ga0068857_100123678 3300005577 Bacteria 2331
88 Ga0068857_100184182 3300005577 Bacteria 1901
89 Ga0068854_100008502 3300005578 Bacteria 6604
90 Ga0068856_100000169 3300005614 Bacteria 67660
91 Ga0068856_100021303 3300005614 Bacteria 6299
92 Ga0068852_100000143 3300005616 Bacteria 48192
93 Ga0068859_100137787 3300005617 Bacteria 2514
94 Ga0068859_100504294 3300005617 Unclassified 1305
95 Ga0068864_100111591 3300005618 Bacteria 2436
96 Ga0068864_100270808 3300005618 Bacteria 1582
97 Ga0068866_10030819 3300005718 Bacteria 2578
98 Ga0068861_100006042 3300005719 Bacteria 8234
99 Ga0068870_10047532 3300005840 Bacteria 2256
100 Ga0068863_100021852 3300005841 Bacteria 6105
101 Ga0068863_100240825 3300005841 Bacteria 1746
102 Ga0068860_100711676 3300005843 Bacteria 1014
103 Ga0068862_100292051 3300005844 Bacteria 1497
104 Ga0070712_100053138 3300006175 Bacteria 2828
105 Ga0075366_10000961 3300006195 Bacteria 14068
106 Ga0075366_10194155 3300006195 Bacteria 1234
107 Ga0097621_100000028 3300006237 Bacteria 71678
108 Ga0097621_100009878 3300006237 Bacteria 6949
109 Ga0097621_100071696 3300006237 Bacteria 2864
110 Ga0075370_10232099 3300006353 Bacteria 1092
111 Ga0068871_100000066 3300006358 Bacteria 57980
112 Ga0068871_100010581 3300006358 Bacteria 6741
113 Ga0075428_100010948 3300006844 Bacteria 10086
114 Ga0068865_100000551 3300006881 Bacteria 20805
115 Ga0068865_100016114 3300006881 Bacteria 4775
116 Ga0068865_100029273 3300006881 Bacteria 3652
117 Ga0097620_100137786 3300006931 Bacteria 2514
118 Ga0097620_100504288 3300006931 Unclassified 1305
119 Ga0105240_10000101 3300009093 Bacteria 175584
120 Ga0105240_10000876 3300009093 Bacteria 54171
121 Ga0105240_10007839 3300009093 Bacteria 15410
122 Ga0105240_10010800 3300009093 Bacteria 12792
123 Ga0105240_10032200 3300009093 Bacteria 6790
124 Ga0105240_10185334 3300009093 Bacteria 2452
125 Ga0105240_10209025 3300009093 Bacteria 2282
126 Ga0105240_10271500 3300009093 Bacteria 1952
127 Ga0111539_10014965 3300009094 Bacteria 9670
128 Ga0111539_10035501 3300009094 Bacteria 6035
129 Ga0105243_10000018 3300009148 Bacteria 227618
130 Ga0105241_10000711 3300009174 Bacteria 25180
131 Ga0105241_10047696 3300009174 Bacteria 3258
132 Ga0105241_10066425 3300009174 Bacteria 2789
133 Ga0105242_10069360 3300009176 Bacteria 2920
134 Ga0105242_10376012 3300009176 Bacteria 1319
135 Ga0105237_10000233 3300009545 Bacteria 79346
136 Ga0105237_10001267 3300009545 Bacteria 33722
137 Ga0105237_10004344 3300009545 Bacteria 16428
138 Ga0105237_10004508 3300009545 Bacteria 16094
139 Ga0105237_10008720 3300009545 Bacteria 10948
140 Ga0105237_10031167 3300009545 Bacteria 5409
141 Ga0105237_10275025 3300009545 Bacteria 1687
142 Ga0105237_10359679 3300009545 Bacteria 1460
143 Ga0105238_10011396 3300009551 Bacteria 8952
144 Ga0105249_10577472 3300009553 Bacteria 1177
145 Ga0105239_10000039 3300010375 Bacteria 203537
146 Ga0105239_10000120 3300010375 Bacteria 110003
147 Ga0105239_10007416 3300010375 Bacteria 12582
148 Ga0105239_10010474 3300010375 Bacteria 10366
149 Ga0105239_10012753 3300010375 Bacteria 9351
150 Ga0105239_10020244 3300010375 Bacteria 7341
151 Ga0105239_10066459 3300010375 Bacteria 3961
152 Ga0105239_10094383 3300010375 Bacteria 3304
153 Ga0105239_10097938 3300010375 Unclassified 3242
154 Ga0105239_10507994 3300010375 Bacteria 1371
155 Ga0105239_10639125 3300010375 Bacteria 1215
156 Ga0105246_10095876 3300011119 Bacteria 2149
157 Ga0157373_10000119 3300013100 Bacteria 62053
158 Ga0157373_10002289 3300013100 Bacteria 14512
159 Ga0157373_10003518 3300013100 Bacteria 11841
160 Ga0157373_10018802 3300013100 Bacteria 5028
161 Ga0157373_10028902 3300013100 Bacteria 3997
162 Ga0157373_10053100 3300013100 Bacteria 2882
163 Ga0157371_10000051 3300013102 Bacteria 180272
164 Ga0157371_10010651 3300013102 Bacteria 7143
165 Ga0157370_10004580 3300013104 Bacteria 15829
166 Ga0157370_10007990 3300013104 Bacteria 11465
167 Ga0157370_10064293 3300013104 Bacteria 3474
168 Ga0157370_10373754 3300013104 Bacteria 1313
169 Ga0157369_10003815 3300013105 Bacteria 17903
170 Ga0157369_10213536 3300013105 Bacteria 2022
171 Ga0157369_10226384 3300013105 Bacteria 1956
172 Ga0157374_10000174 3300013296 Bacteria 59597
173 Ga0157374_10000451 3300013296 Bacteria 37378
174 Ga0157374_10002057 3300013296 Bacteria 16909
175 Ga0157378_10011058 3300013297 Bacteria 7900
176 Ga0157378_10012838 3300013297 Bacteria 7332
177 Ga0157378_10180546 3300013297 Unclassified 1985
178 Ga0163162_10000010 3300013306 Bacteria 302032
179 Ga0163162_10000130 3300013306 Bacteria 68177
180 Ga0163162_10019184 3300013306 Bacteria 6706
181 Ga0163162_10034850 3300013306 Bacteria 5011
182 Ga0163162_10370790 3300013306 Bacteria 1565
183 Ga0163162_10677908 3300013306 Bacteria 1154
184 Ga0157372_10004462 3300013307 Bacteria 14931
185 Ga0157372_10006504 3300013307 Bacteria 12440
186 Ga0157372_10007335 3300013307 Bacteria 11734
187 Ga0157372_10011866 3300013307 Bacteria 9281
188 Ga0157372_10016704 3300013307 Bacteria 7878
189 Ga0157372_10078278 3300013307 Bacteria 3736
190 Ga0157372_10459042 3300013307 Bacteria 1485
191 Ga0157372_10476719 3300013307 Bacteria 1455
192 Ga0157375_10002618 3300013308 Bacteria 15594
193 Ga0157375_10030135 3300013308 Bacteria 5112
194 Ga0157375_10376740 3300013308 Bacteria 1586
195 Ga0157375_10598031 3300013308 Bacteria 1262
196 Ga0157375_10626248 3300013308 Bacteria 1234
197 Ga0163163_10007115 3300014325 Bacteria 9837
198 Ga0157380_10000033 3300014326 Bacteria 86616
199 Ga0157380_10000222 3300014326 Bacteria 33923
200 Ga0157380_10132335 3300014326 Bacteria 2130
201 Ga0157380_10135632 3300014326 Unclassified 2106
202 Ga0182008_10000023 3300014497 Bacteria 201526
203 Ga0182008_10000130 3300014497 Bacteria 57208
204 Ga0182008_10000318 3300014497 Bacteria 37908
205 Ga0157377_10269387 3300014745 Bacteria 1111
206 Ga0157379_10133658 3300014968 Bacteria 2234
207 Ga0157379_10185911 3300014968 Unclassified 1878
208 Ga0157376_10010880 3300014969 Bacteria 6681
209 Ga0157376_10012633 3300014969 Bacteria 6276
210 Ga0182006_1000463 3300015261 Bacteria 31833
211 Ga0182006_1000679 3300015261 Bacteria 23846
212 Ga0182006_1001093 3300015261 Bacteria 17379
213 Ga0182006_1003323 3300015261 Bacteria 8290
214 Ga0182006_1005128 3300015261 Bacteria 6297
215 Ga0182007_10000010 3300015262 Bacteria 286070
216 Ga0182007_10047943 3300015262 Bacteria 1412
217 Ga0183373_1005 3300015682 Bacteria 351562
218 Ga0163161_10000494 3300017792 Bacteria 32399
219 Ga0163161_10002036 3300017792 Bacteria 14637
220 Ga0163161_10003356 3300017792 Bacteria 11225
221 Ga0163161_10006926 3300017792 Bacteria 7839
222 Ga0163161_10021333 3300017792 Bacteria 4553
223 Ga0163161_10028887 3300017792 Bacteria 3940
224 Ga0163161_10053816 3300017792 Bacteria 2920
225 Ga0163161_10174137 3300017792 Bacteria 1647
226 Ga0209436_101879 3300025208 Bacteria 6802
227 Ga0207427_100172 3300025231 Bacteria 71550
228 Ga0209437_100034 3300025233 Bacteria 494007
229 Ga0209437_100177 3300025233 Bacteria 135759
230 Ga0207425_1000004 3300025245 Bacteria 1092421
231 Ga0209646_1000006 3300025246 Bacteria 694084
232 Ga0209026_1000514 3300025250 Bacteria 27275
233 Ga0209026_1000773 3300025250 Bacteria 17887
234 Ga0209026_1004898 3300025250 Bacteria 3785
235 Ga0209129_1000005 3300025258 Bacteria 777812
236 Ga0209233_1000038 3300025261 Bacteria 548972
237 Ga0209233_1029808 3300025261 Bacteria 1292
238 Ga0209130_1003000 3300025284 Bacteria 7642
239 Ga0209676_1000058 3300025292 Bacteria 345185
240 Ga0209025_1000009 3300025294 Bacteria 1092561
241 Ga0209564_1004568 3300025295 Bacteria 8386
242 Ga0209758_1000010 3300025297 Bacteria 1092782
243 Ga0209758_1013068 3300025297 Bacteria 4567
244 Ga0209758_1042001 3300025297 Bacteria 1701
245 Ga0209050_1000054 3300025298 Bacteria 345186
246 Ga0209050_1000163 3300025298 Bacteria 154895
247 Ga0207426_1000060 3300025302 Bacteria 363139
248 Ga0207426_1000096 3300025302 Bacteria 271627
249 Ga0207426_1001679 3300025302 Bacteria 17104
250 Ga0209257_1000007 3300025304 Bacteria 1564415
251 Ga0207642_10023066 3300025899 Bacteria 2480
252 Ga0207642_10124341 3300025899 Bacteria 1336
253 Ga0207680_10253204 3300025903 Bacteria 1217
254 Ga0207647_10000076 3300025904 Bacteria 75824
255 Ga0207647_10000328 3300025904 Bacteria 38905
256 Ga0207647_10025186 3300025904 Bacteria 3914
257 Ga0207645_10000190 3300025907 Bacteria 49657
258 Ga0207645_10133096 3300025907 Bacteria 1619
259 Ga0207705_10000036 3300025909 Bacteria 200787
260 Ga0207654_10000978 3300025911 Bacteria 15688
261 Ga0207654_10018596 3300025911 Bacteria 3650
262 Ga0207654_10033278 3300025911 Bacteria 2857
263 Ga0207707_10012762 3300025912 Bacteria 7307
264 Ga0207695_10000013 3300025913 Bacteria 821265
265 Ga0207695_10000020 3300025913 Bacteria 723025
266 Ga0207695_10003385 3300025913 Bacteria 22535
267 Ga0207695_10022802 3300025913 Bacteria 7092
268 Ga0207695_10356171 3300025913 Bacteria 1350
269 Ga0207671_10000443 3300025914 Bacteria 57065
270 Ga0207671_10000663 3300025914 Bacteria 44922
271 Ga0207671_10009443 3300025914 Bacteria 8154
272 Ga0207671_10009580 3300025914 Bacteria 8077
273 Ga0207671_10011450 3300025914 Bacteria 7221
274 Ga0207671_10036835 3300025914 Bacteria 3628
275 Ga0207657_10015372 3300025919 Bacteria 7416
276 Ga0207657_10215563 3300025919 Bacteria 1539
277 Ga0207652_10021742 3300025921 Bacteria 5298
278 Ga0207652_10036895 3300025921 Bacteria 4134
279 Ga0207650_10148048 3300025925 Bacteria 1851
280 Ga0207644_10166571 3300025931 Bacteria 1717
281 Ga0207690_10000594 3300025932 Bacteria 23425
282 Ga0207690_10008298 3300025932 Bacteria 6161
283 Ga0207690_10271355 3300025932 Bacteria 1318
284 Ga0207706_10000778 3300025933 Bacteria 33033
285 Ga0207709_10000021 3300025935 Bacteria 386722
286 Ga0207704_10000073 3300025938 Bacteria 62449
287 Ga0207704_10139459 3300025938 Bacteria 1693
288 Ga0207661_10033249 3300025944 Bacteria 4001
289 Ga0207667_10000020 3300025949 Bacteria 374770
290 Ga0207667_10001079 3300025949 Bacteria 34634
291 Ga0207667_10128280 3300025949 Bacteria 2613
292 Ga0207667_10157776 3300025949 Bacteria 2334
293 Ga0207667_10171392 3300025949 Bacteria 2230
294 Ga0207667_10488774 3300025949 Bacteria 1249
295 Ga0207667_10821044 3300025949 Bacteria 925
296 Ga0207712_10118340 3300025961 Bacteria 2000
297 Ga0207640_10005901 3300025981 Bacteria 6684
298 Ga0207658_10210183 3300025986 Bacteria 1630
299 Ga0207639_10007665 3300026041 Bacteria 7369
300 Ga0207639_10080213 3300026041 Bacteria 2581
301 Ga0207702_10000142 3300026078 Bacteria 85850
302 Ga0207702_10012032 3300026078 Bacteria 7194
303 Ga0207702_10385618 3300026078 Bacteria 1348
304 Ga0207641_10120838 3300026088 Bacteria 2337
305 Ga0207648_10000347 3300026089 Bacteria 50952
306 Ga0207648_10148148 3300026089 Bacteria 2071
307 Ga0207676_10144704 3300026095 Bacteria 2040
308 Ga0207676_10166219 3300026095 Bacteria 1917
309 Ga0207674_10056997 3300026116 Bacteria 3963
310 Ga0207674_10091362 3300026116 Bacteria 3034
311 Ga0207674_10102419 3300026116 Bacteria 2843
312 Ga0207675_100024685 3300026118 Bacteria 5590
313 Ga0207683_10007777 3300026121 Bacteria 9171
314 Ga0207698_10006150 3300026142 Bacteria 7474
315 Ga0207428_10070634 3300027907 Bacteria 2744
316 Ga0268266_10000089 3300028379 Bacteria 198566
317 Ga0268266_10025443 3300028379 Bacteria 5035
318 Ga0268265_10640897 3300028380 Bacteria 1020
319 Ga0268264_10005664 3300028381 Bacteria 10587
320 Ga0268264_10293974 3300028381 Bacteria 1527
321 Ga0307517_10006296 3300028786 Bacteria 17624
322 Ga0307515_10000039 3300028794 Bacteria 323229
323 Ga0307515_10000912 3300028794 Bacteria 67995
324 Ga0307515_10030446 3300028794 Bacteria 9061
325 Ga0307515_10194559 3300028794 Bacteria 1925
326 Ga0307515_10304008 3300028794 Bacteria 1277
327 Ga0265338_10015011 3300028800 Bacteria 8555
328 Ga0265338_10167597 3300028800 Bacteria 1689
329 Ga0316176_1025728 3300030732 Bacteria 12200
330 Ga0314311_1087192 3300030733 Bacteria 2072
331 Ga0316183_1116149 3300030742 Bacteria 41729
332 Ga0316181_1017950 3300030744 Bacteria 10916
333 Ga0265320_10102832 3300031240 Bacteria 1314
334 Ga0265327_10000060 3300031251 Bacteria 234933
335 Ga0265327_10000486 3300031251 Bacteria 69971
336 Ga0265327_10090043 3300031251 Bacteria 1498
337 Ga0265327_10129623 3300031251 Bacteria 1188
338 Ga0307513_10130748 3300031456 Bacteria 2457
339 Ga0307513_10220899 3300031456 Bacteria 1716
340 Ga0307509_10017143 3300031507 Bacteria 8347
341 Ga0307509_10090283 3300031507 Bacteria 3140
342 Ga0307408_100002098 3300031548 Bacteria 14350
343 Ga0307408_100002491 3300031548 Bacteria 12886
344 Ga0307408_100066776 3300031548 Bacteria 2643
345 Ga0316578_10177631 3300031728 Bacteria 1283
346 Ga0307405_10000035 3300031731 Bacteria 92134
347 Ga0307405_10036709 3300031731 Bacteria 2938
348 Ga0307405_10154680 3300031731 Bacteria 1617
349 Ga0307410_10301184 3300031852 Bacteria 1265
350 Ga0307406_10043872 3300031901 Bacteria 2800
351 Ga0307407_10000005 3300031903 Bacteria 233125
352 Ga0307407_10047189 3300031903 Bacteria 2443
353 Ga0307412_10000004 3300031911 Bacteria 544053
354 Ga0307412_10037239 3300031911 Bacteria 3124
355 Ga0307412_10099943 3300031911 Bacteria 2049
356 Ga0307412_10252671 3300031911 Bacteria 1370
357 Ga0307412_10285675 3300031911 Bacteria 1297
358 Ga0307409_100014722 3300031995 Bacteria 5102
359 Ga0307409_100027618 3300031995 Bacteria 4026
360 Ga0307409_100444132 3300031995 Bacteria 1250
361 Ga0307416_100000001 3300032002 Bacteria 515017
362 Ga0307416_100000449 3300032002 Bacteria 21114
363 Ga0307414_10000053 3300032004 Bacteria 121338
364 Ga0307414_10000313 3300032004 Bacteria 28201
365 Ga0307414_10000728 3300032004 Bacteria 16847
366 Ga0307414_10003862 3300032004 Bacteria 8065
367 Ga0307414_10008529 3300032004 Bacteria 5819
368 Ga0307414_10039712 3300032004 Bacteria 3172
369 Ga0307414_10057237 3300032004 Bacteria 2739
370 Ga0307414_10078893 3300032004 Bacteria 2401
371 Ga0307414_10145709 3300032004 Bacteria 1860
372 Ga0307414_10211643 3300032004 Bacteria 1585
373 Ga0307411_10097827 3300032005 Bacteria 2067
374 Ga0307411_10407345 3300032005 Bacteria 1126
375 Ga0307507_10000010 3300033179 Bacteria 265208
376 Ga0307510_10001230 3300033180 Bacteria 27766
377 Ga0316592_1019832 3300033524 Bacteria 1424
378 Ga0316574_0037325 3300035398 Bacteria 2979
379 Ga0395899_0000002 3300037312 Bacteria 1324310
380 Ga0395899_0000303 3300037312 Bacteria 63241
381 Ga0395899_0000592 3300037312 Bacteria 38093
382 Ga0395899_0070537 3300037312 Bacteria 2558
383 Ga0395900_0000277 3300037418 Bacteria 77256
384 Ga0395898_0010001 3300037466 Bacteria 9931
385 Ga0395905_0000068 3300037471 Bacteria 177163
386 Ga0395901_0000199 3300038443 Bacteria 76415
387 Ga0395901_0027080 3300038443 Bacteria 5888
388 Ga0436361_0232809 3300039447 Bacteria 15069
389 Ga0451807_1181290 3300041486 Bacteria 2248
390 Ga0451837_0086056 3300041494 Bacteria 5428
391 Ga0439431_0001987 3300041997 Bacteria 4537
392 Ga0439445_0017844 3300042004 Bacteria 1757
393 Ga0451577_0014881 3300042876 Bacteria 7248
394 Ga0451577_0037290 3300042876 Bacteria 4376
395 Ga0451577_0176253 3300042876 Bacteria 1927
396 Ga0451577_0512015 3300042876 Bacteria 1090
397 Ga0453683_0133402 3300044673 Bacteria 1566
398 Ga0453684_0001590 3300044712 Bacteria 62492
399 Ga0453684_0002802 3300044712 Bacteria 41228
400 Ga0453684_0011767 3300044712 Bacteria 14586
401 Ga0453684_0023845 3300044712 Bacteria 8981
402 Ga0453684_0062828 3300044712 Bacteria 4754
403 Ga0453684_0208609 3300044712 Bacteria 2273
404 Ga0466959_0004429 3300045049 Bacteria 9406
405 Ga0466959_0046967 3300045049 Bacteria 3177
406 Ga0451576_0000022 3300045051 Bacteria 495037
407 Ga0451576_0003579 3300045051 Bacteria 21131
408 Ga0451576_0004172 3300045051 Bacteria 19028
409 Ga0451576_0197229 3300045051 Bacteria 2103
410 Ga0495651_0225998 3300046462 Bacteria 1292
411 Ga0495650_0000003 3300046471 Bacteria 900730
412 Ga0495585_0000470 3300046492 Bacteria 38600
413 Ga0495607_0077801 3300046501 Bacteria 1832
414 Ga0495606_0000116 3300046507 Bacteria 134901
415 Ga0495606_0013476 3300046507 Bacteria 6452
416 Ga0495606_0019202 3300046507 Bacteria 5095
417 Ga0495610_0000074 3300046512 Bacteria 120043
418 Ga0495610_0009249 3300046512 Bacteria 6249
419 Ga0495616_0002212 3300046513 Bacteria 13010
420 Ga0495616_0023927 3300046513 Bacteria 3282
421 Ga0495644_0005847 3300046523 Bacteria 4805
422 Ga0495648_0028081 3300046524 Bacteria 3752
423 Ga0495640_0165714 3300046533 Bacteria 1414
424 Ga0495609_0009982 3300046538 Bacteria 4573
425 Ga0495609_0049027 3300046538 Bacteria 1886
426 Ga0495633_0000044 3300046558 Bacteria 171185
427 Ga0495633_0008176 3300046558 Bacteria 5925
428 Ga0495633_0042602 3300046558 Bacteria 2155
429 Ga0495668_0000003 3300046616 Bacteria 695023
430 Ga0495668_0000453 3300046616 Bacteria 52477
431 Ga0495625_0000219 3300046660 Bacteria 90690
432 Ga0495625_0001258 3300046660 Bacteria 31973
433 Ga0495625_0006083 3300046660 Bacteria 10825
434 Ga0495625_0042616 3300046660 Bacteria 3297
435 Ga0495625_0071120 3300046660 Bacteria 2442
436 Ga0495661_0001581 3300046665 Bacteria 18761
437 Ga0495661_0013096 3300046665 Bacteria 5581
438 Ga0495670_0018136 3300046691 Bacteria 3466
439 Ga0495649_0000037 3300046694 Bacteria 133848
440 Ga0495649_0051439 3300046694 Bacteria 2234
441 Ga0495589_0049862 3300046794 Bacteria 2072
442 Ga0495636_0000020 3300047318 Bacteria 75085
443 Ga0495683_0018276 3300047323 Bacteria 3627
444 Ga0495687_000484 3300047443 Bacteria 48242
445 Ga0495677_0015361 3300047445 Bacteria 2782
446 Ga0495686_0000372 3300047472 Bacteria 72285
447 Ga0495686_0000577 3300047472 Bacteria 51975
448 Ga0495686_0001661 3300047472 Bacteria 23172
449 Ga0495686_0097410 3300047472 Bacteria 1778
450 Ga0496114_0345954 3300048917 Bacteria 1315
451 Ga0496115_0029326 3300048918 Bacteria 4321
452 Ga0496117_0000934 3300048920 Bacteria 44763
453 Ga0496122_0000390 3300048925 Bacteria 93522
454 Ga0496122_0048016 3300048925 Bacteria 3288
455 Ga0496123_0002978 3300048926 Bacteria 19669
456 Ga0496123_0027922 3300048926 Bacteria 4190
457 Ga0496123_0158119 3300048926 Bacteria 1212
458 Ga0496124_0208206 3300048927 Bacteria 1482
459 Ga0496126_0006314 3300048929 Bacteria 13234
460 Ga0496126_0244711 3300048929 Bacteria 1497
461 Ga0495678_059423 3300049459 Bacteria 1441
462 Ga0501323_001747 3300049539 Bacteria 1996
463 Ga0501034_0044922 3300049571 Bacteria 4465
464 Ga0501043_0044700 3300049579 Unclassified 3483
465 Ga0501069_0096030 3300049585 Bacteria 1679
466 Ga0501217_010525 3300049661 Bacteria 2028
467 Ga0501223_000879 3300049663 Bacteria 7121
468 Ga0501257_006823 3300049686 Bacteria 2541
469 Ga0501241_000198 3300049758 Bacteria 13561
470 Ga0501241_011801 3300049758 Bacteria 1587
471 Ga0501264_000422 3300049761 Bacteria 6502
472 Ga0501269_004089 3300049766 Bacteria 1754
473 Ga0501271_003249 3300049768 Bacteria 1490
474 Ga0501035_0174039 3300049822 Bacteria 1858
475 Ga0501035_0420340 3300049822 Bacteria 1110
476 Ga0501044_0117254 3300049823 Bacteria 2667
477 nmdc:mga0k408_1234_c1 3300050493 Bacteria 13998
478 nmdc:mga0k408_31885_c1 3300050493 Bacteria 3011
479 nmdc:mga07m45_181158_c1 3300050496 Bacteria 1225
480 nmdc:mga08y16_17307_c1 3300050511 Bacteria 7587
481 nmdc:mga08y16_42456_c1 3300050511 Bacteria 4763
482 Ga0500651_0000168 3300053093 Bacteria 42658
483 Ga0500562_008431 3300053108 Bacteria 2604
484 Ga0500608_000453 3300053122 Bacteria 15356
485 Ga0500608_166265 3300053122 Bacteria 950
486 Ga0500618_000001 3300053125 Bacteria 538477
487 Ga0500616_0000013 3300053153 Bacteria 674172
488 Ga0500616_0000698 3300053153 Bacteria 39124
489 Ga0500622_0000017 3300053156 Bacteria 332114
490 Ga0500622_0000058 3300053156 Bacteria 134237
491 Ga0500622_0000584 3300053156 Bacteria 33074
492 Ga0500624_000539 3300053157 Bacteria 10713
493 Ga0500636_0176844 3300053177 Bacteria 1149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005719 Ga0068861_100006042 Ga0068861_1000060428 256
2 3300013308 Ga0157375_10376740 Ga0157375_103767402 256
3 3300026118 Ga0207675_100024685 Ga0207675_1000246855 256
4 3300013297 Ga0157378_10012838 Ga0157378_100128385 265
5 3300025907 Ga0207645_10133096 Ga0207645_101330963 266
6 3300026089 Ga0207648_10148148 Ga0207648_101481482 266
7 3300031911 Ga0307412_10285675 Ga0307412_102856752 266
8 3300017792 Ga0163161_10003356 Ga0163161_100033566 269
9 3300031251 Ga0265327_10000060 Ga0265327_10000060110 271
10 3300013306 Ga0163162_10000130 Ga0163162_1000013058 272
11 3300046501 Ga0495607_0077801 Ga0495607_0077801_957_1811 272
12 3300006237 Ga0097621_100071696 Ga0097621_1000716963 273
13 3300006881 Ga0068865_100016114 Ga0068865_1000161141 273
14 3300013297 Ga0157378_10180546 Ga0157378_101805462 273
15 3300014969 Ga0157376_10012633 Ga0157376_100126336 273
16 3300025938 Ga0207704_10139459 Ga0207704_101394592 273
17 3300002773 JGI25152J39213_1000228 JGI25152J39213_100022825 274
18 3300002774 JGI25150J39212_1000002 JGI25150J39212_1000002170 274
19 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003486 274
20 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003318 274
21 3300003781 Ga0055536_1000007 Ga0055536_100000752 274
22 3300005288 Ga0065714_10021073 Ga0065714_100210731 274
23 3300005563 Ga0068855_100218561 Ga0068855_1002185612 274
24 3300013100 Ga0157373_10028902 Ga0157373_100289024 274
25 3300013104 Ga0157370_10373754 Ga0157370_103737542 274
26 3300013105 Ga0157369_10003815 Ga0157369_1000381511 274
27 3300014497 Ga0182008_10000318 Ga0182008_100003187 274
28 3300015261 Ga0182006_1000463 Ga0182006_100046324 274
29 3300015261 Ga0182006_1000679 Ga0182006_10006792 274
30 3300015262 Ga0182007_10000010 Ga0182007_10000010221 274
31 3300017792 Ga0163161_10006926 Ga0163161_100069261 274
32 3300025245 Ga0207425_1000004 Ga0207425_1000004773 274
33 3300025258 Ga0209129_1000005 Ga0209129_1000005169 274
34 3300025292 Ga0209676_1000058 Ga0209676_100005851 274
35 3300025294 Ga0209025_1000009 Ga0209025_1000009773 274
36 3300025297 Ga0209758_1000010 Ga0209758_1000010774 274
37 3300025298 Ga0209050_1000054 Ga0209050_100005451 274
38 3300031731 Ga0307405_10000035 Ga0307405_100000351 274
39 3300031903 Ga0307407_10000005 Ga0307407_1000000567 274
40 3300031995 Ga0307409_100027618 Ga0307409_1000276182 274
41 3300032002 Ga0307416_100000001 Ga0307416_100000001381 274
42 3300032004 Ga0307414_10145709 Ga0307414_101457092 274
43 3300032005 Ga0307411_10407345 Ga0307411_104073451 274
44 3300047318 Ga0495636_0000020 Ga0495636_0000020_39655_40512 274
45 3300014326 Ga0157380_10000222 Ga0157380_100002227 276
46 iso_pu_bacteria 2721755487 2722726436 276
47 iso_pu_bacteria 2842903701 2842904002 276
48 iso_pu_bacteria 2881247448 2881249201 276
49 iso_pu_bacteria 2884634485 2884637713 276
50 iso_pu_bacteria 2887375801 2887380188 276
51 iso_pu_bacteria 2890737413 2890740070 276
52 iso_pu_bacteria 2896344016 2896346629 276
53 iso_pu_bacteria 2898713307 2898716606 276
54 iso_pu_bacteria 2904780799 2904783692 276
55 iso_pu_bacteria 2919177583 2919182243 276
56 iso_pu_bacteria 2919509842 2919510815 276
57 iso_pu_bacteria 2919692658 2919693876 276
58 iso_pu_bacteria 2958512119 2958514807 276
59 iso_pu_bacteria 3003233435 3003233470 276
60 iso_pu_bacteria 8036736890 8036738916 276
61 3300009093 Ga0105240_10000101 Ga0105240_1000010131 277
62 3300010375 Ga0105239_10020244 Ga0105239_100202448 277
63 3300025913 Ga0207695_10000020 Ga0207695_10000020668 277
64 iso_pu_bacteria 2585427687 2586208523 277
65 iso_pu_bacteria 2738541283 2738754345 277
66 iso_pu_bacteria 2738541284 2738763042 277
67 iso_pu_bacteria 2738541302 2738856671 277
68 iso_pu_bacteria 2738543023 2739301802 277
69 iso_pu_bacteria 2739367651 2739590096 277
70 iso_pu_bacteria 2739367656 2739615335 277
71 iso_pu_bacteria 2739367663 2739644297 277
72 iso_pu_bacteria 2775506987 2776614674 277
73 iso_pu_bacteria 2818991437 2819548515 277
74 iso_pu_bacteria 2842722452 2842722912 277
75 iso_pu_bacteria 2842909656 2842913345 277
76 iso_pu_bacteria 2849281842 2849284478 277
77 iso_pu_bacteria 2852627209 2852627738 277
78 iso_pu_bacteria 2857627736 2857631169 277
79 iso_pu_bacteria 2902048731 2902051820 277
80 iso_pu_bacteria 2904445276 2904448520 277
81 iso_pu_bacteria 2919186247 2919187915 277
82 iso_pu_bacteria 2939664404 2939664818 277
83 iso_pu_bacteria 2945997725 2945999872 277
84 iso_pu_bacteria 2954016120 2954016489 277
85 iso_pu_bacteria 8055588893 8055590753 277
86 3300005327 Ga0070658_10067457 Ga0070658_100674573 278
87 3300028380 Ga0268265_10640897 Ga0268265_106408971 278
88 3300028794 Ga0307515_10000039 Ga0307515_10000039122 278
89 iso_pu_bacteria 2818991460 2819678102 278
90 iso_pu_bacteria 2881955468 2881956638 278
91 iso_pu_bacteria 2884791551 2884792948 278
92 iso_pu_bacteria 2929177148 2929181190 278
93 iso_pu_bacteria 2929921140 2929925087 278
94 iso_pu_bacteria 2945977869 2945983594 278
95 iso_pu_bacteria 2946013367 2946017018 278
96 iso_pu_bacteria 8003151029 8003157336 278
97 3300003320 rootH2_10010799 rootH2_1001079929 279
98 3300003322 rootL2_10000697 rootL2_1000069721 279
99 3300003322 rootL2_10014627 rootL2_100146273 279
100 3300003322 rootL2_10061513 rootL2_100615136 279
101 3300003794 Ga0055531_10000199 Ga0055531_100001998 279
102 3300005563 Ga0068855_100172836 Ga0068855_1001728362 279
103 3300005577 Ga0068857_100123678 Ga0068857_1001236783 279
104 3300005614 Ga0068856_100021303 Ga0068856_1000213032 279
105 3300005617 Ga0068859_100137787 Ga0068859_1001377872 279
106 3300005617 Ga0068859_100504294 Ga0068859_1005042941 279
107 3300005618 Ga0068864_100270808 Ga0068864_1002708082 279
108 3300005841 Ga0068863_100240825 Ga0068863_1002408252 279
109 3300005844 Ga0068862_100292051 Ga0068862_1002920512 279
110 3300006931 Ga0097620_100137786 Ga0097620_1001377862 279
111 3300006931 Ga0097620_100504288 Ga0097620_1005042881 279
112 3300014326 Ga0157380_10132335 Ga0157380_101323352 279
113 3300025304 Ga0209257_1000007 Ga0209257_1000007419 279
114 3300025949 Ga0207667_10171392 Ga0207667_101713922 279
115 3300026078 Ga0207702_10012032 Ga0207702_100120325 279
116 3300026078 Ga0207702_10385618 Ga0207702_103856181 279
117 3300026095 Ga0207676_10144704 Ga0207676_101447042 279
118 3300026116 Ga0207674_10056997 Ga0207674_100569971 279
119 3300028794 Ga0307515_10194559 Ga0307515_101945591 279
120 3300031251 Ga0265327_10090043 Ga0265327_100900431 279
121 3300031507 Ga0307509_10017143 Ga0307509_100171434 279
122 3300031507 Ga0307509_10090283 Ga0307509_100902832 279
123 3300041486 Ga0451807_1181290 Ga0451807_1181290_1160_1999 279
124 3300042876 Ga0451577_0037290 Ga0451577_0037290_3515_4354 279
125 3300042876 Ga0451577_0176253 Ga0451577_0176253_562_1401 279
126 3300044673 Ga0453683_0133402 Ga0453683_0133402_115_954 279
127 3300044712 Ga0453684_0001590 Ga0453684_0001590_35995_36834 279
128 3300045051 Ga0451576_0003579 Ga0451576_0003579_14419_15258 279
129 3300045051 Ga0451576_0004172 Ga0451576_0004172_17542_18381 279
130 3300045051 Ga0451576_0197229 Ga0451576_0197229_159_998 279
131 3300049585 Ga0501069_0096030 Ga0501069_0096030_793_1632 279
132 3300053108 Ga0500562_008431 Ga0500562_008431_530_1369 279
133 3300053156 Ga0500622_0000017 Ga0500622_0000017_148745_149584 279
134 3300053156 Ga0500622_0000058 Ga0500622_0000058_40716_41555 279
135 iso_pu_bacteria 2739367866 2740031309 279
136 iso_pu_bacteria 2884933994 2884938079 279
137 3300003323 rootH1_10208198 rootH1_102081982 280
138 3300005262 Ga0065165_1001006 Ga0065165_100100611 280
139 3300006844 Ga0075428_100010948 Ga0075428_1000109487 280
140 3300009094 Ga0111539_10014965 Ga0111539_100149658 280
141 3300009094 Ga0111539_10035501 Ga0111539_100355012 280
142 3300009148 Ga0105243_10000018 Ga0105243_1000001832 280
143 3300009545 Ga0105237_10008720 Ga0105237_100087208 280
144 3300014326 Ga0157380_10135632 Ga0157380_101356322 280
145 3300017792 Ga0163161_10174137 Ga0163161_101741371 280
146 3300025914 Ga0207671_10036835 Ga0207671_100368352 280
147 3300025935 Ga0207709_10000021 Ga0207709_10000021161 280
148 3300027907 Ga0207428_10070634 Ga0207428_100706342 280
149 3300030732 Ga0316176_1025728 Ga0316176_102572814 280
150 3300030733 Ga0314311_1087192 Ga0314311_10871922 280
151 3300030742 Ga0316183_1116149 Ga0316183_111614938 280
152 3300030744 Ga0316181_1017950 Ga0316181_10179504 280
153 3300031456 Ga0307513_10220899 Ga0307513_102208992 280
154 3300031548 Ga0307408_100066776 Ga0307408_1000667762 280
155 3300031852 Ga0307410_10301184 Ga0307410_103011842 280
156 3300031901 Ga0307406_10043872 Ga0307406_100438722 280
157 3300031903 Ga0307407_10047189 Ga0307407_100471893 280
158 3300031911 Ga0307412_10037239 Ga0307412_100372393 280
159 3300031995 Ga0307409_100014722 Ga0307409_1000147227 280
160 3300032002 Ga0307416_100000449 Ga0307416_10000044911 280
161 3300032004 Ga0307414_10000053 Ga0307414_1000005374 280
162 3300032004 Ga0307414_10003862 Ga0307414_100038623 280
163 3300032004 Ga0307414_10078893 Ga0307414_100788932 280
164 3300032005 Ga0307411_10097827 Ga0307411_100978273 280
165 3300033524 Ga0316592_1019832 Ga0316592_10198322 280
166 3300035398 Ga0316574_0037325 Ga0316574_0037325_506_1363 280
167 3300041494 Ga0451837_0086056 Ga0451837_0086056_2474_3340 280
168 3300042004 Ga0439445_0017844 Ga0439445_0017844_823_1665 280
169 3300042876 Ga0451577_0014881 Ga0451577_0014881_314_1198 280
170 3300042876 Ga0451577_0512015 Ga0451577_0512015_119_964 280
171 3300044712 Ga0453684_0002802 Ga0453684_0002802_11571_12455 280
172 3300048920 Ga0496117_0000934 Ga0496117_0000934_29310_30152 280
173 3300048925 Ga0496122_0048016 Ga0496122_0048016_871_1713 280
174 3300048926 Ga0496123_0027922 Ga0496123_0027922_2063_2905 280
175 3300048927 Ga0496124_0208206 Ga0496124_0208206_50_892 280
176 3300049539 Ga0501323_001747 Ga0501323_001747_1136_1978 280
177 3300049661 Ga0501217_010525 Ga0501217_010525_898_1740 280
178 3300049686 Ga0501257_006823 Ga0501257_006823_858_1700 280
179 3300049761 Ga0501264_000422 Ga0501264_000422_2759_3601 280
180 3300049768 Ga0501271_003249 Ga0501271_003249_134_976 280
181 3300050511 nmdc:mga08y16_17307_c1 nmdc:mga08y16_17307_c1_3263_4105 280
182 3300050511 nmdc:mga08y16_42456_c1 nmdc:mga08y16_42456_c1_2977_3831 280
183 3300053153 Ga0500616_0000013 Ga0500616_0000013_103865_104707 280
184 iso_pu_bacteria 2896317667 2896321068 280
185 3300001904 JGI24736J21556_1001968 JGI24736J21556_10019685 281
186 3300001990 JGI24737J22298_10001541 JGI24737J22298_100015416 281
187 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002398 281
188 3300002737 JGI25162J39368_1000062 JGI25162J39368_100006265 281
189 3300002737 JGI25162J39368_1001209 JGI25162J39368_100120916 281
190 3300002741 JGI25157J39369_1005251 JGI25157J39369_10052512 281
191 3300002772 JGI25164J39214_1001080 JGI25164J39214_10010803 281
192 3300003214 JGI25165J46597_1000862 JGI25165J46597_10008628 281
193 3300003316 rootH1_10054021 rootH1_100540213 281
194 3300003320 rootH2_10016472 rootH2_1001647220 281
195 3300003320 rootH2_10115657 rootH2_101156573 281
196 3300003320 rootH2_10129398 rootH2_101293982 281
197 3300003323 rootH1_10018482 rootH1_1001848217 281
198 3300003323 rootH1_10065780 rootH1_100657802 281
199 3300003323 rootH1_10067209 rootH1_100672092 281
200 3300003323 rootH1_10189091 rootH1_101890916 281
201 3300004799 Ga0058863_11867852 Ga0058863_118678521 281
202 3300005288 Ga0065714_10064736 Ga0065714_1006473625 281
203 3300005288 Ga0065714_10064842 Ga0065714_100648421 281
204 3300005288 Ga0065714_10064999 Ga0065714_1006499916 281
205 3300005288 Ga0065714_10067791 Ga0065714_100677912 281
206 3300005288 Ga0065714_10122169 Ga0065714_101221692 281
207 3300005288 Ga0065714_10140281 Ga0065714_101402811 281
208 3300005289 Ga0065704_10000196 Ga0065704_100001965 281
209 3300005327 Ga0070658_10000018 Ga0070658_1000001861 281
210 3300005327 Ga0070658_10052697 Ga0070658_100526974 281
211 3300005328 Ga0070676_10000592 Ga0070676_1000059221 281
212 3300005329 Ga0070683_100018345 Ga0070683_1000183456 281
213 3300005338 Ga0068868_100204443 Ga0068868_1002044432 281
214 3300005339 Ga0070660_100013515 Ga0070660_1000135155 281
215 3300005339 Ga0070660_100240772 Ga0070660_1002407722 281
216 3300005355 Ga0070671_100063852 Ga0070671_1000638523 281
217 3300005364 Ga0070673_100000909 Ga0070673_1000009096 281
218 3300005366 Ga0070659_100000899 Ga0070659_10000089922 281
219 3300005366 Ga0070659_100005511 Ga0070659_1000055118 281
220 3300005367 Ga0070667_100116903 Ga0070667_1001169032 281
221 3300005456 Ga0070678_100000238 Ga0070678_1000002387 281
222 3300005456 Ga0070678_100310567 Ga0070678_1003105672 281
223 3300005457 Ga0070662_100000343 Ga0070662_10000034311 281
224 3300005458 Ga0070681_10039739 Ga0070681_100397392 281
225 3300005459 Ga0068867_100001894 Ga0068867_10000189412 281
226 3300005530 Ga0070679_100005153 Ga0070679_10000515313 281
227 3300005530 Ga0070679_100047159 Ga0070679_1000471594 281
228 3300005535 Ga0070684_100052825 Ga0070684_1000528254 281
229 3300005539 Ga0068853_100132257 Ga0068853_1001322573 281
230 3300005543 Ga0070672_100239621 Ga0070672_1002396211 281
231 3300005548 Ga0070665_100000072 Ga0070665_10000007229 281
232 3300005563 Ga0068855_100000019 Ga0068855_100000019163 281
233 3300005563 Ga0068855_100000268 Ga0068855_10000026877 281
234 3300005563 Ga0068855_100226241 Ga0068855_1002262412 281
235 3300005563 Ga0068855_100380335 Ga0068855_1003803353 281
236 3300005563 Ga0068855_100881177 Ga0068855_1008811771 281
237 3300005577 Ga0068857_100184182 Ga0068857_1001841822 281
238 3300005578 Ga0068854_100008502 Ga0068854_1000085028 281
239 3300005614 Ga0068856_100000169 Ga0068856_10000016910 281
240 3300005616 Ga0068852_100000143 Ga0068852_10000014340 281
241 3300005718 Ga0068866_10030819 Ga0068866_100308193 281
242 3300005840 Ga0068870_10047532 Ga0068870_100475323 281
243 3300006195 Ga0075366_10000961 Ga0075366_1000096114 281
244 3300006195 Ga0075366_10194155 Ga0075366_101941551 281
245 3300006237 Ga0097621_100000028 Ga0097621_10000002857 281
246 3300006358 Ga0068871_100000066 Ga0068871_10000006654 281
247 3300006881 Ga0068865_100000551 Ga0068865_10000055116 281
248 3300009093 Ga0105240_10000876 Ga0105240_1000087625 281
249 3300009093 Ga0105240_10007839 Ga0105240_1000783910 281
250 3300009093 Ga0105240_10010800 Ga0105240_100108005 281
251 3300009093 Ga0105240_10032200 Ga0105240_100322007 281
252 3300009093 Ga0105240_10185334 Ga0105240_101853342 281
253 3300009093 Ga0105240_10271500 Ga0105240_102715002 281
254 3300009174 Ga0105241_10000711 Ga0105241_1000071116 281
255 3300009174 Ga0105241_10047696 Ga0105241_100476962 281
256 3300009174 Ga0105241_10066425 Ga0105241_100664251 281
257 3300009176 Ga0105242_10069360 Ga0105242_100693602 281
258 3300009176 Ga0105242_10376012 Ga0105242_103760122 281
259 3300009545 Ga0105237_10000233 Ga0105237_1000023340 281
260 3300009545 Ga0105237_10001267 Ga0105237_1000126726 281
261 3300009545 Ga0105237_10004344 Ga0105237_1000434413 281
262 3300009545 Ga0105237_10004508 Ga0105237_1000450811 281
263 3300009545 Ga0105237_10031167 Ga0105237_100311675 281
264 3300009551 Ga0105238_10011396 Ga0105238_100113961 281
265 3300009553 Ga0105249_10577472 Ga0105249_105774721 281
266 3300010375 Ga0105239_10000039 Ga0105239_1000003998 281
267 3300010375 Ga0105239_10000120 Ga0105239_1000012033 281
268 3300010375 Ga0105239_10007416 Ga0105239_100074162 281
269 3300010375 Ga0105239_10010474 Ga0105239_100104741 281
270 3300010375 Ga0105239_10012753 Ga0105239_100127535 281
271 3300010375 Ga0105239_10066459 Ga0105239_100664594 281
272 3300010375 Ga0105239_10507994 Ga0105239_105079941 281
273 3300010375 Ga0105239_10639125 Ga0105239_106391251 281
274 3300011119 Ga0105246_10095876 Ga0105246_100958762 281
275 3300013100 Ga0157373_10000119 Ga0157373_1000011919 281
276 3300013100 Ga0157373_10002289 Ga0157373_100022895 281
277 3300013100 Ga0157373_10003518 Ga0157373_100035185 281
278 3300013100 Ga0157373_10018802 Ga0157373_100188022 281
279 3300013100 Ga0157373_10053100 Ga0157373_100531002 281
280 3300013102 Ga0157371_10000051 Ga0157371_100000518 281
281 3300013102 Ga0157371_10010651 Ga0157371_100106515 281
282 3300013104 Ga0157370_10004580 Ga0157370_100045802 281
283 3300013104 Ga0157370_10007990 Ga0157370_100079907 281
284 3300013104 Ga0157370_10064293 Ga0157370_100642933 281
285 3300013105 Ga0157369_10213536 Ga0157369_102135361 281
286 3300013105 Ga0157369_10226384 Ga0157369_102263841 281
287 3300013296 Ga0157374_10000174 Ga0157374_1000017432 281
288 3300013296 Ga0157374_10000451 Ga0157374_100004517 281
289 3300013296 Ga0157374_10002057 Ga0157374_1000205718 281
290 3300013297 Ga0157378_10011058 Ga0157378_100110586 281
291 3300013306 Ga0163162_10000010 Ga0163162_1000001099 281
292 3300013306 Ga0163162_10034850 Ga0163162_100348503 281
293 3300013306 Ga0163162_10370790 Ga0163162_103707901 281
294 3300013307 Ga0157372_10004462 Ga0157372_100044629 281
295 3300013307 Ga0157372_10006504 Ga0157372_1000650410 281
296 3300013307 Ga0157372_10007335 Ga0157372_1000733510 281
297 3300013307 Ga0157372_10011866 Ga0157372_100118663 281
298 3300013307 Ga0157372_10078278 Ga0157372_100782781 281
299 3300013307 Ga0157372_10459042 Ga0157372_104590422 281
300 3300013307 Ga0157372_10476719 Ga0157372_104767191 281
301 3300013308 Ga0157375_10030135 Ga0157375_100301353 281
302 3300013308 Ga0157375_10598031 Ga0157375_105980312 281
303 3300013308 Ga0157375_10626248 Ga0157375_106262482 281
304 3300014497 Ga0182008_10000023 Ga0182008_10000023120 281
305 3300014497 Ga0182008_10000130 Ga0182008_1000013023 281
306 3300014745 Ga0157377_10269387 Ga0157377_102693871 281
307 3300015261 Ga0182006_1001093 Ga0182006_10010932 281
308 3300015261 Ga0182006_1003323 Ga0182006_10033232 281
309 3300015261 Ga0182006_1005128 Ga0182006_10051287 281
310 3300015262 Ga0182007_10047943 Ga0182007_100479431 281
311 3300015682 Ga0183373_1005 Ga0183373_1005197 281
312 3300017792 Ga0163161_10000494 Ga0163161_100004942 281
313 3300017792 Ga0163161_10021333 Ga0163161_100213335 281
314 3300017792 Ga0163161_10028887 Ga0163161_100288871 281
315 3300017792 Ga0163161_10053816 Ga0163161_100538162 281
316 3300025231 Ga0207427_100172 Ga0207427_10017223 281
317 3300025233 Ga0209437_100034 Ga0209437_100034128 281
318 3300025233 Ga0209437_100177 Ga0209437_10017764 281
319 3300025250 Ga0209026_1000514 Ga0209026_10005142 281
320 3300025250 Ga0209026_1004898 Ga0209026_10048985 281
321 3300025261 Ga0209233_1000038 Ga0209233_1000038128 281
322 3300025261 Ga0209233_1029808 Ga0209233_10298082 281
323 3300025899 Ga0207642_10023066 Ga0207642_100230663 281
324 3300025904 Ga0207647_10000076 Ga0207647_1000007644 281
325 3300025904 Ga0207647_10000328 Ga0207647_1000032822 281
326 3300025907 Ga0207645_10000190 Ga0207645_1000019045 281
327 3300025909 Ga0207705_10000036 Ga0207705_10000036134 281
328 3300025911 Ga0207654_10000978 Ga0207654_1000097812 281
329 3300025911 Ga0207654_10018596 Ga0207654_100185963 281
330 3300025911 Ga0207654_10033278 Ga0207654_100332784 281
331 3300025912 Ga0207707_10012762 Ga0207707_100127623 281
332 3300025913 Ga0207695_10000013 Ga0207695_10000013300 281
333 3300025913 Ga0207695_10022802 Ga0207695_100228025 281
334 3300025913 Ga0207695_10356171 Ga0207695_103561712 281
335 3300025914 Ga0207671_10000663 Ga0207671_1000066340 281
336 3300025914 Ga0207671_10009443 Ga0207671_100094435 281
337 3300025914 Ga0207671_10009580 Ga0207671_100095804 281
338 3300025914 Ga0207671_10011450 Ga0207671_100114505 281
339 3300025919 Ga0207657_10015372 Ga0207657_100153725 281
340 3300025919 Ga0207657_10215563 Ga0207657_102155631 281
341 3300025921 Ga0207652_10021742 Ga0207652_100217422 281
342 3300025921 Ga0207652_10036895 Ga0207652_100368954 281
343 3300025932 Ga0207690_10000594 Ga0207690_1000059425 281
344 3300025932 Ga0207690_10008298 Ga0207690_100082989 281
345 3300025932 Ga0207690_10271355 Ga0207690_102713551 281
346 3300025933 Ga0207706_10000778 Ga0207706_1000077812 281
347 3300025938 Ga0207704_10000073 Ga0207704_1000007359 281
348 3300025944 Ga0207661_10033249 Ga0207661_100332491 281
349 3300025949 Ga0207667_10000020 Ga0207667_100000206 281
350 3300025949 Ga0207667_10001079 Ga0207667_1000107911 281
351 3300025949 Ga0207667_10128280 Ga0207667_101282801 281
352 3300025949 Ga0207667_10157776 Ga0207667_101577761 281
353 3300025949 Ga0207667_10488774 Ga0207667_104887742 281
354 3300025949 Ga0207667_10821044 Ga0207667_108210441 281
355 3300025981 Ga0207640_10005901 Ga0207640_100059012 281
356 3300025986 Ga0207658_10210183 Ga0207658_102101831 281
357 3300026041 Ga0207639_10007665 Ga0207639_100076656 281
358 3300026041 Ga0207639_10080213 Ga0207639_100802135 281
359 3300026078 Ga0207702_10000142 Ga0207702_1000014278 281
360 3300026089 Ga0207648_10000347 Ga0207648_1000034753 281
361 3300026116 Ga0207674_10102419 Ga0207674_101024192 281
362 3300026121 Ga0207683_10007777 Ga0207683_100077777 281
363 3300026142 Ga0207698_10006150 Ga0207698_100061503 281
364 3300028379 Ga0268266_10000089 Ga0268266_1000008929 281
365 3300028381 Ga0268264_10293974 Ga0268264_102939742 281
366 3300028786 Ga0307517_10006296 Ga0307517_1000629616 281
367 3300028794 Ga0307515_10000912 Ga0307515_1000091242 281
368 3300028794 Ga0307515_10030446 Ga0307515_100304462 281
369 3300028800 Ga0265338_10015011 Ga0265338_100150119 281
370 3300028800 Ga0265338_10167597 Ga0265338_101675971 281
371 3300031240 Ga0265320_10102832 Ga0265320_101028322 281
372 3300031456 Ga0307513_10130748 Ga0307513_101307483 281
373 3300031548 Ga0307408_100002098 Ga0307408_10000209810 281
374 3300031548 Ga0307408_100002491 Ga0307408_1000024912 281
375 3300031728 Ga0316578_10177631 Ga0316578_101776311 281
376 3300031731 Ga0307405_10036709 Ga0307405_100367092 281
377 3300031731 Ga0307405_10154680 Ga0307405_101546802 281
378 3300031911 Ga0307412_10000004 Ga0307412_10000004242 281
379 3300031911 Ga0307412_10099943 Ga0307412_100999432 281
380 3300031911 Ga0307412_10252671 Ga0307412_102526713 281
381 3300031995 Ga0307409_100444132 Ga0307409_1004441321 281
382 3300032004 Ga0307414_10000313 Ga0307414_1000031321 281
383 3300032004 Ga0307414_10000728 Ga0307414_100007282 281
384 3300032004 Ga0307414_10039712 Ga0307414_100397121 281
385 3300032004 Ga0307414_10057237 Ga0307414_100572374 281
386 3300032004 Ga0307414_10211643 Ga0307414_102116432 281
387 3300033179 Ga0307507_10000010 Ga0307507_10000010124 281
388 3300033180 Ga0307510_10001230 Ga0307510_1000123016 281
389 3300037312 Ga0395899_0000002 Ga0395899_0000002_978361_979206 281
390 3300037312 Ga0395899_0000303 Ga0395899_0000303_59792_60637 281
391 3300037312 Ga0395899_0000592 Ga0395899_0000592_20577_21422 281
392 3300037418 Ga0395900_0000277 Ga0395900_0000277_68641_69486 281
393 3300037466 Ga0395898_0010001 Ga0395898_0010001_6615_7460 281
394 3300037471 Ga0395905_0000068 Ga0395905_0000068_21780_22625 281
395 3300038443 Ga0395901_0000199 Ga0395901_0000199_46320_47165 281
396 3300039447 Ga0436361_0232809 Ga0436361_0232809_12668_13513 281
397 3300041997 Ga0439431_0001987 Ga0439431_0001987_1819_2664 281
398 3300044712 Ga0453684_0023845 Ga0453684_0023845_1586_2455 281
399 3300044712 Ga0453684_0062828 Ga0453684_0062828_3602_4513 281
400 3300044712 Ga0453684_0208609 Ga0453684_0208609_50_901 281
401 3300045049 Ga0466959_0046967 Ga0466959_0046967_486_1331 281
402 3300045051 Ga0451576_0000022 Ga0451576_0000022_29059_29904 281
403 3300046462 Ga0495651_0225998 Ga0495651_0225998_264_1130 281
404 3300046471 Ga0495650_0000003 Ga0495650_0000003_839258_840103 281
405 3300046492 Ga0495585_0000470 Ga0495585_0000470_37226_38071 281
406 3300046507 Ga0495606_0000116 Ga0495606_0000116_11149_11994 281
407 3300046507 Ga0495606_0013476 Ga0495606_0013476_1858_2703 281
408 3300046507 Ga0495606_0019202 Ga0495606_0019202_1686_2531 281
409 3300046512 Ga0495610_0000074 Ga0495610_0000074_15349_16194 281
410 3300046512 Ga0495610_0009249 Ga0495610_0009249_365_1210 281
411 3300046513 Ga0495616_0002212 Ga0495616_0002212_10871_11716 281
412 3300046513 Ga0495616_0023927 Ga0495616_0023927_76_921 281
413 3300046523 Ga0495644_0005847 Ga0495644_0005847_581_1426 281
414 3300046524 Ga0495648_0028081 Ga0495648_0028081_967_1812 281
415 3300046533 Ga0495640_0165714 Ga0495640_0165714_526_1371 281
416 3300046538 Ga0495609_0009982 Ga0495609_0009982_62_928 281
417 3300046538 Ga0495609_0049027 Ga0495609_0049027_876_1721 281
418 3300046558 Ga0495633_0000044 Ga0495633_0000044_139609_140454 281
419 3300046558 Ga0495633_0008176 Ga0495633_0008176_4160_5005 281
420 3300046558 Ga0495633_0042602 Ga0495633_0042602_876_1721 281
421 3300046616 Ga0495668_0000003 Ga0495668_0000003_627340_628185 281
422 3300046660 Ga0495625_0000219 Ga0495625_0000219_74872_75717 281
423 3300046660 Ga0495625_0001258 Ga0495625_0001258_1178_2023 281
424 3300046660 Ga0495625_0006083 Ga0495625_0006083_3710_4555 281
425 3300046660 Ga0495625_0042616 Ga0495625_0042616_904_1800 281
426 3300046660 Ga0495625_0071120 Ga0495625_0071120_1254_2120 281
427 3300046665 Ga0495661_0013096 Ga0495661_0013096_2964_3809 281
428 3300046691 Ga0495670_0018136 Ga0495670_0018136_730_1575 281
429 3300046694 Ga0495649_0000037 Ga0495649_0000037_74671_75516 281
430 3300046694 Ga0495649_0051439 Ga0495649_0051439_277_1143 281
431 3300046794 Ga0495589_0049862 Ga0495589_0049862_992_1837 281
432 3300047323 Ga0495683_0018276 Ga0495683_0018276_2102_2968 281
433 3300047443 Ga0495687_000484 Ga0495687_000484_18496_19341 281
434 3300047445 Ga0495677_0015361 Ga0495677_0015361_103_948 281
435 3300047472 Ga0495686_0000372 Ga0495686_0000372_47287_48132 281
436 3300047472 Ga0495686_0001661 Ga0495686_0001661_17380_18246 281
437 3300047472 Ga0495686_0097410 Ga0495686_0097410_484_1329 281
438 3300048925 Ga0496122_0000390 Ga0496122_0000390_43129_43974 281
439 3300048926 Ga0496123_0002978 Ga0496123_0002978_14767_15612 281
440 3300049459 Ga0495678_059423 Ga0495678_059423_564_1409 281
441 3300049571 Ga0501034_0044922 Ga0501034_0044922_2081_2926 281
442 3300049663 Ga0501223_000879 Ga0501223_000879_4769_5614 281
443 3300049758 Ga0501241_011801 Ga0501241_011801_652_1497 281
444 3300050493 nmdc:mga0k408_1234_c1 nmdc:mga0k408_1234_c1_9814_10659 281
445 3300050493 nmdc:mga0k408_31885_c1 nmdc:mga0k408_31885_c1_59_925 281
446 3300053093 Ga0500651_0000168 Ga0500651_0000168_15290_16135 281
447 3300053122 Ga0500608_000453 Ga0500608_000453_7428_8294 281
448 3300053122 Ga0500608_166265 Ga0500608_166265_56_901 281
449 3300053125 Ga0500618_000001 Ga0500618_000001_113488_114333 281
450 3300053156 Ga0500622_0000584 Ga0500622_0000584_26025_26921 281
451 3300053157 Ga0500624_000539 Ga0500624_000539_2463_3308 281
452 iso_pu_bacteria 2599185184 2599478555 281
453 iso_pu_bacteria 2919437846 2919441020 281
454 iso_pu_bacteria 2928078545 2928080391 281
455 iso_pu_bacteria 2928147474 2928149436 281
456 iso_pu_bacteria 2932082852 2932083265 281
457 iso_pu_bacteria 2977232053 2977232844 281
458 3300001989 JGI24739J22299_10004404 JGI24739J22299_100044043 282
459 3300002738 JGI25154J39366_1000070 JGI25154J39366_100007037 282
460 3300003323 rootH1_10004448 rootH1_1000444813 282
461 3300003354 JGI25160J50197_1005737 JGI25160J50197_10057375 282
462 3300003354 JGI25160J50197_1005862 JGI25160J50197_10058623 282
463 3300003790 Ga0055528_1000123 Ga0055528_100012346 282
464 3300003791 Ga0055530_10000315 Ga0055530_100003154 282
465 3300005262 Ga0065165_1000964 Ga0065165_100096419 282
466 3300005577 Ga0068857_100046936 Ga0068857_1000469363 282
467 3300006353 Ga0075370_10232099 Ga0075370_102320991 282
468 3300010375 Ga0105239_10094383 Ga0105239_100943833 282
469 3300014326 Ga0157380_10000033 Ga0157380_1000003329 282
470 3300025208 Ga0209436_101879 Ga0209436_1018798 282
471 3300025246 Ga0209646_1000006 Ga0209646_1000006390 282
472 3300025250 Ga0209026_1000773 Ga0209026_10007739 282
473 3300025284 Ga0209130_1003000 Ga0209130_10030003 282
474 3300025295 Ga0209564_1004568 Ga0209564_10045682 282
475 3300025297 Ga0209758_1013068 Ga0209758_10130684 282
476 3300025297 Ga0209758_1042001 Ga0209758_10420013 282
477 3300025298 Ga0209050_1000163 Ga0209050_100016370 282
478 3300025302 Ga0207426_1000060 Ga0207426_1000060242 282
479 3300025302 Ga0207426_1000096 Ga0207426_1000096208 282
480 3300025302 Ga0207426_1001679 Ga0207426_10016797 282
481 3300026116 Ga0207674_10091362 Ga0207674_100913622 282
482 3300028794 Ga0307515_10304008 Ga0307515_103040081 282
483 3300044712 Ga0453684_0011767 Ga0453684_0011767_1221_2075 282
484 3300046665 Ga0495661_0001581 Ga0495661_0001581_14140_15180 282
485 3300048929 Ga0496126_0006314 Ga0496126_0006314_1999_2847 282
486 3300048929 Ga0496126_0244711 Ga0496126_0244711_221_1069 282
487 3300049758 Ga0501241_000198 Ga0501241_000198_5178_6026 282
488 3300049822 Ga0501035_0420340 Ga0501035_0420340_194_1042 282
489 3300050496 nmdc:mga07m45_181158_c1 nmdc:mga07m45_181158_c1_103_951 282
490 3300053177 Ga0500636_0176844 Ga0500636_0176844_208_1056 282
491 3300003322 rootL2_10184829 rootL2_101848292 283
492 3300003323 rootH1_10030641 rootH1_100306419 283
493 3300003323 rootH1_10191902 rootH1_101919023 283
494 3300005335 Ga0070666_10274502 Ga0070666_102745021 283
495 3300005355 Ga0070671_100054322 Ga0070671_1000543223 283
496 3300005367 Ga0070667_100011017 Ga0070667_1000110172 283
497 3300005618 Ga0068864_100111591 Ga0068864_1001115913 283
498 3300005841 Ga0068863_100021852 Ga0068863_1000218526 283
499 3300006175 Ga0070712_100053138 Ga0070712_1000531382 283
500 3300006237 Ga0097621_100009878 Ga0097621_1000098783 283
501 3300006358 Ga0068871_100010581 Ga0068871_1000105816 283
502 3300006881 Ga0068865_100029273 Ga0068865_1000292732 283
503 3300009545 Ga0105237_10275025 Ga0105237_102750253 283
504 3300010375 Ga0105239_10097938 Ga0105239_100979385 283
505 3300013306 Ga0163162_10019184 Ga0163162_100191843 283
506 3300013306 Ga0163162_10677908 Ga0163162_106779081 283
507 3300013307 Ga0157372_10016704 Ga0157372_100167048 283
508 3300013308 Ga0157375_10002618 Ga0157375_1000261813 283
509 3300014325 Ga0163163_10007115 Ga0163163_100071154 283
510 3300014968 Ga0157379_10133658 Ga0157379_101336582 283
511 3300014968 Ga0157379_10185911 Ga0157379_101859112 283
512 3300014969 Ga0157376_10010880 Ga0157376_100108806 283
513 3300017792 Ga0163161_10002036 Ga0163161_1000203612 283
514 3300025899 Ga0207642_10124341 Ga0207642_101243411 283
515 3300025903 Ga0207680_10253204 Ga0207680_102532041 283
516 3300025914 Ga0207671_10000443 Ga0207671_1000044341 283
517 3300025925 Ga0207650_10148048 Ga0207650_101480482 283
518 3300025931 Ga0207644_10166571 Ga0207644_101665713 283
519 3300025961 Ga0207712_10118340 Ga0207712_101183401 283
520 3300026088 Ga0207641_10120838 Ga0207641_101208382 283
521 3300026095 Ga0207676_10166219 Ga0207676_101662192 283
522 3300028381 Ga0268264_10005664 Ga0268264_1000566411 283
523 3300037312 Ga0395899_0070537 Ga0395899_0070537_1397_2296 283
524 3300038443 Ga0395901_0027080 Ga0395901_0027080_4742_5641 283
525 3300045049 Ga0466959_0004429 Ga0466959_0004429_6836_7747 283
526 3300046616 Ga0495668_0000453 Ga0495668_0000453_31104_31955 283
527 3300047472 Ga0495686_0000577 Ga0495686_0000577_36453_37304 283
528 3300048917 Ga0496114_0345954 Ga0496114_0345954_111_1022 283
529 3300048918 Ga0496115_0029326 Ga0496115_0029326_2090_2941 283
530 3300049579 Ga0501043_0044700 Ga0501043_0044700_731_1642 283
531 3300049766 Ga0501269_004089 Ga0501269_004089_26_877 283
532 3300049822 Ga0501035_0174039 Ga0501035_0174039_922_1833 283
533 3300053153 Ga0500616_0000698 Ga0500616_0000698_16249_17100 283
534 iso_pu_bacteria 2852623160 2852626872 283
535 iso_pu_bacteria 2914759650 2914760836 283
536 3300005843 Ga0068860_100711676 Ga0068860_1007116762 284
537 3300009093 Ga0105240_10209025 Ga0105240_102090251 284
538 3300009545 Ga0105237_10359679 Ga0105237_103596792 284
539 3300025904 Ga0207647_10025186 Ga0207647_100251862 284
540 3300025913 Ga0207695_10003385 Ga0207695_1000338517 284
541 3300028379 Ga0268266_10025443 Ga0268266_100254434 284
542 3300048926 Ga0496123_0158119 Ga0496123_0158119_65_934 284
543 3300049823 Ga0501044_0117254 Ga0501044_0117254_1745_2608 284
544 2162886007 SwRhRL2b_contig_1886170 SwRhRL2b_0728.00007920 285
545 3300005289 Ga0065704_10070159 Ga0065704_1007015922 285
546 3300005544 Ga0070686_100174142 Ga0070686_1001741421 285
547 3300031251 Ga0265327_10000486 Ga0265327_1000048665 285
548 3300031251 Ga0265327_10129623 Ga0265327_101296232 285
549 3300032004 Ga0307414_10008529 Ga0307414_100085293 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

128

336

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9641 27 280
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9509 27 283
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9457 27 280
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9369 27 285
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9297 27 285
ID Description Score Start End Superfamily
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9509 27 283 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9495 27 282 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9369 27 285 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.932 27 282 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9297 27 285 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2V9ITX8-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9947 197 280 GO:0003989
GO:0006633
GO:0009317
GO:0016740
GO:2001295
AF-A0A800ETI3-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9936 192 282 GO:0003989
GO:0006633
GO:0009317
GO:0016740
GO:2001295
AF-I1YL57-F1-model_v4 Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) 0.9913 202 283 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A2E0SNH6-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.991 203 280 GO:0003989
GO:0006633
GO:0009317
GO:0016740
GO:2001295
AF-A0A0F9DJE1-F1-model_v4 CoA carboxyltransferase N-terminal domain-containing protein 0.9892 179 281 GO:0003989
GO:0006633
GO:0009317
GO:2001295

Feature Viewer

pLDDT pTM Quality
83.69 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map