F462384

General Info

Members Datasets Scaffolds Average Seq Length
549 252 542 137

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10596572|Ga0307412_105965722
Length 166
Sequence MAGSRTVSVQWADRSTQSIWSIPLRKNPAMSILEAIVGPVSKLLDKIIPDPQARDRAKLELLKLQGDQEMQTITAQMQAIVAEAQSSDPWTSRARPSFLYVMYALLLWAIPMGLIAAARPEMAADIAKGMNAYLAGIPEPLYALFGTGYLGYTAARSWGKAKGVEK

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
7 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
8 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
9 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
152 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
194 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
195 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
196 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
197 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
198 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
199 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
200 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
213 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
216 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
217 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
218 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
219 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
222 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
223 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
224 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
225 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
226 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
229 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
230 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
231 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
232 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
233 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
234 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
235 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
236 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
240 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
252 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.29
Nodule 0
Rhizoplane 2.91
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_86265 2162886006 Bacteria 1676
2 SwRhRL2b_contig_650828 2162886007 Unclassified 930
3 JGI24752J21851_1000370 3300001976 Bacteria 6247
4 JGI24749J21850_1006682 3300002076 Bacteria 1605
5 JGI24742J22300_10022985 3300002244 Bacteria 1070
6 JGI24742J22300_10068936 3300002244 Bacteria 657
7 JGI24751J29686_10117683 3300002459 Bacteria 558
8 Ga0055536_1002465 3300003781 Bacteria 10393
9 Ga0055536_1003362 3300003781 Bacteria 8638
10 Ga0055536_1026479 3300003781 Bacteria 1624
11 Ga0055534_1017433 3300003784 Bacteria 1270
12 Ga0055530_10002163 3300003791 Bacteria 13024
13 Ga0055531_10002264 3300003794 Bacteria 13024
14 Ga0055531_10002939 3300003794 Bacteria 11088
15 JGI25405J52794_10014256 3300003911 Bacteria 1550
16 Ga0065704_10123386 3300005289 Bacteria 1734
17 Ga0065712_10353773 3300005290 Bacteria 784
18 Ga0065715_10135674 3300005293 Bacteria 1934
19 Ga0065715_10160311 3300005293 Bacteria 1636
20 Ga0065715_10165694 3300005293 Bacteria 1589
21 Ga0065707_10081814 3300005295 Bacteria 36963
22 Ga0065707_10121622 3300005295 Bacteria 2106
23 Ga0065707_10124743 3300005295 Bacteria 2038
24 Ga0065707_11085056 3300005295 Bacteria 519
25 Ga0070658_10055435 3300005327 Bacteria 3221
26 Ga0070676_10071866 3300005328 Bacteria 2079
27 Ga0070676_10240287 3300005328 Bacteria 1204
28 Ga0070676_10474792 3300005328 Bacteria 884
29 Ga0070670_100000081 3300005331 Bacteria 92043
30 Ga0070670_100000350 3300005331 Bacteria 38698
31 Ga0070670_100020103 3300005331 Bacteria 5735
32 Ga0070670_100220323 3300005331 Bacteria 1651
33 Ga0070677_10014798 3300005333 Bacteria 2753
34 Ga0070666_10087145 3300005335 Bacteria 2140
35 Ga0068868_100489190 3300005338 Bacteria 1076
36 Ga0070661_100172245 3300005344 Bacteria 1644
37 Ga0070661_100752338 3300005344 Bacteria 797
38 Ga0070668_100135102 3300005347 Bacteria 1983
39 Ga0070668_100185402 3300005347 Bacteria 1702
40 Ga0070668_100521949 3300005347 Bacteria 1031
41 Ga0070668_100708749 3300005347 Bacteria 888
42 Ga0070669_100001581 3300005353 Bacteria 16498
43 Ga0070669_100026397 3300005353 Bacteria 4179
44 Ga0070669_100054890 3300005353 Bacteria 2919
45 Ga0070669_100096449 3300005353 Bacteria 2225
46 Ga0070675_100001857 3300005354 Bacteria 15581
47 Ga0070675_100002352 3300005354 Bacteria 14063
48 Ga0070675_100006205 3300005354 Bacteria 9170
49 Ga0070675_100256398 3300005354 Bacteria 1532
50 Ga0070671_100001032 3300005355 Bacteria 20490
51 Ga0070671_100224229 3300005355 Bacteria 1595
52 Ga0070671_101411729 3300005355 Bacteria 615
53 Ga0070674_100001573 3300005356 Bacteria 12214
54 Ga0070674_100033419 3300005356 Bacteria 3424
55 Ga0070674_100057994 3300005356 Bacteria 2690
56 Ga0070673_100003253 3300005364 Bacteria 10079
57 Ga0070673_100267958 3300005364 Bacteria 1494
58 Ga0070667_100000774 3300005367 Bacteria 30276
59 Ga0070667_100002350 3300005367 Bacteria 16565
60 Ga0070667_100020574 3300005367 Bacteria 5478
61 Ga0070667_100035262 3300005367 Bacteria 4190
62 Ga0070701_10026160 3300005438 Bacteria 2843
63 Ga0070708_101635723 3300005445 Bacteria 599
64 Ga0070663_100070130 3300005455 Bacteria 2548
65 Ga0070663_100097585 3300005455 Bacteria 2188
66 Ga0070678_100038160 3300005456 Bacteria 3379
67 Ga0070678_100127885 3300005456 Bacteria 2014
68 Ga0070662_100002989 3300005457 Bacteria 10511
69 Ga0070662_100008923 3300005457 Bacteria 6536
70 Ga0070662_100645689 3300005457 Bacteria 892
71 Ga0070662_100845829 3300005457 Bacteria 779
72 Ga0068867_100022921 3300005459 Bacteria 4467
73 Ga0070699_102217228 3300005518 Bacteria 501
74 Ga0068853_100051988 3300005539 Bacteria 3528
75 Ga0068853_100501538 3300005539 Bacteria 1146
76 Ga0070672_100005889 3300005543 Bacteria 8177
77 Ga0070672_100016447 3300005543 Bacteria 5296
78 Ga0070672_100513576 3300005543 Bacteria 1037
79 Ga0070665_100005505 3300005548 Bacteria 13037
80 Ga0070665_100056228 3300005548 Bacteria 3946
81 Ga0070664_100004435 3300005564 Bacteria 11273
82 Ga0070664_100114616 3300005564 Bacteria 2355
83 Ga0070664_100467324 3300005564 Bacteria 1160
84 Ga0068857_100587402 3300005577 Bacteria 1052
85 Ga0068857_101646225 3300005577 Bacteria 627
86 Ga0068854_100165413 3300005578 Bacteria 1717
87 Ga0068859_100046644 3300005617 Bacteria 4351
88 Ga0068859_100083693 3300005617 Bacteria 3234
89 Ga0068859_100775763 3300005617 Bacteria 1047
90 Ga0068859_101022323 3300005617 Bacteria 908
91 Ga0068864_100000016 3300005618 Bacteria 292454
92 Ga0068864_100031131 3300005618 Bacteria 4526
93 Ga0068861_100124437 3300005719 Bacteria 2084
94 Ga0068851_10178826 3300005834 Bacteria 1174
95 Ga0068870_10077948 3300005840 Bacteria 1824
96 Ga0068870_10395111 3300005840 Bacteria 898
97 Ga0068863_100000014 3300005841 Bacteria 216135
98 Ga0068863_100000089 3300005841 Bacteria 101645
99 Ga0068860_100000007 3300005843 Bacteria 429329
100 Ga0068860_102227977 3300005843 Bacteria 569
101 Ga0068862_100000068 3300005844 Bacteria 123535
102 Ga0068862_100006350 3300005844 Bacteria 9828
103 Ga0068862_100012958 3300005844 Bacteria 6898
104 Ga0068862_100177953 3300005844 Bacteria 1908
105 Ga0068862_102571033 3300005844 Bacteria 521
106 Ga0081455_10000100 3300005937 Bacteria 95033
107 Ga0081539_10100337 3300005985 Bacteria 1477
108 Ga0068871_100297756 3300006358 Bacteria 1415
109 Ga0075428_100895044 3300006844 Bacteria 941
110 Ga0097620_100046642 3300006931 Bacteria 4351
111 Ga0097620_100083693 3300006931 Bacteria 3234
112 Ga0097620_100775718 3300006931 Bacteria 1047
113 Ga0097620_101022303 3300006931 Bacteria 908
114 Ga0111539_10256176 3300009094 Bacteria 2038
115 Ga0111539_10639484 3300009094 Bacteria 1239
116 Ga0105247_10009279 3300009101 Bacteria 5976
117 Ga0105248_10000021 3300009177 Bacteria 276159
118 Ga0105248_10104896 3300009177 Bacteria 3187
119 Ga0105248_10525636 3300009177 Bacteria 1334
120 Ga0105249_10000162 3300009553 Bacteria 80304
121 Ga0105249_10138372 3300009553 Bacteria 2332
122 Ga0105249_10209781 3300009553 Bacteria 1911
123 Ga0105249_11216989 3300009553 Bacteria 824
124 Ga0157371_10464224 3300013102 Bacteria 932
125 Ga0157370_10362754 3300013104 Bacteria 1335
126 Ga0157378_10012259 3300013297 Bacteria 7504
127 Ga0157378_10064485 3300013297 Bacteria 3277
128 Ga0163162_10092656 3300013306 Bacteria 3105
129 Ga0157372_10913192 3300013307 Bacteria 1018
130 Ga0157372_10973748 3300013307 Bacteria 983
131 Ga0157375_10055112 3300013308 Bacteria 3919
132 Ga0157375_10543734 3300013308 Bacteria 1324
133 Ga0157375_13300480 3300013308 Bacteria 538
134 Ga0163163_10223509 3300014325 Bacteria 1932
135 Ga0157380_10000062 3300014326 Bacteria 61714
136 Ga0157380_10735166 3300014326 Bacteria 996
137 Ga0157379_10303499 3300014968 Bacteria 1455
138 Ga0157379_11103863 3300014968 Bacteria 760
139 Ga0163161_10016024 3300017792 Bacteria 5231
140 Ga0163161_10020224 3300017792 Bacteria 4669
141 Ga0163161_11230669 3300017792 Bacteria 648
142 Ga0209675_1003647 3300025291 Bacteria 7219
143 Ga0209676_1000045 3300025292 Bacteria 412331
144 Ga0209676_1000211 3300025292 Bacteria 129654
145 Ga0209676_1000465 3300025292 Bacteria 68153
146 Ga0209676_1082234 3300025292 Bacteria 731
147 Ga0209025_1003047 3300025294 Bacteria 16515
148 Ga0209758_1036580 3300025297 Bacteria 1913
149 Ga0209050_1000047 3300025298 Bacteria 380561
150 Ga0209050_1003310 3300025298 Bacteria 12045
151 Ga0209050_1031783 3300025298 Bacteria 1637
152 Ga0209257_1000076 3300025304 Bacteria 324617
153 Ga0209257_1000644 3300025304 Bacteria 55811
154 Ga0209257_1001050 3300025304 Bacteria 36695
155 Ga0209257_1042769 3300025304 Bacteria 1334
156 Ga0207697_10004192 3300025315 Bacteria 6933
157 Ga0207713_1048207 3300025735 Bacteria 1717
158 Ga0207682_10000428 3300025893 Bacteria 19411
159 Ga0207710_10031675 3300025900 Bacteria 2313
160 Ga0207688_10134847 3300025901 Bacteria 1449
161 Ga0207680_10081041 3300025903 Bacteria 2039
162 Ga0207680_10289558 3300025903 Bacteria 1139
163 Ga0207645_10174856 3300025907 Bacteria 1408
164 Ga0207643_10119887 3300025908 Bacteria 1557
165 Ga0207705_11069947 3300025909 Bacteria 622
166 Ga0207662_10224523 3300025918 Bacteria 1224
167 Ga0207657_10421338 3300025919 Bacteria 1049
168 Ga0207649_10120255 3300025920 Bacteria 1770
169 Ga0207649_10603037 3300025920 Bacteria 845
170 Ga0207681_10018328 3300025923 Bacteria 4411
171 Ga0207681_10020618 3300025923 Bacteria 4180
172 Ga0207681_11204108 3300025923 Bacteria 636
173 Ga0207681_11535641 3300025923 Bacteria 558
174 Ga0207650_10000069 3300025925 Bacteria 138442
175 Ga0207650_10011078 3300025925 Bacteria 6200
176 Ga0207650_10015737 3300025925 Bacteria 5273
177 Ga0207650_10355668 3300025925 Bacteria 1206
178 Ga0207650_10465713 3300025925 Bacteria 1053
179 Ga0207659_10002256 3300025926 Bacteria 11474
180 Ga0207659_10021111 3300025926 Bacteria 4316
181 Ga0207659_10344972 3300025926 Bacteria 1234
182 Ga0207644_10007270 3300025931 Bacteria 7207
183 Ga0207644_10027624 3300025931 Bacteria 3922
184 Ga0207644_10194663 3300025931 Bacteria 1596
185 Ga0207644_10369746 3300025931 Bacteria 1168
186 Ga0207644_11027778 3300025931 Bacteria 692
187 Ga0207706_10005825 3300025933 Bacteria 11464
188 Ga0207706_10008036 3300025933 Bacteria 9736
189 Ga0207706_10069641 3300025933 Bacteria 3094
190 Ga0207706_10360039 3300025933 Bacteria 1264
191 Ga0207669_10031264 3300025937 Bacteria 2972
192 Ga0207669_10267926 3300025937 Bacteria 1281
193 Ga0207691_10012970 3300025940 Bacteria 7981
194 Ga0207691_10041883 3300025940 Bacteria 4224
195 Ga0207691_10091188 3300025940 Bacteria 2731
196 Ga0207691_10305900 3300025940 Bacteria 1365
197 Ga0207711_10000025 3300025941 Bacteria 289972
198 Ga0207711_10029142 3300025941 Bacteria 4653
199 Ga0207679_10029566 3300025945 Bacteria 3816
200 Ga0207679_10126589 3300025945 Bacteria 2042
201 Ga0207679_10481234 3300025945 Bacteria 1105
202 Ga0207651_10002735 3300025960 Bacteria 8469
203 Ga0207651_10205915 3300025960 Bacteria 1580
204 Ga0207712_10000316 3300025961 Bacteria 44217
205 Ga0207712_10501626 3300025961 Bacteria 1037
206 Ga0207712_11046943 3300025961 Bacteria 725
207 Ga0207668_10283104 3300025972 Bacteria 1360
208 Ga0207668_10401185 3300025972 Bacteria 1159
209 Ga0207668_10513619 3300025972 Bacteria 1032
210 Ga0207668_10579674 3300025972 Bacteria 975
211 Ga0207640_10015531 3300025981 Bacteria 4410
212 Ga0207640_10185237 3300025981 Bacteria 1565
213 Ga0207640_10315565 3300025981 Bacteria 1242
214 Ga0207640_10761989 3300025981 Bacteria 835
215 Ga0207658_10000153 3300025986 Bacteria 72252
216 Ga0207658_10003755 3300025986 Bacteria 10697
217 Ga0207658_10013637 3300025986 Bacteria 5560
218 Ga0207658_10031859 3300025986 Bacteria 3748
219 Ga0207677_11030995 3300026023 Bacteria 747
220 Ga0207703_10051426 3300026035 Bacteria 3339
221 Ga0207639_10853013 3300026041 Bacteria 850
222 Ga0207639_11106212 3300026041 Bacteria 743
223 Ga0207678_10033605 3300026067 Bacteria 4467
224 Ga0207678_10077225 3300026067 Bacteria 2853
225 Ga0207641_10000103 3300026088 Bacteria 122350
226 Ga0207641_10000126 3300026088 Bacteria 112607
227 Ga0207641_11007564 3300026088 Bacteria 830
228 Ga0207648_10013089 3300026089 Bacteria 7735
229 Ga0207676_10000044 3300026095 Bacteria 161679
230 Ga0207676_10014379 3300026095 Bacteria 5692
231 Ga0207676_10296681 3300026095 Bacteria 1474
232 Ga0207674_10021373 3300026116 Bacteria 6969
233 Ga0207674_10092050 3300026116 Bacteria 3022
234 Ga0207674_11224864 3300026116 Bacteria 720
235 Ga0207675_100023583 3300026118 Bacteria 5725
236 Ga0207683_10090131 3300026121 Bacteria 2730
237 Ga0210000_1039011 3300027462 Bacteria 752
238 Ga0209983_1026286 3300027665 Bacteria 1231
239 Ga0209974_10082323 3300027876 Bacteria 1109
240 Ga0268266_10011921 3300028379 Bacteria 7529
241 Ga0268266_10021435 3300028379 Bacteria 5504
242 Ga0268265_10000142 3300028380 Bacteria 91165
243 Ga0268265_10003941 3300028380 Bacteria 10459
244 Ga0268265_10008961 3300028380 Bacteria 6767
245 Ga0268265_10050543 3300028380 Bacteria 3133
246 Ga0268265_10140648 3300028380 Bacteria 2020
247 Ga0268265_10232761 3300028380 Bacteria 1620
248 Ga0268265_10482227 3300028380 Bacteria 1165
249 Ga0268265_10509200 3300028380 Bacteria 1136
250 Ga0268264_10000077 3300028381 Bacteria 252597
251 Ga0268264_10014949 3300028381 Bacteria 6372
252 Ga0268264_11768635 3300028381 Bacteria 628
253 Ga0307517_10024515 3300028786 Bacteria 7426
254 Ga0265327_10070126 3300031251 Bacteria 1757
255 Ga0307408_100106205 3300031548 Bacteria 2148
256 Ga0307408_100227630 3300031548 Bacteria 1525
257 Ga0307408_100280484 3300031548 Bacteria 1387
258 Ga0307408_100503852 3300031548 Bacteria 1060
259 Ga0307408_100531677 3300031548 Bacteria 1034
260 Ga0307408_100536190 3300031548 Bacteria 1030
261 Ga0307408_100596645 3300031548 Bacteria 981
262 Ga0307408_100843115 3300031548 Bacteria 835
263 Ga0307408_101091946 3300031548 Bacteria 740
264 Ga0307408_101627284 3300031548 Bacteria 614
265 Ga0307408_101994713 3300031548 Bacteria 558
266 Ga0307405_10132371 3300031731 Bacteria 1725
267 Ga0307405_10250198 3300031731 Bacteria 1318
268 Ga0307405_10531051 3300031731 Bacteria 949
269 Ga0307405_10662991 3300031731 Bacteria 859
270 Ga0307405_10671713 3300031731 Bacteria 854
271 Ga0307413_10023759 3300031824 Bacteria 3327
272 Ga0307413_10071876 3300031824 Bacteria 2181
273 Ga0307413_10107199 3300031824 Bacteria 1861
274 Ga0307413_10386333 3300031824 Bacteria 1092
275 Ga0307413_10564836 3300031824 Bacteria 925
276 Ga0307413_10696192 3300031824 Bacteria 843
277 Ga0307413_10822615 3300031824 Bacteria 782
278 Ga0307413_11225693 3300031824 Bacteria 653
279 Ga0307410_10055411 3300031852 Bacteria 2691
280 Ga0307410_10109687 3300031852 Bacteria 1995
281 Ga0307410_10287140 3300031852 Bacteria 1293
282 Ga0307410_10539063 3300031852 Bacteria 965
283 Ga0307410_10554060 3300031852 Bacteria 953
284 Ga0307410_11074995 3300031852 Bacteria 696
285 Ga0307410_11401875 3300031852 Bacteria 613
286 Ga0307410_11410036 3300031852 Bacteria 612
287 Ga0307406_10050625 3300031901 Bacteria 2634
288 Ga0307406_10090576 3300031901 Bacteria 2058
289 Ga0307406_10106032 3300031901 Bacteria 1924
290 Ga0307406_10208987 3300031901 Bacteria 1442
291 Ga0307406_10394589 3300031901 Bacteria 1095
292 Ga0307406_10428026 3300031901 Bacteria 1056
293 Ga0307406_10729885 3300031901 Bacteria 830
294 Ga0307406_10898912 3300031901 Bacteria 754
295 Ga0307406_11346141 3300031901 Bacteria 624
296 Ga0307407_10078216 3300031903 Bacteria 1992
297 Ga0307407_10193828 3300031903 Bacteria 1356
298 Ga0307407_11495820 3300031903 Bacteria 534
299 Ga0307412_10001551 3300031911 Bacteria 12691
300 Ga0307412_10003245 3300031911 Bacteria 9042
301 Ga0307412_10076123 3300031911 Bacteria 2304
302 Ga0307412_10082451 3300031911 Bacteria 2227
303 Ga0307412_10106765 3300031911 Bacteria 1991
304 Ga0307412_10143051 3300031911 Bacteria 1754
305 Ga0307412_10164618 3300031911 Bacteria 1652
306 Ga0307412_10225463 3300031911 Bacteria 1439
307 Ga0307412_10289088 3300031911 Bacteria 1290
308 Ga0307412_10333068 3300031911 Bacteria 1212
309 Ga0307412_10538722 3300031911 Bacteria 978
310 Ga0307412_10566504 3300031911 Bacteria 956
311 Ga0307412_10573201 3300031911 Bacteria 951
312 Ga0307412_10596572 3300031911 Bacteria 935
313 Ga0307412_11122878 3300031911 Bacteria 700
314 Ga0307412_11125554 3300031911 Bacteria 700
315 Ga0307412_11274211 3300031911 Bacteria 661
316 Ga0307412_11339296 3300031911 Bacteria 646
317 Ga0307412_11538914 3300031911 Bacteria 606
318 Ga0307409_100094765 3300031995 Bacteria 2457
319 Ga0307409_100397355 3300031995 Bacteria 1315
320 Ga0307409_100550759 3300031995 Bacteria 1132
321 Ga0307409_100559332 3300031995 Bacteria 1124
322 Ga0307409_100560315 3300031995 Bacteria 1123
323 Ga0307409_100936069 3300031995 Bacteria 882
324 Ga0307409_102018102 3300031995 Bacteria 606
325 Ga0307416_100002549 3300032002 Bacteria 10500
326 Ga0307416_100049705 3300032002 Bacteria 3336
327 Ga0307416_100057475 3300032002 Bacteria 3147
328 Ga0307416_100071336 3300032002 Bacteria 2885
329 Ga0307416_100450459 3300032002 Bacteria 1339
330 Ga0307416_100724940 3300032002 Bacteria 1085
331 Ga0307416_100932513 3300032002 Bacteria 969
332 Ga0307416_101243409 3300032002 Bacteria 850
333 Ga0307416_101278636 3300032002 Bacteria 839
334 Ga0307416_101788507 3300032002 Bacteria 718
335 Ga0307414_10000486 3300032004 Bacteria 20663
336 Ga0307414_10001040 3300032004 Bacteria 14198
337 Ga0307414_10005017 3300032004 Bacteria 7246
338 Ga0307414_10006477 3300032004 Bacteria 6528
339 Ga0307414_10011626 3300032004 Bacteria 5171
340 Ga0307414_10039170 3300032004 Bacteria 3190
341 Ga0307414_10044651 3300032004 Bacteria 3029
342 Ga0307414_10049873 3300032004 Bacteria 2896
343 Ga0307414_10073472 3300032004 Bacteria 2474
344 Ga0307414_10120441 3300032004 Bacteria 2016
345 Ga0307414_10140986 3300032004 Bacteria 1887
346 Ga0307414_10275259 3300032004 Bacteria 1412
347 Ga0307414_10308300 3300032004 Bacteria 1342
348 Ga0307414_10457785 3300032004 Bacteria 1120
349 Ga0307414_10562784 3300032004 Bacteria 1017
350 Ga0307414_10581634 3300032004 Bacteria 1002
351 Ga0307414_10652973 3300032004 Bacteria 948
352 Ga0307414_10674212 3300032004 Bacteria 934
353 Ga0307414_10769207 3300032004 Bacteria 876
354 Ga0307414_10771345 3300032004 Bacteria 875
355 Ga0307414_10814078 3300032004 Bacteria 852
356 Ga0307414_10861851 3300032004 Bacteria 829
357 Ga0307414_10875399 3300032004 Bacteria 822
358 Ga0307414_10914101 3300032004 Bacteria 805
359 Ga0307414_10971483 3300032004 Bacteria 781
360 Ga0307414_11147998 3300032004 Bacteria 718
361 Ga0307414_11388252 3300032004 Bacteria 653
362 Ga0307414_12168960 3300032004 Unclassified 519
363 Ga0307411_10035984 3300032005 Bacteria 3097
364 Ga0307411_10073330 3300032005 Bacteria 2328
365 Ga0307411_10192888 3300032005 Bacteria 1557
366 Ga0307411_10236009 3300032005 Bacteria 1428
367 Ga0307411_10268432 3300032005 Bacteria 1352
368 Ga0307411_10418424 3300032005 Bacteria 1112
369 Ga0307411_10498630 3300032005 Bacteria 1029
370 Ga0307411_10717687 3300032005 Bacteria 872
371 Ga0307411_10964729 3300032005 Bacteria 761
372 Ga0307411_10980616 3300032005 Bacteria 755
373 Ga0307411_10980658 3300032005 Bacteria 755
374 Ga0307411_11500314 3300032005 Bacteria 619
375 Ga0307411_11823706 3300032005 Bacteria 565
376 Ga0307415_100004677 3300032126 Bacteria 7158
377 Ga0307415_100027986 3300032126 Bacteria 3579
378 Ga0307415_100191462 3300032126 Bacteria 1614
379 Ga0307415_100356638 3300032126 Bacteria 1233
380 Ga0307415_100375923 3300032126 Bacteria 1205
381 Ga0307415_100555002 3300032126 Bacteria 1014
382 Ga0307415_100766427 3300032126 Bacteria 877
383 Ga0307415_100787717 3300032126 Bacteria 866
384 Ga0307415_101457828 3300032126 Bacteria 653
385 Ga0307415_101762801 3300032126 Bacteria 598
386 Ga0395900_1247259 3300037418 Bacteria 658
387 Ga0395905_0112865 3300037471 Bacteria 2553
388 Ga0395905_0128838 3300037471 Bacteria 2380
389 Ga0395901_0121559 3300038443 Bacteria 2744
390 Ga0436365_1296624 3300039437 Bacteria 1320
391 Ga0436365_1764132 3300039437 Bacteria 605
392 Ga0436363_1205530 3300039450 Bacteria 521
393 Ga0439453_0132671 3300041408 Bacteria 580
394 Ga0439465_0368210 3300041413 Unclassified 544
395 Ga0451793_0089535 3300041452 Bacteria 786
396 Ga0439441_137588 3300042001 Bacteria 569
397 Ga0439442_064523 3300042002 Bacteria 777
398 Ga0439432_062657 3300042006 Bacteria 1144
399 Ga0439432_172598 3300042006 Unclassified 631
400 Ga0439449_0123456 3300042007 Bacteria 962
401 Ga0450912_026182 3300042116 Bacteria 587
402 Ga0439464_0001561 3300042439 Bacteria 5435
403 Ga0466965_0072769 3300044683 Bacteria 1730
404 Ga0451576_0494190 3300045051 Bacteria 1285
405 Ga0495650_0040089 3300046471 Bacteria 2015
406 Ga0495596_0170864 3300046500 Bacteria 845
407 Ga0495616_0000187 3300046513 Bacteria 51726
408 Ga0495643_0011914 3300046522 Bacteria 5267
409 Ga0495663_0040407 3300046525 Bacteria 1416
410 Ga0495663_0068786 3300046525 Bacteria 1124
411 Ga0495663_0112274 3300046525 Bacteria 906
412 Ga0495663_0160484 3300046525 Bacteria 771
413 Ga0495663_0227550 3300046525 Bacteria 657
414 Ga0495654_0015755 3300046530 Bacteria 4010
415 Ga0495654_0030157 3300046530 Bacteria 2761
416 Ga0495654_0087132 3300046530 Bacteria 1454
417 Ga0495598_0004644 3300046537 Bacteria 2988
418 Ga0495598_0459613 3300046537 Bacteria 505
419 Ga0495621_0006102 3300046539 Bacteria 3501
420 Ga0495621_0028095 3300046539 Bacteria 1910
421 Ga0495633_0284799 3300046558 Bacteria 751
422 Ga0495668_0000024 3300046616 Bacteria 359469
423 Ga0495668_0019448 3300046616 Bacteria 3914
424 Ga0495668_0043954 3300046616 Bacteria 2483
425 Ga0495611_0336069 3300046648 Bacteria 694
426 Ga0495625_0000196 3300046660 Bacteria 96006
427 Ga0495659_0027612 3300046664 Bacteria 1959
428 Ga0495669_0000602 3300046684 Bacteria 15746
429 Ga0495669_0022836 3300046684 Bacteria 2719
430 Ga0495669_0436980 3300046684 Bacteria 635
431 Ga0495670_0091718 3300046691 Bacteria 1555
432 Ga0495670_0365382 3300046691 Bacteria 778
433 Ga0495649_0393355 3300046694 Bacteria 696
434 Ga0495636_0226809 3300047318 Bacteria 859
435 Ga0495677_0138458 3300047445 Bacteria 934
436 Ga0495681_0351738 3300047470 Bacteria 560
437 Ga0495686_0000701 3300047472 Bacteria 45238
438 Ga0496100_0144000 3300048903 Bacteria 1693
439 Ga0496101_0305200 3300048904 Bacteria 1247
440 Ga0496102_0504780 3300048905 Bacteria 1132
441 Ga0496102_0624794 3300048905 Bacteria 1000
442 Ga0496102_0735933 3300048905 Bacteria 909
443 Ga0496103_0047920 3300048906 Bacteria 2641
444 Ga0496104_0051151 3300048907 Bacteria 3899
445 Ga0496105_0004419 3300048908 Bacteria 10585
446 Ga0496106_1460242 3300048909 Bacteria 527
447 Ga0496108_0283881 3300048911 Bacteria 1441
448 Ga0496109_0025686 3300048912 Bacteria 5250
449 Ga0496110_0001413 3300048913 Bacteria 17353
450 Ga0496111_0011130 3300048914 Bacteria 6055
451 Ga0496113_1097698 3300048916 Bacteria 624
452 Ga0496114_0146039 3300048917 Bacteria 2050
453 Ga0496117_0037162 3300048920 Bacteria 3632
454 Ga0496118_0000339 3300048921 Bacteria 80008
455 Ga0496118_0020455 3300048921 Bacteria 5868
456 Ga0496120_0184115 3300048923 Bacteria 1023
457 Ga0496121_0000222 3300048924 Bacteria 123595
458 Ga0495678_017250 3300049459 Bacteria 3278
459 Ga0501290_000464 3300049513 Bacteria 6297
460 Ga0501290_006459 3300049513 Bacteria 1469
461 Ga0501292_000026 3300049515 Bacteria 42153
462 Ga0501293_001367 3300049516 Bacteria 1834
463 Ga0501294_000620 3300049517 Bacteria 4032
464 Ga0501297_003055 3300049520 Bacteria 1650
465 Ga0501298_022812 3300049521 Bacteria 1182
466 Ga0501300_004021 3300049523 Bacteria 2186
467 Ga0501300_004703 3300049523 Bacteria 2019
468 Ga0501300_021080 3300049523 Bacteria 951
469 Ga0501301_001208 3300049524 Bacteria 1622
470 Ga0501031_0051644 3300049568 Bacteria 2678
471 Ga0501032_0165002 3300049569 Bacteria 1453
472 Ga0501033_0001955 3300049570 Bacteria 17935
473 Ga0501036_0225590 3300049572 Bacteria 1572
474 Ga0501036_1549534 3300049572 Bacteria 536
475 Ga0501037_0168433 3300049573 Bacteria 1558
476 Ga0501038_0045845 3300049574 Bacteria 3793
477 Ga0501038_0050719 3300049574 Bacteria 3585
478 Ga0501039_0121354 3300049575 Bacteria 2048
479 Ga0501043_0046027 3300049579 Bacteria 3430
480 Ga0501047_0639593 3300049581 Bacteria 883
481 Ga0501047_1452705 3300049581 Bacteria 501
482 Ga0501048_0290394 3300049582 Bacteria 1163
483 Ga0501071_0450790 3300049587 Bacteria 985
484 Ga0501071_1331330 3300049587 Bacteria 555
485 Ga0501202_004276 3300049652 Bacteria 2497
486 Ga0501206_000824 3300049653 Bacteria 3798
487 Ga0501217_296631 3300049661 Bacteria 533
488 Ga0501222_000640 3300049662 Bacteria 5129
489 Ga0501223_002932 3300049663 Bacteria 3743
490 Ga0501223_005742 3300049663 Bacteria 2594
491 Ga0501223_006203 3300049663 Bacteria 2481
492 Ga0501224_000020 3300049664 Bacteria 74346
493 Ga0501224_009136 3300049664 Bacteria 1449
494 Ga0501227_010889 3300049665 Bacteria 1976
495 Ga0501227_016975 3300049665 Bacteria 1640
496 Ga0501233_007168 3300049668 Bacteria 2117
497 Ga0501233_048660 3300049668 Bacteria 1020
498 Ga0501235_001905 3300049669 Bacteria 4460
499 Ga0501235_002921 3300049669 Bacteria 3680
500 Ga0501243_041061 3300049675 Bacteria 813
501 Ga0501247_037872 3300049677 Bacteria 680
502 Ga0501257_000131 3300049686 Bacteria 17065
503 Ga0501259_000268 3300049688 Bacteria 8191
504 Ga0501261_000046 3300049690 Bacteria 24263
505 Ga0501221_005058 3300049704 Bacteria 2196
506 Ga0501225_0000009 3300049705 Bacteria 90065
507 Ga0501229_003848 3300049706 Bacteria 1814
508 Ga0501245_001012 3300049708 Bacteria 3613
509 Ga0501268_091764 3300049765 Bacteria 640
510 Ga0501276_002528 3300049773 Bacteria 1293
511 Ga0501279_000027 3300049775 Bacteria 40843
512 Ga0501280_000044 3300049776 Bacteria 37121
513 Ga0501280_001131 3300049776 Bacteria 5332
514 Ga0501281_00442 3300049777 Bacteria 4033
515 Ga0501282_000334 3300049778 Bacteria 5704
516 Ga0501283_009832 3300049779 Bacteria 1400
517 Ga0501035_0018153 3300049822 Bacteria 6481
518 Ga0501044_0196206 3300049823 Bacteria 1978
519 Ga0501226_000187 3300049853 Bacteria 9961
520 Ga0501284_01647 3300050005 Bacteria 1194
521 nmdc:mga06r32_1106451_c1 3300050510 Bacteria 741
522 nmdc:mga06r32_14029_c1 3300050510 Bacteria 7265
523 nmdc:mga08y16_719013_c1 3300050511 Bacteria 997
524 Ga0500643_000065 3300053087 Bacteria 119995
525 Ga0500643_000488 3300053087 Bacteria 28843
526 Ga0500643_100970 3300053087 Bacteria 782
527 Ga0500592_000140 3300053116 Bacteria 15045
528 Ga0500592_000384 3300053116 Bacteria 7453
529 Ga0500592_028997 3300053116 Bacteria 893
530 Ga0500592_061242 3300053116 Bacteria 616
531 Ga0500658_0402787 3300053134 Bacteria 626
532 Ga0500559_0002322 3300053136 Bacteria 9970
533 Ga0500568_0001688 3300053139 Bacteria 13785
534 Ga0500590_000142 3300053148 Bacteria 19990
535 Ga0500604_0009046 3300053151 Bacteria 2650
536 Ga0500604_0015383 3300053151 Bacteria 2095
537 Ga0500604_0028845 3300053151 Bacteria 1614
538 Ga0500627_0000043 3300053158 Bacteria 65441
539 Ga0500627_0000551 3300053158 Bacteria 10092
540 Ga0500627_0161586 3300053158 Bacteria 1010
541 Ga0500611_044866 3300053727 Bacteria 987
542 Ga0500661_000036 3300055283 Bacteria 19851

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221560 2643822372 133
2 iso_pu_bacteria 2643221563 2643833600 133
3 iso_pu_bacteria 2643221608 2644054527 133
4 iso_pu_bacteria 2852653556 2852656692 133
5 iso_pu_bacteria 2852680915 2852682088 133
6 iso_pu_bacteria 2882806704 2882808292 133
7 iso_pu_bacteria 2885429604 2885430748 133
8 3300025940 Ga0207691_10305900 Ga0207691_103059002 134
9 3300037418 Ga0395900_1247259 Ga0395900_1247259_235_639 134
10 3300031251 Ga0265327_10070126 Ga0265327_100701263 135
11 3300031548 Ga0307408_100280484 Ga0307408_1002804841 135
12 3300031731 Ga0307405_10132371 Ga0307405_101323713 135
13 3300031901 Ga0307406_10050625 Ga0307406_100506252 135
14 3300031911 Ga0307412_10143051 Ga0307412_101430513 135
15 3300039450 Ga0436363_1205530 Ga0436363_1205530_54_461 135
16 3300005335 Ga0070666_10087145 Ga0070666_100871452 136
17 3300005353 Ga0070669_100096449 Ga0070669_1000964492 136
18 3300005367 Ga0070667_100002350 Ga0070667_10000235012 136
19 3300005548 Ga0070665_100005505 Ga0070665_10000550512 136
20 3300005617 Ga0068859_100775763 Ga0068859_1007757632 136
21 3300005841 Ga0068863_100000014 Ga0068863_10000001463 136
22 3300005843 Ga0068860_100000007 Ga0068860_100000007172 136
23 3300005844 Ga0068862_100012958 Ga0068862_1000129581 136
24 3300006931 Ga0097620_100775718 Ga0097620_1007757182 136
25 3300009177 Ga0105248_10104896 Ga0105248_101048962 136
26 3300025903 Ga0207680_10081041 Ga0207680_100810412 136
27 3300025986 Ga0207658_10003755 Ga0207658_100037556 136
28 3300026035 Ga0207703_10051426 Ga0207703_100514263 136
29 3300026088 Ga0207641_10000126 Ga0207641_1000012640 136
30 3300028379 Ga0268266_10011921 Ga0268266_100119217 136
31 3300028380 Ga0268265_10008961 Ga0268265_100089618 136
32 3300028381 Ga0268264_10000077 Ga0268264_1000007767 136
33 3300031911 Ga0307412_11538914 Ga0307412_115389141 136
34 3300032004 Ga0307414_10005017 Ga0307414_100050172 136
35 3300044683 Ga0466965_0072769 Ga0466965_0072769_552_962 136
36 3300048905 Ga0496102_0624794 Ga0496102_0624794_133_543 136
37 3300048905 Ga0496102_0735933 Ga0496102_0735933_486_896 136
38 3300048907 Ga0496104_0051151 Ga0496104_0051151_2201_2611 136
39 3300048908 Ga0496105_0004419 Ga0496105_0004419_91_501 136
40 3300048923 Ga0496120_0184115 Ga0496120_0184115_289_699 136
41 2162886006 SwRhRL3b_contig_86265 SwRhRL3b_0238.00000270 137
42 2162886007 SwRhRL2b_contig_650828 SwRhRL2b_0643.00004970 137
43 3300001976 JGI24752J21851_1000370 JGI24752J21851_10003705 137
44 3300002076 JGI24749J21850_1006682 JGI24749J21850_10066822 137
45 3300002244 JGI24742J22300_10022985 JGI24742J22300_100229851 137
46 3300002244 JGI24742J22300_10068936 JGI24742J22300_100689361 137
47 3300002459 JGI24751J29686_10117683 JGI24751J29686_101176831 137
48 3300003781 Ga0055536_1002465 Ga0055536_10024655 137
49 3300003781 Ga0055536_1003362 Ga0055536_10033623 137
50 3300003781 Ga0055536_1026479 Ga0055536_10264793 137
51 3300003784 Ga0055534_1017433 Ga0055534_10174331 137
52 3300003791 Ga0055530_10002163 Ga0055530_100021638 137
53 3300003794 Ga0055531_10002264 Ga0055531_100022648 137
54 3300003794 Ga0055531_10002939 Ga0055531_100029398 137
55 3300003911 JGI25405J52794_10014256 JGI25405J52794_100142562 137
56 3300005289 Ga0065704_10123386 Ga0065704_101233863 137
57 3300005290 Ga0065712_10353773 Ga0065712_103537732 137
58 3300005293 Ga0065715_10135674 Ga0065715_101356742 137
59 3300005293 Ga0065715_10160311 Ga0065715_101603113 137
60 3300005293 Ga0065715_10165694 Ga0065715_101656942 137
61 3300005295 Ga0065707_10081814 Ga0065707_1008181418 137
62 3300005295 Ga0065707_10121622 Ga0065707_101216223 137
63 3300005295 Ga0065707_10124743 Ga0065707_101247433 137
64 3300005295 Ga0065707_11085056 Ga0065707_110850561 137
65 3300005327 Ga0070658_10055435 Ga0070658_100554354 137
66 3300005328 Ga0070676_10071866 Ga0070676_100718664 137
67 3300005328 Ga0070676_10240287 Ga0070676_102402872 137
68 3300005328 Ga0070676_10474792 Ga0070676_104747921 137
69 3300005331 Ga0070670_100000081 Ga0070670_10000008180 137
70 3300005331 Ga0070670_100000350 Ga0070670_10000035027 137
71 3300005331 Ga0070670_100020103 Ga0070670_1000201036 137
72 3300005331 Ga0070670_100220323 Ga0070670_1002203232 137
73 3300005333 Ga0070677_10014798 Ga0070677_100147981 137
74 3300005338 Ga0068868_100489190 Ga0068868_1004891902 137
75 3300005344 Ga0070661_100172245 Ga0070661_1001722452 137
76 3300005344 Ga0070661_100752338 Ga0070661_1007523382 137
77 3300005347 Ga0070668_100135102 Ga0070668_1001351023 137
78 3300005347 Ga0070668_100185402 Ga0070668_1001854022 137
79 3300005347 Ga0070668_100521949 Ga0070668_1005219492 137
80 3300005347 Ga0070668_100708749 Ga0070668_1007087492 137
81 3300005353 Ga0070669_100001581 Ga0070669_10000158118 137
82 3300005353 Ga0070669_100026397 Ga0070669_1000263972 137
83 3300005353 Ga0070669_100054890 Ga0070669_1000548905 137
84 3300005354 Ga0070675_100001857 Ga0070675_10000185714 137
85 3300005354 Ga0070675_100002352 Ga0070675_1000023524 137
86 3300005354 Ga0070675_100006205 Ga0070675_1000062056 137
87 3300005354 Ga0070675_100256398 Ga0070675_1002563983 137
88 3300005355 Ga0070671_100001032 Ga0070671_10000103214 137
89 3300005355 Ga0070671_100224229 Ga0070671_1002242293 137
90 3300005355 Ga0070671_101411729 Ga0070671_1014117291 137
91 3300005356 Ga0070674_100001573 Ga0070674_1000015733 137
92 3300005356 Ga0070674_100033419 Ga0070674_1000334195 137
93 3300005356 Ga0070674_100057994 Ga0070674_1000579942 137
94 3300005364 Ga0070673_100003253 Ga0070673_1000032539 137
95 3300005364 Ga0070673_100267958 Ga0070673_1002679582 137
96 3300005367 Ga0070667_100000774 Ga0070667_10000077417 137
97 3300005367 Ga0070667_100020574 Ga0070667_1000205746 137
98 3300005367 Ga0070667_100035262 Ga0070667_1000352625 137
99 3300005438 Ga0070701_10026160 Ga0070701_100261602 137
100 3300005445 Ga0070708_101635723 Ga0070708_1016357231 137
101 3300005455 Ga0070663_100070130 Ga0070663_1000701302 137
102 3300005455 Ga0070663_100097585 Ga0070663_1000975851 137
103 3300005456 Ga0070678_100038160 Ga0070678_1000381602 137
104 3300005456 Ga0070678_100127885 Ga0070678_1001278853 137
105 3300005457 Ga0070662_100002989 Ga0070662_10000298912 137
106 3300005457 Ga0070662_100008923 Ga0070662_1000089235 137
107 3300005457 Ga0070662_100645689 Ga0070662_1006456892 137
108 3300005457 Ga0070662_100845829 Ga0070662_1008458292 137
109 3300005459 Ga0068867_100022921 Ga0068867_1000229213 137
110 3300005518 Ga0070699_102217228 Ga0070699_1022172281 137
111 3300005539 Ga0068853_100051988 Ga0068853_1000519881 137
112 3300005539 Ga0068853_100501538 Ga0068853_1005015381 137
113 3300005543 Ga0070672_100005889 Ga0070672_1000058896 137
114 3300005543 Ga0070672_100016447 Ga0070672_1000164472 137
115 3300005543 Ga0070672_100513576 Ga0070672_1005135761 137
116 3300005548 Ga0070665_100056228 Ga0070665_1000562284 137
117 3300005564 Ga0070664_100004435 Ga0070664_1000044356 137
118 3300005564 Ga0070664_100114616 Ga0070664_1001146163 137
119 3300005564 Ga0070664_100467324 Ga0070664_1004673242 137
120 3300005577 Ga0068857_100587402 Ga0068857_1005874022 137
121 3300005577 Ga0068857_101646225 Ga0068857_1016462251 137
122 3300005578 Ga0068854_100165413 Ga0068854_1001654133 137
123 3300005617 Ga0068859_100046644 Ga0068859_1000466445 137
124 3300005617 Ga0068859_100083693 Ga0068859_1000836931 137
125 3300005617 Ga0068859_101022323 Ga0068859_1010223232 137
126 3300005618 Ga0068864_100000016 Ga0068864_10000001684 137
127 3300005618 Ga0068864_100031131 Ga0068864_1000311314 137
128 3300005719 Ga0068861_100124437 Ga0068861_1001244373 137
129 3300005834 Ga0068851_10178826 Ga0068851_101788262 137
130 3300005840 Ga0068870_10077948 Ga0068870_100779482 137
131 3300005840 Ga0068870_10395111 Ga0068870_103951112 137
132 3300005841 Ga0068863_100000089 Ga0068863_10000008959 137
133 3300005843 Ga0068860_102227977 Ga0068860_1022279771 137
134 3300005844 Ga0068862_100000068 Ga0068862_10000006885 137
135 3300005844 Ga0068862_100006350 Ga0068862_10000635011 137
136 3300005844 Ga0068862_100177953 Ga0068862_1001779531 137
137 3300005844 Ga0068862_102571033 Ga0068862_1025710331 137
138 3300005937 Ga0081455_10000100 Ga0081455_1000010088 137
139 3300005985 Ga0081539_10100337 Ga0081539_101003372 137
140 3300006358 Ga0068871_100297756 Ga0068871_1002977562 137
141 3300006844 Ga0075428_100895044 Ga0075428_1008950442 137
142 3300006931 Ga0097620_100046642 Ga0097620_1000466425 137
143 3300006931 Ga0097620_100083693 Ga0097620_1000836931 137
144 3300006931 Ga0097620_101022303 Ga0097620_1010223032 137
145 3300009094 Ga0111539_10256176 Ga0111539_102561761 137
146 3300009094 Ga0111539_10639484 Ga0111539_106394842 137
147 3300009101 Ga0105247_10009279 Ga0105247_100092795 137
148 3300009177 Ga0105248_10000021 Ga0105248_1000002151 137
149 3300009177 Ga0105248_10525636 Ga0105248_105256362 137
150 3300009553 Ga0105249_10000162 Ga0105249_1000016244 137
151 3300009553 Ga0105249_10138372 Ga0105249_101383722 137
152 3300009553 Ga0105249_10209781 Ga0105249_102097812 137
153 3300009553 Ga0105249_11216989 Ga0105249_112169892 137
154 3300013102 Ga0157371_10464224 Ga0157371_104642242 137
155 3300013104 Ga0157370_10362754 Ga0157370_103627541 137
156 3300013297 Ga0157378_10012259 Ga0157378_100122594 137
157 3300013297 Ga0157378_10064485 Ga0157378_100644852 137
158 3300013306 Ga0163162_10092656 Ga0163162_100926564 137
159 3300013307 Ga0157372_10913192 Ga0157372_109131921 137
160 3300013307 Ga0157372_10973748 Ga0157372_109737482 137
161 3300013308 Ga0157375_10055112 Ga0157375_100551126 137
162 3300013308 Ga0157375_10543734 Ga0157375_105437342 137
163 3300013308 Ga0157375_13300480 Ga0157375_133004801 137
164 3300014325 Ga0163163_10223509 Ga0163163_102235092 137
165 3300014326 Ga0157380_10000062 Ga0157380_1000006239 137
166 3300014326 Ga0157380_10735166 Ga0157380_107351662 137
167 3300014968 Ga0157379_10303499 Ga0157379_103034991 137
168 3300014968 Ga0157379_11103863 Ga0157379_111038632 137
169 3300017792 Ga0163161_10016024 Ga0163161_100160246 137
170 3300017792 Ga0163161_10020224 Ga0163161_100202245 137
171 3300017792 Ga0163161_11230669 Ga0163161_112306691 137
172 3300025291 Ga0209675_1003647 Ga0209675_10036473 137
173 3300025292 Ga0209676_1000045 Ga0209676_100004519 137
174 3300025292 Ga0209676_1000211 Ga0209676_10002118 137
175 3300025292 Ga0209676_1000465 Ga0209676_10004656 137
176 3300025292 Ga0209676_1082234 Ga0209676_10822341 137
177 3300025294 Ga0209025_1003047 Ga0209025_10030473 137
178 3300025297 Ga0209758_1036580 Ga0209758_10365803 137
179 3300025298 Ga0209050_1000047 Ga0209050_1000047193 137
180 3300025298 Ga0209050_1003310 Ga0209050_10033108 137
181 3300025298 Ga0209050_1031783 Ga0209050_10317833 137
182 3300025304 Ga0209257_1000076 Ga0209257_1000076149 137
183 3300025304 Ga0209257_1000644 Ga0209257_10006449 137
184 3300025304 Ga0209257_1001050 Ga0209257_10010507 137
185 3300025304 Ga0209257_1042769 Ga0209257_10427693 137
186 3300025315 Ga0207697_10004192 Ga0207697_100041923 137
187 3300025735 Ga0207713_1048207 Ga0207713_10482073 137
188 3300025893 Ga0207682_10000428 Ga0207682_1000042814 137
189 3300025900 Ga0207710_10031675 Ga0207710_100316752 137
190 3300025901 Ga0207688_10134847 Ga0207688_101348472 137
191 3300025903 Ga0207680_10289558 Ga0207680_102895582 137
192 3300025907 Ga0207645_10174856 Ga0207645_101748562 137
193 3300025908 Ga0207643_10119887 Ga0207643_101198873 137
194 3300025909 Ga0207705_11069947 Ga0207705_110699471 137
195 3300025918 Ga0207662_10224523 Ga0207662_102245232 137
196 3300025919 Ga0207657_10421338 Ga0207657_104213382 137
197 3300025920 Ga0207649_10120255 Ga0207649_101202553 137
198 3300025920 Ga0207649_10603037 Ga0207649_106030372 137
199 3300025923 Ga0207681_10018328 Ga0207681_100183286 137
200 3300025923 Ga0207681_10020618 Ga0207681_100206182 137
201 3300025923 Ga0207681_11204108 Ga0207681_112041082 137
202 3300025923 Ga0207681_11535641 Ga0207681_115356411 137
203 3300025925 Ga0207650_10000069 Ga0207650_1000006919 137
204 3300025925 Ga0207650_10011078 Ga0207650_100110788 137
205 3300025925 Ga0207650_10015737 Ga0207650_100157375 137
206 3300025925 Ga0207650_10355668 Ga0207650_103556682 137
207 3300025925 Ga0207650_10465713 Ga0207650_104657131 137
208 3300025926 Ga0207659_10002256 Ga0207659_1000225611 137
209 3300025926 Ga0207659_10021111 Ga0207659_100211115 137
210 3300025926 Ga0207659_10344972 Ga0207659_103449721 137
211 3300025931 Ga0207644_10007270 Ga0207644_100072707 137
212 3300025931 Ga0207644_10027624 Ga0207644_100276242 137
213 3300025931 Ga0207644_10194663 Ga0207644_101946633 137
214 3300025931 Ga0207644_10369746 Ga0207644_103697462 137
215 3300025931 Ga0207644_11027778 Ga0207644_110277782 137
216 3300025933 Ga0207706_10005825 Ga0207706_1000582511 137
217 3300025933 Ga0207706_10008036 Ga0207706_100080365 137
218 3300025933 Ga0207706_10069641 Ga0207706_100696415 137
219 3300025933 Ga0207706_10360039 Ga0207706_103600392 137
220 3300025937 Ga0207669_10031264 Ga0207669_100312644 137
221 3300025937 Ga0207669_10267926 Ga0207669_102679262 137
222 3300025940 Ga0207691_10012970 Ga0207691_100129706 137
223 3300025940 Ga0207691_10041883 Ga0207691_100418832 137
224 3300025940 Ga0207691_10091188 Ga0207691_100911883 137
225 3300025941 Ga0207711_10000025 Ga0207711_10000025247 137
226 3300025941 Ga0207711_10029142 Ga0207711_100291426 137
227 3300025945 Ga0207679_10029566 Ga0207679_100295663 137
228 3300025945 Ga0207679_10126589 Ga0207679_101265894 137
229 3300025945 Ga0207679_10481234 Ga0207679_104812342 137
230 3300025960 Ga0207651_10002735 Ga0207651_100027358 137
231 3300025960 Ga0207651_10205915 Ga0207651_102059152 137
232 3300025961 Ga0207712_10000316 Ga0207712_1000031644 137
233 3300025961 Ga0207712_10501626 Ga0207712_105016262 137
234 3300025961 Ga0207712_11046943 Ga0207712_110469431 137
235 3300025972 Ga0207668_10283104 Ga0207668_102831042 137
236 3300025972 Ga0207668_10401185 Ga0207668_104011852 137
237 3300025972 Ga0207668_10513619 Ga0207668_105136192 137
238 3300025972 Ga0207668_10579674 Ga0207668_105796742 137
239 3300025981 Ga0207640_10015531 Ga0207640_100155313 137
240 3300025981 Ga0207640_10185237 Ga0207640_101852373 137
241 3300025981 Ga0207640_10315565 Ga0207640_103155652 137
242 3300025981 Ga0207640_10761989 Ga0207640_107619892 137
243 3300025986 Ga0207658_10000153 Ga0207658_1000015331 137
244 3300025986 Ga0207658_10013637 Ga0207658_100136372 137
245 3300025986 Ga0207658_10031859 Ga0207658_100318595 137
246 3300026023 Ga0207677_11030995 Ga0207677_110309951 137
247 3300026041 Ga0207639_10853013 Ga0207639_108530132 137
248 3300026041 Ga0207639_11106212 Ga0207639_111062121 137
249 3300026067 Ga0207678_10033605 Ga0207678_100336055 137
250 3300026067 Ga0207678_10077225 Ga0207678_100772255 137
251 3300026088 Ga0207641_10000103 Ga0207641_1000010377 137
252 3300026088 Ga0207641_11007564 Ga0207641_110075642 137
253 3300026089 Ga0207648_10013089 Ga0207648_100130895 137
254 3300026095 Ga0207676_10000044 Ga0207676_1000004477 137
255 3300026095 Ga0207676_10014379 Ga0207676_100143797 137
256 3300026095 Ga0207676_10296681 Ga0207676_102966812 137
257 3300026116 Ga0207674_10021373 Ga0207674_100213733 137
258 3300026116 Ga0207674_10092050 Ga0207674_100920504 137
259 3300026116 Ga0207674_11224864 Ga0207674_112248641 137
260 3300026118 Ga0207675_100023583 Ga0207675_1000235833 137
261 3300026121 Ga0207683_10090131 Ga0207683_100901312 137
262 3300027462 Ga0210000_1039011 Ga0210000_10390111 137
263 3300027665 Ga0209983_1026286 Ga0209983_10262862 137
264 3300027876 Ga0209974_10082323 Ga0209974_100823231 137
265 3300028379 Ga0268266_10021435 Ga0268266_100214354 137
266 3300028380 Ga0268265_10000142 Ga0268265_1000014277 137
267 3300028380 Ga0268265_10003941 Ga0268265_100039412 137
268 3300028380 Ga0268265_10050543 Ga0268265_100505436 137
269 3300028380 Ga0268265_10140648 Ga0268265_101406483 137
270 3300028380 Ga0268265_10232761 Ga0268265_102327613 137
271 3300028380 Ga0268265_10482227 Ga0268265_104822272 137
272 3300028380 Ga0268265_10509200 Ga0268265_105092002 137
273 3300028381 Ga0268264_10014949 Ga0268264_100149494 137
274 3300028381 Ga0268264_11768635 Ga0268264_117686351 137
275 3300028786 Ga0307517_10024515 Ga0307517_100245157 137
276 3300031548 Ga0307408_100106205 Ga0307408_1001062052 137
277 3300031548 Ga0307408_100227630 Ga0307408_1002276302 137
278 3300031548 Ga0307408_100503852 Ga0307408_1005038522 137
279 3300031548 Ga0307408_100531677 Ga0307408_1005316772 137
280 3300031548 Ga0307408_100536190 Ga0307408_1005361902 137
281 3300031548 Ga0307408_100596645 Ga0307408_1005966452 137
282 3300031548 Ga0307408_100843115 Ga0307408_1008431152 137
283 3300031548 Ga0307408_101091946 Ga0307408_1010919462 137
284 3300031548 Ga0307408_101627284 Ga0307408_1016272841 137
285 3300031548 Ga0307408_101994713 Ga0307408_1019947131 137
286 3300031731 Ga0307405_10250198 Ga0307405_102501982 137
287 3300031731 Ga0307405_10531051 Ga0307405_105310512 137
288 3300031731 Ga0307405_10662991 Ga0307405_106629912 137
289 3300031731 Ga0307405_10671713 Ga0307405_106717132 137
290 3300031824 Ga0307413_10023759 Ga0307413_100237593 137
291 3300031824 Ga0307413_10071876 Ga0307413_100718762 137
292 3300031824 Ga0307413_10107199 Ga0307413_101071992 137
293 3300031824 Ga0307413_10386333 Ga0307413_103863332 137
294 3300031824 Ga0307413_10564836 Ga0307413_105648362 137
295 3300031824 Ga0307413_10696192 Ga0307413_106961922 137
296 3300031824 Ga0307413_10822615 Ga0307413_108226152 137
297 3300031824 Ga0307413_11225693 Ga0307413_112256931 137
298 3300031852 Ga0307410_10055411 Ga0307410_100554112 137
299 3300031852 Ga0307410_10109687 Ga0307410_101096873 137
300 3300031852 Ga0307410_10287140 Ga0307410_102871402 137
301 3300031852 Ga0307410_10539063 Ga0307410_105390632 137
302 3300031852 Ga0307410_10554060 Ga0307410_105540602 137
303 3300031852 Ga0307410_11074995 Ga0307410_110749952 137
304 3300031852 Ga0307410_11401875 Ga0307410_114018751 137
305 3300031852 Ga0307410_11410036 Ga0307410_114100361 137
306 3300031901 Ga0307406_10090576 Ga0307406_100905762 137
307 3300031901 Ga0307406_10106032 Ga0307406_101060322 137
308 3300031901 Ga0307406_10208987 Ga0307406_102089872 137
309 3300031901 Ga0307406_10394589 Ga0307406_103945892 137
310 3300031901 Ga0307406_10428026 Ga0307406_104280262 137
311 3300031901 Ga0307406_10729885 Ga0307406_107298851 137
312 3300031901 Ga0307406_10898912 Ga0307406_108989121 137
313 3300031901 Ga0307406_11346141 Ga0307406_113461411 137
314 3300031903 Ga0307407_10078216 Ga0307407_100782163 137
315 3300031903 Ga0307407_10193828 Ga0307407_101938282 137
316 3300031903 Ga0307407_11495820 Ga0307407_114958201 137
317 3300031911 Ga0307412_10001551 Ga0307412_1000155110 137
318 3300031911 Ga0307412_10003245 Ga0307412_100032455 137
319 3300031911 Ga0307412_10076123 Ga0307412_100761233 137
320 3300031911 Ga0307412_10082451 Ga0307412_100824514 137
321 3300031911 Ga0307412_10106765 Ga0307412_101067651 137
322 3300031911 Ga0307412_10164618 Ga0307412_101646182 137
323 3300031911 Ga0307412_10225463 Ga0307412_102254632 137
324 3300031911 Ga0307412_10289088 Ga0307412_102890882 137
325 3300031911 Ga0307412_10333068 Ga0307412_103330682 137
326 3300031911 Ga0307412_10538722 Ga0307412_105387222 137
327 3300031911 Ga0307412_10566504 Ga0307412_105665042 137
328 3300031911 Ga0307412_10573201 Ga0307412_105732011 137
329 3300031911 Ga0307412_10596572 Ga0307412_105965722 137
330 3300031911 Ga0307412_11122878 Ga0307412_111228782 137
331 3300031911 Ga0307412_11125554 Ga0307412_111255541 137
332 3300031911 Ga0307412_11274211 Ga0307412_112742112 137
333 3300031911 Ga0307412_11339296 Ga0307412_113392962 137
334 3300031995 Ga0307409_100094765 Ga0307409_1000947653 137
335 3300031995 Ga0307409_100397355 Ga0307409_1003973552 137
336 3300031995 Ga0307409_100550759 Ga0307409_1005507592 137
337 3300031995 Ga0307409_100559332 Ga0307409_1005593321 137
338 3300031995 Ga0307409_100560315 Ga0307409_1005603152 137
339 3300031995 Ga0307409_100936069 Ga0307409_1009360692 137
340 3300031995 Ga0307409_102018102 Ga0307409_1020181021 137
341 3300032002 Ga0307416_100002549 Ga0307416_1000025492 137
342 3300032002 Ga0307416_100049705 Ga0307416_1000497054 137
343 3300032002 Ga0307416_100057475 Ga0307416_1000574752 137
344 3300032002 Ga0307416_100071336 Ga0307416_1000713362 137
345 3300032002 Ga0307416_100450459 Ga0307416_1004504592 137
346 3300032002 Ga0307416_100724940 Ga0307416_1007249401 137
347 3300032002 Ga0307416_100932513 Ga0307416_1009325132 137
348 3300032002 Ga0307416_101243409 Ga0307416_1012434092 137
349 3300032002 Ga0307416_101278636 Ga0307416_1012786362 137
350 3300032002 Ga0307416_101788507 Ga0307416_1017885072 137
351 3300032004 Ga0307414_10000486 Ga0307414_100004863 137
352 3300032004 Ga0307414_10001040 Ga0307414_1000104011 137
353 3300032004 Ga0307414_10006477 Ga0307414_100064774 137
354 3300032004 Ga0307414_10011626 Ga0307414_100116265 137
355 3300032004 Ga0307414_10039170 Ga0307414_100391702 137
356 3300032004 Ga0307414_10044651 Ga0307414_100446513 137
357 3300032004 Ga0307414_10049873 Ga0307414_100498732 137
358 3300032004 Ga0307414_10073472 Ga0307414_100734722 137
359 3300032004 Ga0307414_10120441 Ga0307414_101204413 137
360 3300032004 Ga0307414_10140986 Ga0307414_101409862 137
361 3300032004 Ga0307414_10275259 Ga0307414_102752593 137
362 3300032004 Ga0307414_10308300 Ga0307414_103083001 137
363 3300032004 Ga0307414_10457785 Ga0307414_104577852 137
364 3300032004 Ga0307414_10562784 Ga0307414_105627842 137
365 3300032004 Ga0307414_10581634 Ga0307414_105816342 137
366 3300032004 Ga0307414_10652973 Ga0307414_106529732 137
367 3300032004 Ga0307414_10674212 Ga0307414_106742122 137
368 3300032004 Ga0307414_10769207 Ga0307414_107692071 137
369 3300032004 Ga0307414_10771345 Ga0307414_107713452 137
370 3300032004 Ga0307414_10814078 Ga0307414_108140782 137
371 3300032004 Ga0307414_10861851 Ga0307414_108618511 137
372 3300032004 Ga0307414_10875399 Ga0307414_108753991 137
373 3300032004 Ga0307414_10914101 Ga0307414_109141012 137
374 3300032004 Ga0307414_10971483 Ga0307414_109714832 137
375 3300032004 Ga0307414_11147998 Ga0307414_111479982 137
376 3300032004 Ga0307414_11388252 Ga0307414_113882521 137
377 3300032004 Ga0307414_12168960 Ga0307414_121689601 137
378 3300032005 Ga0307411_10035984 Ga0307411_100359845 137
379 3300032005 Ga0307411_10073330 Ga0307411_100733304 137
380 3300032005 Ga0307411_10192888 Ga0307411_101928882 137
381 3300032005 Ga0307411_10236009 Ga0307411_102360092 137
382 3300032005 Ga0307411_10268432 Ga0307411_102684323 137
383 3300032005 Ga0307411_10418424 Ga0307411_104184242 137
384 3300032005 Ga0307411_10498630 Ga0307411_104986302 137
385 3300032005 Ga0307411_10717687 Ga0307411_107176871 137
386 3300032005 Ga0307411_10964729 Ga0307411_109647292 137
387 3300032005 Ga0307411_10980616 Ga0307411_109806162 137
388 3300032005 Ga0307411_10980658 Ga0307411_109806581 137
389 3300032005 Ga0307411_11500314 Ga0307411_115003141 137
390 3300032005 Ga0307411_11823706 Ga0307411_118237061 137
391 3300032126 Ga0307415_100004677 Ga0307415_1000046773 137
392 3300032126 Ga0307415_100027986 Ga0307415_1000279862 137
393 3300032126 Ga0307415_100191462 Ga0307415_1001914623 137
394 3300032126 Ga0307415_100356638 Ga0307415_1003566382 137
395 3300032126 Ga0307415_100375923 Ga0307415_1003759231 137
396 3300032126 Ga0307415_100555002 Ga0307415_1005550022 137
397 3300032126 Ga0307415_100766427 Ga0307415_1007664271 137
398 3300032126 Ga0307415_100787717 Ga0307415_1007877172 137
399 3300032126 Ga0307415_101457828 Ga0307415_1014578282 137
400 3300032126 Ga0307415_101762801 Ga0307415_1017628011 137
401 3300037471 Ga0395905_0112865 Ga0395905_0112865_1266_1679 137
402 3300037471 Ga0395905_0128838 Ga0395905_0128838_1336_1749 137
403 3300038443 Ga0395901_0121559 Ga0395901_0121559_1881_2294 137
404 3300039437 Ga0436365_1296624 Ga0436365_1296624_802_1215 137
405 3300039437 Ga0436365_1764132 Ga0436365_1764132_124_537 137
406 3300041408 Ga0439453_0132671 Ga0439453_0132671_61_474 137
407 3300041413 Ga0439465_0368210 Ga0439465_0368210_48_461 137
408 3300041452 Ga0451793_0089535 Ga0451793_0089535_292_705 137
409 3300042001 Ga0439441_137588 Ga0439441_137588_26_439 137
410 3300042002 Ga0439442_064523 Ga0439442_064523_198_611 137
411 3300042006 Ga0439432_062657 Ga0439432_062657_202_615 137
412 3300042006 Ga0439432_172598 Ga0439432_172598_174_587 137
413 3300042007 Ga0439449_0123456 Ga0439449_0123456_349_762 137
414 3300042116 Ga0450912_026182 Ga0450912_026182_17_430 137
415 3300042439 Ga0439464_0001561 Ga0439464_0001561_3799_4212 137
416 3300045051 Ga0451576_0494190 Ga0451576_0494190_560_973 137
417 3300046471 Ga0495650_0040089 Ga0495650_0040089_1474_1887 137
418 3300046500 Ga0495596_0170864 Ga0495596_0170864_81_494 137
419 3300046513 Ga0495616_0000187 Ga0495616_0000187_39023_39436 137
420 3300046522 Ga0495643_0011914 Ga0495643_0011914_503_916 137
421 3300046525 Ga0495663_0040407 Ga0495663_0040407_765_1178 137
422 3300046525 Ga0495663_0068786 Ga0495663_0068786_699_1112 137
423 3300046525 Ga0495663_0112274 Ga0495663_0112274_165_578 137
424 3300046525 Ga0495663_0160484 Ga0495663_0160484_181_594 137
425 3300046525 Ga0495663_0227550 Ga0495663_0227550_119_532 137
426 3300046530 Ga0495654_0015755 Ga0495654_0015755_3056_3469 137
427 3300046530 Ga0495654_0030157 Ga0495654_0030157_824_1237 137
428 3300046530 Ga0495654_0087132 Ga0495654_0087132_92_505 137
429 3300046537 Ga0495598_0004644 Ga0495598_0004644_2111_2524 137
430 3300046537 Ga0495598_0459613 Ga0495598_0459613_41_454 137
431 3300046539 Ga0495621_0006102 Ga0495621_0006102_2783_3196 137
432 3300046539 Ga0495621_0028095 Ga0495621_0028095_521_934 137
433 3300046558 Ga0495633_0284799 Ga0495633_0284799_16_429 137
434 3300046616 Ga0495668_0000024 Ga0495668_0000024_189294_189707 137
435 3300046616 Ga0495668_0019448 Ga0495668_0019448_1006_1419 137
436 3300046616 Ga0495668_0043954 Ga0495668_0043954_985_1398 137
437 3300046648 Ga0495611_0336069 Ga0495611_0336069_172_585 137
438 3300046660 Ga0495625_0000196 Ga0495625_0000196_6813_7226 137
439 3300046664 Ga0495659_0027612 Ga0495659_0027612_1490_1903 137
440 3300046684 Ga0495669_0000602 Ga0495669_0000602_11299_11727 137
441 3300046684 Ga0495669_0022836 Ga0495669_0022836_1751_2164 137
442 3300046684 Ga0495669_0436980 Ga0495669_0436980_128_541 137
443 3300046691 Ga0495670_0091718 Ga0495670_0091718_446_859 137
444 3300046691 Ga0495670_0365382 Ga0495670_0365382_57_470 137
445 3300046694 Ga0495649_0393355 Ga0495649_0393355_131_544 137
446 3300047318 Ga0495636_0226809 Ga0495636_0226809_187_600 137
447 3300047445 Ga0495677_0138458 Ga0495677_0138458_428_856 137
448 3300047470 Ga0495681_0351738 Ga0495681_0351738_10_423 137
449 3300047472 Ga0495686_0000701 Ga0495686_0000701_34298_34711 137
450 3300048903 Ga0496100_0144000 Ga0496100_0144000_192_617 137
451 3300048904 Ga0496101_0305200 Ga0496101_0305200_591_1031 137
452 3300048905 Ga0496102_0504780 Ga0496102_0504780_174_587 137
453 3300048906 Ga0496103_0047920 Ga0496103_0047920_1067_1507 137
454 3300048909 Ga0496106_1460242 Ga0496106_1460242_77_505 137
455 3300048911 Ga0496108_0283881 Ga0496108_0283881_314_742 137
456 3300048912 Ga0496109_0025686 Ga0496109_0025686_878_1306 137
457 3300048913 Ga0496110_0001413 Ga0496110_0001413_10207_10635 137
458 3300048914 Ga0496111_0011130 Ga0496111_0011130_5114_5542 137
459 3300048916 Ga0496113_1097698 Ga0496113_1097698_135_563 137
460 3300048917 Ga0496114_0146039 Ga0496114_0146039_1074_1502 137
461 3300048920 Ga0496117_0037162 Ga0496117_0037162_2913_3353 137
462 3300048921 Ga0496118_0000339 Ga0496118_0000339_51719_52159 137
463 3300048921 Ga0496118_0020455 Ga0496118_0020455_5076_5507 137
464 3300048924 Ga0496121_0000222 Ga0496121_0000222_75413_75844 137
465 3300049459 Ga0495678_017250 Ga0495678_017250_2638_3051 137
466 3300049513 Ga0501290_000464 Ga0501290_000464_1069_1482 137
467 3300049513 Ga0501290_006459 Ga0501290_006459_268_681 137
468 3300049515 Ga0501292_000026 Ga0501292_000026_27553_27966 137
469 3300049516 Ga0501293_001367 Ga0501293_001367_61_474 137
470 3300049517 Ga0501294_000620 Ga0501294_000620_2556_2969 137
471 3300049520 Ga0501297_003055 Ga0501297_003055_163_576 137
472 3300049521 Ga0501298_022812 Ga0501298_022812_706_1119 137
473 3300049523 Ga0501300_004021 Ga0501300_004021_769_1182 137
474 3300049523 Ga0501300_004703 Ga0501300_004703_785_1198 137
475 3300049523 Ga0501300_021080 Ga0501300_021080_400_813 137
476 3300049524 Ga0501301_001208 Ga0501301_001208_690_1103 137
477 3300049568 Ga0501031_0051644 Ga0501031_0051644_122_535 137
478 3300049569 Ga0501032_0165002 Ga0501032_0165002_382_795 137
479 3300049570 Ga0501033_0001955 Ga0501033_0001955_14578_14991 137
480 3300049572 Ga0501036_0225590 Ga0501036_0225590_1089_1502 137
481 3300049572 Ga0501036_1549534 Ga0501036_1549534_106_519 137
482 3300049573 Ga0501037_0168433 Ga0501037_0168433_1046_1459 137
483 3300049574 Ga0501038_0045845 Ga0501038_0045845_3025_3438 137
484 3300049574 Ga0501038_0050719 Ga0501038_0050719_552_965 137
485 3300049575 Ga0501039_0121354 Ga0501039_0121354_346_759 137
486 3300049579 Ga0501043_0046027 Ga0501043_0046027_1685_2098 137
487 3300049581 Ga0501047_0639593 Ga0501047_0639593_70_483 137
488 3300049581 Ga0501047_1452705 Ga0501047_1452705_58_471 137
489 3300049582 Ga0501048_0290394 Ga0501048_0290394_703_1116 137
490 3300049587 Ga0501071_0450790 Ga0501071_0450790_66_479 137
491 3300049587 Ga0501071_1331330 Ga0501071_1331330_118_531 137
492 3300049652 Ga0501202_004276 Ga0501202_004276_1256_1669 137
493 3300049653 Ga0501206_000824 Ga0501206_000824_2517_2930 137
494 3300049661 Ga0501217_296631 Ga0501217_296631_81_494 137
495 3300049662 Ga0501222_000640 Ga0501222_000640_1670_2083 137
496 3300049663 Ga0501223_002932 Ga0501223_002932_239_652 137
497 3300049663 Ga0501223_005742 Ga0501223_005742_1030_1443 137
498 3300049663 Ga0501223_006203 Ga0501223_006203_1354_1767 137
499 3300049664 Ga0501224_000020 Ga0501224_000020_3092_3505 137
500 3300049664 Ga0501224_009136 Ga0501224_009136_980_1393 137
501 3300049665 Ga0501227_010889 Ga0501227_010889_1442_1855 137
502 3300049665 Ga0501227_016975 Ga0501227_016975_710_1123 137
503 3300049668 Ga0501233_007168 Ga0501233_007168_1199_1612 137
504 3300049668 Ga0501233_048660 Ga0501233_048660_573_986 137
505 3300049669 Ga0501235_001905 Ga0501235_001905_859_1272 137
506 3300049669 Ga0501235_002921 Ga0501235_002921_3018_3431 137
507 3300049675 Ga0501243_041061 Ga0501243_041061_41_454 137
508 3300049677 Ga0501247_037872 Ga0501247_037872_209_622 137
509 3300049686 Ga0501257_000131 Ga0501257_000131_1555_1968 137
510 3300049688 Ga0501259_000268 Ga0501259_000268_6722_7135 137
511 3300049690 Ga0501261_000046 Ga0501261_000046_756_1169 137
512 3300049704 Ga0501221_005058 Ga0501221_005058_506_919 137
513 3300049705 Ga0501225_0000009 Ga0501225_0000009_45582_45995 137
514 3300049706 Ga0501229_003848 Ga0501229_003848_571_984 137
515 3300049708 Ga0501245_001012 Ga0501245_001012_667_1080 137
516 3300049765 Ga0501268_091764 Ga0501268_091764_18_431 137
517 3300049773 Ga0501276_002528 Ga0501276_002528_131_544 137
518 3300049775 Ga0501279_000027 Ga0501279_000027_9289_9702 137
519 3300049776 Ga0501280_000044 Ga0501280_000044_1062_1475 137
520 3300049776 Ga0501280_001131 Ga0501280_001131_1047_1460 137
521 3300049777 Ga0501281_00442 Ga0501281_00442_3420_3833 137
522 3300049778 Ga0501282_000334 Ga0501282_000334_1340_1753 137
523 3300049779 Ga0501283_009832 Ga0501283_009832_256_669 137
524 3300049822 Ga0501035_0018153 Ga0501035_0018153_219_632 137
525 3300049823 Ga0501044_0196206 Ga0501044_0196206_1116_1529 137
526 3300049853 Ga0501226_000187 Ga0501226_000187_259_672 137
527 3300050005 Ga0501284_01647 Ga0501284_01647_364_777 137
528 3300050510 nmdc:mga06r32_1106451_c1 nmdc:mga06r32_1106451_c1_238_651 137
529 3300050510 nmdc:mga06r32_14029_c1 nmdc:mga06r32_14029_c1_1550_1969 137
530 3300050511 nmdc:mga08y16_719013_c1 nmdc:mga08y16_719013_c1_47_460 137
531 3300053087 Ga0500643_000065 Ga0500643_000065_70555_70968 137
532 3300053087 Ga0500643_000488 Ga0500643_000488_9535_9948 137
533 3300053087 Ga0500643_100970 Ga0500643_100970_231_644 137
534 3300053116 Ga0500592_000140 Ga0500592_000140_13203_13616 137
535 3300053116 Ga0500592_000384 Ga0500592_000384_6739_7152 137
536 3300053116 Ga0500592_028997 Ga0500592_028997_379_792 137
537 3300053116 Ga0500592_061242 Ga0500592_061242_112_525 137
538 3300053134 Ga0500658_0402787 Ga0500658_0402787_11_424 137
539 3300053136 Ga0500559_0002322 Ga0500559_0002322_8174_8587 137
540 3300053139 Ga0500568_0001688 Ga0500568_0001688_4144_4557 137
541 3300053148 Ga0500590_000142 Ga0500590_000142_317_730 137
542 3300053151 Ga0500604_0009046 Ga0500604_0009046_1091_1504 137
543 3300053151 Ga0500604_0015383 Ga0500604_0015383_1664_2077 137
544 3300053151 Ga0500604_0028845 Ga0500604_0028845_217_630 137
545 3300053158 Ga0500627_0000043 Ga0500627_0000043_59058_59471 137
546 3300053158 Ga0500627_0000551 Ga0500627_0000551_3163_3576 137
547 3300053158 Ga0500627_0161586 Ga0500627_0161586_492_905 137
548 3300053727 Ga0500611_044866 Ga0500611_044866_395_808 137
549 3300055283 Ga0500661_000036 Ga0500661_000036_10677_11090 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11351

GTA_holin_3TM

Holin of 3TMs, for gene-transfer release

34

157

0.98

Feature Viewer

pLDDT pTM Quality
70.94 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map