F462384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 549 | 252 | 542 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300031911|Ga0307412_10596572|Ga0307412_105965722 |
| Length | 166 |
| Sequence | MAGSRTVSVQWADRSTQSIWSIPLRKNPAMSILEAIVGPVSKLLDKIIPDPQARDRAKLELLKLQGDQEMQTITAQMQAIVAEAQSSDPWTSRARPSFLYVMYALLLWAIPMGLIAAARPEMAADIAKGMNAYLAGIPEPLYALFGTGYLGYTAARSWGKAKGVEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 4 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 5 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 6 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 7 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 8 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 9 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 126 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 131 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 132 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 144 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 145 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 146 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 147 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 148 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 149 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 150 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 151 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 152 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 153 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 178 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 179 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 180 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 181 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 188 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 189 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 190 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 191 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 192 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 194 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 195 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 196 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 197 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 198 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 199 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 200 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 201 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 213 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 214 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 215 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 222 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 223 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 224 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 225 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 227 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 229 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 230 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 231 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 232 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 233 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 234 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 235 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 236 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 240 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 241 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 244 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 245 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 246 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 247 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 248 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 249 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 250 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 252 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 0 |
| Isolates | 1.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.29 |
| Nodule | 0 |
| Rhizoplane | 2.91 |
| Rhizosphere | 87.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_86265 | 2162886006 | Bacteria | 1676 |
| 2 | SwRhRL2b_contig_650828 | 2162886007 | Unclassified | 930 |
| 3 | JGI24752J21851_1000370 | 3300001976 | Bacteria | 6247 |
| 4 | JGI24749J21850_1006682 | 3300002076 | Bacteria | 1605 |
| 5 | JGI24742J22300_10022985 | 3300002244 | Bacteria | 1070 |
| 6 | JGI24742J22300_10068936 | 3300002244 | Bacteria | 657 |
| 7 | JGI24751J29686_10117683 | 3300002459 | Bacteria | 558 |
| 8 | Ga0055536_1002465 | 3300003781 | Bacteria | 10393 |
| 9 | Ga0055536_1003362 | 3300003781 | Bacteria | 8638 |
| 10 | Ga0055536_1026479 | 3300003781 | Bacteria | 1624 |
| 11 | Ga0055534_1017433 | 3300003784 | Bacteria | 1270 |
| 12 | Ga0055530_10002163 | 3300003791 | Bacteria | 13024 |
| 13 | Ga0055531_10002264 | 3300003794 | Bacteria | 13024 |
| 14 | Ga0055531_10002939 | 3300003794 | Bacteria | 11088 |
| 15 | JGI25405J52794_10014256 | 3300003911 | Bacteria | 1550 |
| 16 | Ga0065704_10123386 | 3300005289 | Bacteria | 1734 |
| 17 | Ga0065712_10353773 | 3300005290 | Bacteria | 784 |
| 18 | Ga0065715_10135674 | 3300005293 | Bacteria | 1934 |
| 19 | Ga0065715_10160311 | 3300005293 | Bacteria | 1636 |
| 20 | Ga0065715_10165694 | 3300005293 | Bacteria | 1589 |
| 21 | Ga0065707_10081814 | 3300005295 | Bacteria | 36963 |
| 22 | Ga0065707_10121622 | 3300005295 | Bacteria | 2106 |
| 23 | Ga0065707_10124743 | 3300005295 | Bacteria | 2038 |
| 24 | Ga0065707_11085056 | 3300005295 | Bacteria | 519 |
| 25 | Ga0070658_10055435 | 3300005327 | Bacteria | 3221 |
| 26 | Ga0070676_10071866 | 3300005328 | Bacteria | 2079 |
| 27 | Ga0070676_10240287 | 3300005328 | Bacteria | 1204 |
| 28 | Ga0070676_10474792 | 3300005328 | Bacteria | 884 |
| 29 | Ga0070670_100000081 | 3300005331 | Bacteria | 92043 |
| 30 | Ga0070670_100000350 | 3300005331 | Bacteria | 38698 |
| 31 | Ga0070670_100020103 | 3300005331 | Bacteria | 5735 |
| 32 | Ga0070670_100220323 | 3300005331 | Bacteria | 1651 |
| 33 | Ga0070677_10014798 | 3300005333 | Bacteria | 2753 |
| 34 | Ga0070666_10087145 | 3300005335 | Bacteria | 2140 |
| 35 | Ga0068868_100489190 | 3300005338 | Bacteria | 1076 |
| 36 | Ga0070661_100172245 | 3300005344 | Bacteria | 1644 |
| 37 | Ga0070661_100752338 | 3300005344 | Bacteria | 797 |
| 38 | Ga0070668_100135102 | 3300005347 | Bacteria | 1983 |
| 39 | Ga0070668_100185402 | 3300005347 | Bacteria | 1702 |
| 40 | Ga0070668_100521949 | 3300005347 | Bacteria | 1031 |
| 41 | Ga0070668_100708749 | 3300005347 | Bacteria | 888 |
| 42 | Ga0070669_100001581 | 3300005353 | Bacteria | 16498 |
| 43 | Ga0070669_100026397 | 3300005353 | Bacteria | 4179 |
| 44 | Ga0070669_100054890 | 3300005353 | Bacteria | 2919 |
| 45 | Ga0070669_100096449 | 3300005353 | Bacteria | 2225 |
| 46 | Ga0070675_100001857 | 3300005354 | Bacteria | 15581 |
| 47 | Ga0070675_100002352 | 3300005354 | Bacteria | 14063 |
| 48 | Ga0070675_100006205 | 3300005354 | Bacteria | 9170 |
| 49 | Ga0070675_100256398 | 3300005354 | Bacteria | 1532 |
| 50 | Ga0070671_100001032 | 3300005355 | Bacteria | 20490 |
| 51 | Ga0070671_100224229 | 3300005355 | Bacteria | 1595 |
| 52 | Ga0070671_101411729 | 3300005355 | Bacteria | 615 |
| 53 | Ga0070674_100001573 | 3300005356 | Bacteria | 12214 |
| 54 | Ga0070674_100033419 | 3300005356 | Bacteria | 3424 |
| 55 | Ga0070674_100057994 | 3300005356 | Bacteria | 2690 |
| 56 | Ga0070673_100003253 | 3300005364 | Bacteria | 10079 |
| 57 | Ga0070673_100267958 | 3300005364 | Bacteria | 1494 |
| 58 | Ga0070667_100000774 | 3300005367 | Bacteria | 30276 |
| 59 | Ga0070667_100002350 | 3300005367 | Bacteria | 16565 |
| 60 | Ga0070667_100020574 | 3300005367 | Bacteria | 5478 |
| 61 | Ga0070667_100035262 | 3300005367 | Bacteria | 4190 |
| 62 | Ga0070701_10026160 | 3300005438 | Bacteria | 2843 |
| 63 | Ga0070708_101635723 | 3300005445 | Bacteria | 599 |
| 64 | Ga0070663_100070130 | 3300005455 | Bacteria | 2548 |
| 65 | Ga0070663_100097585 | 3300005455 | Bacteria | 2188 |
| 66 | Ga0070678_100038160 | 3300005456 | Bacteria | 3379 |
| 67 | Ga0070678_100127885 | 3300005456 | Bacteria | 2014 |
| 68 | Ga0070662_100002989 | 3300005457 | Bacteria | 10511 |
| 69 | Ga0070662_100008923 | 3300005457 | Bacteria | 6536 |
| 70 | Ga0070662_100645689 | 3300005457 | Bacteria | 892 |
| 71 | Ga0070662_100845829 | 3300005457 | Bacteria | 779 |
| 72 | Ga0068867_100022921 | 3300005459 | Bacteria | 4467 |
| 73 | Ga0070699_102217228 | 3300005518 | Bacteria | 501 |
| 74 | Ga0068853_100051988 | 3300005539 | Bacteria | 3528 |
| 75 | Ga0068853_100501538 | 3300005539 | Bacteria | 1146 |
| 76 | Ga0070672_100005889 | 3300005543 | Bacteria | 8177 |
| 77 | Ga0070672_100016447 | 3300005543 | Bacteria | 5296 |
| 78 | Ga0070672_100513576 | 3300005543 | Bacteria | 1037 |
| 79 | Ga0070665_100005505 | 3300005548 | Bacteria | 13037 |
| 80 | Ga0070665_100056228 | 3300005548 | Bacteria | 3946 |
| 81 | Ga0070664_100004435 | 3300005564 | Bacteria | 11273 |
| 82 | Ga0070664_100114616 | 3300005564 | Bacteria | 2355 |
| 83 | Ga0070664_100467324 | 3300005564 | Bacteria | 1160 |
| 84 | Ga0068857_100587402 | 3300005577 | Bacteria | 1052 |
| 85 | Ga0068857_101646225 | 3300005577 | Bacteria | 627 |
| 86 | Ga0068854_100165413 | 3300005578 | Bacteria | 1717 |
| 87 | Ga0068859_100046644 | 3300005617 | Bacteria | 4351 |
| 88 | Ga0068859_100083693 | 3300005617 | Bacteria | 3234 |
| 89 | Ga0068859_100775763 | 3300005617 | Bacteria | 1047 |
| 90 | Ga0068859_101022323 | 3300005617 | Bacteria | 908 |
| 91 | Ga0068864_100000016 | 3300005618 | Bacteria | 292454 |
| 92 | Ga0068864_100031131 | 3300005618 | Bacteria | 4526 |
| 93 | Ga0068861_100124437 | 3300005719 | Bacteria | 2084 |
| 94 | Ga0068851_10178826 | 3300005834 | Bacteria | 1174 |
| 95 | Ga0068870_10077948 | 3300005840 | Bacteria | 1824 |
| 96 | Ga0068870_10395111 | 3300005840 | Bacteria | 898 |
| 97 | Ga0068863_100000014 | 3300005841 | Bacteria | 216135 |
| 98 | Ga0068863_100000089 | 3300005841 | Bacteria | 101645 |
| 99 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 100 | Ga0068860_102227977 | 3300005843 | Bacteria | 569 |
| 101 | Ga0068862_100000068 | 3300005844 | Bacteria | 123535 |
| 102 | Ga0068862_100006350 | 3300005844 | Bacteria | 9828 |
| 103 | Ga0068862_100012958 | 3300005844 | Bacteria | 6898 |
| 104 | Ga0068862_100177953 | 3300005844 | Bacteria | 1908 |
| 105 | Ga0068862_102571033 | 3300005844 | Bacteria | 521 |
| 106 | Ga0081455_10000100 | 3300005937 | Bacteria | 95033 |
| 107 | Ga0081539_10100337 | 3300005985 | Bacteria | 1477 |
| 108 | Ga0068871_100297756 | 3300006358 | Bacteria | 1415 |
| 109 | Ga0075428_100895044 | 3300006844 | Bacteria | 941 |
| 110 | Ga0097620_100046642 | 3300006931 | Bacteria | 4351 |
| 111 | Ga0097620_100083693 | 3300006931 | Bacteria | 3234 |
| 112 | Ga0097620_100775718 | 3300006931 | Bacteria | 1047 |
| 113 | Ga0097620_101022303 | 3300006931 | Bacteria | 908 |
| 114 | Ga0111539_10256176 | 3300009094 | Bacteria | 2038 |
| 115 | Ga0111539_10639484 | 3300009094 | Bacteria | 1239 |
| 116 | Ga0105247_10009279 | 3300009101 | Bacteria | 5976 |
| 117 | Ga0105248_10000021 | 3300009177 | Bacteria | 276159 |
| 118 | Ga0105248_10104896 | 3300009177 | Bacteria | 3187 |
| 119 | Ga0105248_10525636 | 3300009177 | Bacteria | 1334 |
| 120 | Ga0105249_10000162 | 3300009553 | Bacteria | 80304 |
| 121 | Ga0105249_10138372 | 3300009553 | Bacteria | 2332 |
| 122 | Ga0105249_10209781 | 3300009553 | Bacteria | 1911 |
| 123 | Ga0105249_11216989 | 3300009553 | Bacteria | 824 |
| 124 | Ga0157371_10464224 | 3300013102 | Bacteria | 932 |
| 125 | Ga0157370_10362754 | 3300013104 | Bacteria | 1335 |
| 126 | Ga0157378_10012259 | 3300013297 | Bacteria | 7504 |
| 127 | Ga0157378_10064485 | 3300013297 | Bacteria | 3277 |
| 128 | Ga0163162_10092656 | 3300013306 | Bacteria | 3105 |
| 129 | Ga0157372_10913192 | 3300013307 | Bacteria | 1018 |
| 130 | Ga0157372_10973748 | 3300013307 | Bacteria | 983 |
| 131 | Ga0157375_10055112 | 3300013308 | Bacteria | 3919 |
| 132 | Ga0157375_10543734 | 3300013308 | Bacteria | 1324 |
| 133 | Ga0157375_13300480 | 3300013308 | Bacteria | 538 |
| 134 | Ga0163163_10223509 | 3300014325 | Bacteria | 1932 |
| 135 | Ga0157380_10000062 | 3300014326 | Bacteria | 61714 |
| 136 | Ga0157380_10735166 | 3300014326 | Bacteria | 996 |
| 137 | Ga0157379_10303499 | 3300014968 | Bacteria | 1455 |
| 138 | Ga0157379_11103863 | 3300014968 | Bacteria | 760 |
| 139 | Ga0163161_10016024 | 3300017792 | Bacteria | 5231 |
| 140 | Ga0163161_10020224 | 3300017792 | Bacteria | 4669 |
| 141 | Ga0163161_11230669 | 3300017792 | Bacteria | 648 |
| 142 | Ga0209675_1003647 | 3300025291 | Bacteria | 7219 |
| 143 | Ga0209676_1000045 | 3300025292 | Bacteria | 412331 |
| 144 | Ga0209676_1000211 | 3300025292 | Bacteria | 129654 |
| 145 | Ga0209676_1000465 | 3300025292 | Bacteria | 68153 |
| 146 | Ga0209676_1082234 | 3300025292 | Bacteria | 731 |
| 147 | Ga0209025_1003047 | 3300025294 | Bacteria | 16515 |
| 148 | Ga0209758_1036580 | 3300025297 | Bacteria | 1913 |
| 149 | Ga0209050_1000047 | 3300025298 | Bacteria | 380561 |
| 150 | Ga0209050_1003310 | 3300025298 | Bacteria | 12045 |
| 151 | Ga0209050_1031783 | 3300025298 | Bacteria | 1637 |
| 152 | Ga0209257_1000076 | 3300025304 | Bacteria | 324617 |
| 153 | Ga0209257_1000644 | 3300025304 | Bacteria | 55811 |
| 154 | Ga0209257_1001050 | 3300025304 | Bacteria | 36695 |
| 155 | Ga0209257_1042769 | 3300025304 | Bacteria | 1334 |
| 156 | Ga0207697_10004192 | 3300025315 | Bacteria | 6933 |
| 157 | Ga0207713_1048207 | 3300025735 | Bacteria | 1717 |
| 158 | Ga0207682_10000428 | 3300025893 | Bacteria | 19411 |
| 159 | Ga0207710_10031675 | 3300025900 | Bacteria | 2313 |
| 160 | Ga0207688_10134847 | 3300025901 | Bacteria | 1449 |
| 161 | Ga0207680_10081041 | 3300025903 | Bacteria | 2039 |
| 162 | Ga0207680_10289558 | 3300025903 | Bacteria | 1139 |
| 163 | Ga0207645_10174856 | 3300025907 | Bacteria | 1408 |
| 164 | Ga0207643_10119887 | 3300025908 | Bacteria | 1557 |
| 165 | Ga0207705_11069947 | 3300025909 | Bacteria | 622 |
| 166 | Ga0207662_10224523 | 3300025918 | Bacteria | 1224 |
| 167 | Ga0207657_10421338 | 3300025919 | Bacteria | 1049 |
| 168 | Ga0207649_10120255 | 3300025920 | Bacteria | 1770 |
| 169 | Ga0207649_10603037 | 3300025920 | Bacteria | 845 |
| 170 | Ga0207681_10018328 | 3300025923 | Bacteria | 4411 |
| 171 | Ga0207681_10020618 | 3300025923 | Bacteria | 4180 |
| 172 | Ga0207681_11204108 | 3300025923 | Bacteria | 636 |
| 173 | Ga0207681_11535641 | 3300025923 | Bacteria | 558 |
| 174 | Ga0207650_10000069 | 3300025925 | Bacteria | 138442 |
| 175 | Ga0207650_10011078 | 3300025925 | Bacteria | 6200 |
| 176 | Ga0207650_10015737 | 3300025925 | Bacteria | 5273 |
| 177 | Ga0207650_10355668 | 3300025925 | Bacteria | 1206 |
| 178 | Ga0207650_10465713 | 3300025925 | Bacteria | 1053 |
| 179 | Ga0207659_10002256 | 3300025926 | Bacteria | 11474 |
| 180 | Ga0207659_10021111 | 3300025926 | Bacteria | 4316 |
| 181 | Ga0207659_10344972 | 3300025926 | Bacteria | 1234 |
| 182 | Ga0207644_10007270 | 3300025931 | Bacteria | 7207 |
| 183 | Ga0207644_10027624 | 3300025931 | Bacteria | 3922 |
| 184 | Ga0207644_10194663 | 3300025931 | Bacteria | 1596 |
| 185 | Ga0207644_10369746 | 3300025931 | Bacteria | 1168 |
| 186 | Ga0207644_11027778 | 3300025931 | Bacteria | 692 |
| 187 | Ga0207706_10005825 | 3300025933 | Bacteria | 11464 |
| 188 | Ga0207706_10008036 | 3300025933 | Bacteria | 9736 |
| 189 | Ga0207706_10069641 | 3300025933 | Bacteria | 3094 |
| 190 | Ga0207706_10360039 | 3300025933 | Bacteria | 1264 |
| 191 | Ga0207669_10031264 | 3300025937 | Bacteria | 2972 |
| 192 | Ga0207669_10267926 | 3300025937 | Bacteria | 1281 |
| 193 | Ga0207691_10012970 | 3300025940 | Bacteria | 7981 |
| 194 | Ga0207691_10041883 | 3300025940 | Bacteria | 4224 |
| 195 | Ga0207691_10091188 | 3300025940 | Bacteria | 2731 |
| 196 | Ga0207691_10305900 | 3300025940 | Bacteria | 1365 |
| 197 | Ga0207711_10000025 | 3300025941 | Bacteria | 289972 |
| 198 | Ga0207711_10029142 | 3300025941 | Bacteria | 4653 |
| 199 | Ga0207679_10029566 | 3300025945 | Bacteria | 3816 |
| 200 | Ga0207679_10126589 | 3300025945 | Bacteria | 2042 |
| 201 | Ga0207679_10481234 | 3300025945 | Bacteria | 1105 |
| 202 | Ga0207651_10002735 | 3300025960 | Bacteria | 8469 |
| 203 | Ga0207651_10205915 | 3300025960 | Bacteria | 1580 |
| 204 | Ga0207712_10000316 | 3300025961 | Bacteria | 44217 |
| 205 | Ga0207712_10501626 | 3300025961 | Bacteria | 1037 |
| 206 | Ga0207712_11046943 | 3300025961 | Bacteria | 725 |
| 207 | Ga0207668_10283104 | 3300025972 | Bacteria | 1360 |
| 208 | Ga0207668_10401185 | 3300025972 | Bacteria | 1159 |
| 209 | Ga0207668_10513619 | 3300025972 | Bacteria | 1032 |
| 210 | Ga0207668_10579674 | 3300025972 | Bacteria | 975 |
| 211 | Ga0207640_10015531 | 3300025981 | Bacteria | 4410 |
| 212 | Ga0207640_10185237 | 3300025981 | Bacteria | 1565 |
| 213 | Ga0207640_10315565 | 3300025981 | Bacteria | 1242 |
| 214 | Ga0207640_10761989 | 3300025981 | Bacteria | 835 |
| 215 | Ga0207658_10000153 | 3300025986 | Bacteria | 72252 |
| 216 | Ga0207658_10003755 | 3300025986 | Bacteria | 10697 |
| 217 | Ga0207658_10013637 | 3300025986 | Bacteria | 5560 |
| 218 | Ga0207658_10031859 | 3300025986 | Bacteria | 3748 |
| 219 | Ga0207677_11030995 | 3300026023 | Bacteria | 747 |
| 220 | Ga0207703_10051426 | 3300026035 | Bacteria | 3339 |
| 221 | Ga0207639_10853013 | 3300026041 | Bacteria | 850 |
| 222 | Ga0207639_11106212 | 3300026041 | Bacteria | 743 |
| 223 | Ga0207678_10033605 | 3300026067 | Bacteria | 4467 |
| 224 | Ga0207678_10077225 | 3300026067 | Bacteria | 2853 |
| 225 | Ga0207641_10000103 | 3300026088 | Bacteria | 122350 |
| 226 | Ga0207641_10000126 | 3300026088 | Bacteria | 112607 |
| 227 | Ga0207641_11007564 | 3300026088 | Bacteria | 830 |
| 228 | Ga0207648_10013089 | 3300026089 | Bacteria | 7735 |
| 229 | Ga0207676_10000044 | 3300026095 | Bacteria | 161679 |
| 230 | Ga0207676_10014379 | 3300026095 | Bacteria | 5692 |
| 231 | Ga0207676_10296681 | 3300026095 | Bacteria | 1474 |
| 232 | Ga0207674_10021373 | 3300026116 | Bacteria | 6969 |
| 233 | Ga0207674_10092050 | 3300026116 | Bacteria | 3022 |
| 234 | Ga0207674_11224864 | 3300026116 | Bacteria | 720 |
| 235 | Ga0207675_100023583 | 3300026118 | Bacteria | 5725 |
| 236 | Ga0207683_10090131 | 3300026121 | Bacteria | 2730 |
| 237 | Ga0210000_1039011 | 3300027462 | Bacteria | 752 |
| 238 | Ga0209983_1026286 | 3300027665 | Bacteria | 1231 |
| 239 | Ga0209974_10082323 | 3300027876 | Bacteria | 1109 |
| 240 | Ga0268266_10011921 | 3300028379 | Bacteria | 7529 |
| 241 | Ga0268266_10021435 | 3300028379 | Bacteria | 5504 |
| 242 | Ga0268265_10000142 | 3300028380 | Bacteria | 91165 |
| 243 | Ga0268265_10003941 | 3300028380 | Bacteria | 10459 |
| 244 | Ga0268265_10008961 | 3300028380 | Bacteria | 6767 |
| 245 | Ga0268265_10050543 | 3300028380 | Bacteria | 3133 |
| 246 | Ga0268265_10140648 | 3300028380 | Bacteria | 2020 |
| 247 | Ga0268265_10232761 | 3300028380 | Bacteria | 1620 |
| 248 | Ga0268265_10482227 | 3300028380 | Bacteria | 1165 |
| 249 | Ga0268265_10509200 | 3300028380 | Bacteria | 1136 |
| 250 | Ga0268264_10000077 | 3300028381 | Bacteria | 252597 |
| 251 | Ga0268264_10014949 | 3300028381 | Bacteria | 6372 |
| 252 | Ga0268264_11768635 | 3300028381 | Bacteria | 628 |
| 253 | Ga0307517_10024515 | 3300028786 | Bacteria | 7426 |
| 254 | Ga0265327_10070126 | 3300031251 | Bacteria | 1757 |
| 255 | Ga0307408_100106205 | 3300031548 | Bacteria | 2148 |
| 256 | Ga0307408_100227630 | 3300031548 | Bacteria | 1525 |
| 257 | Ga0307408_100280484 | 3300031548 | Bacteria | 1387 |
| 258 | Ga0307408_100503852 | 3300031548 | Bacteria | 1060 |
| 259 | Ga0307408_100531677 | 3300031548 | Bacteria | 1034 |
| 260 | Ga0307408_100536190 | 3300031548 | Bacteria | 1030 |
| 261 | Ga0307408_100596645 | 3300031548 | Bacteria | 981 |
| 262 | Ga0307408_100843115 | 3300031548 | Bacteria | 835 |
| 263 | Ga0307408_101091946 | 3300031548 | Bacteria | 740 |
| 264 | Ga0307408_101627284 | 3300031548 | Bacteria | 614 |
| 265 | Ga0307408_101994713 | 3300031548 | Bacteria | 558 |
| 266 | Ga0307405_10132371 | 3300031731 | Bacteria | 1725 |
| 267 | Ga0307405_10250198 | 3300031731 | Bacteria | 1318 |
| 268 | Ga0307405_10531051 | 3300031731 | Bacteria | 949 |
| 269 | Ga0307405_10662991 | 3300031731 | Bacteria | 859 |
| 270 | Ga0307405_10671713 | 3300031731 | Bacteria | 854 |
| 271 | Ga0307413_10023759 | 3300031824 | Bacteria | 3327 |
| 272 | Ga0307413_10071876 | 3300031824 | Bacteria | 2181 |
| 273 | Ga0307413_10107199 | 3300031824 | Bacteria | 1861 |
| 274 | Ga0307413_10386333 | 3300031824 | Bacteria | 1092 |
| 275 | Ga0307413_10564836 | 3300031824 | Bacteria | 925 |
| 276 | Ga0307413_10696192 | 3300031824 | Bacteria | 843 |
| 277 | Ga0307413_10822615 | 3300031824 | Bacteria | 782 |
| 278 | Ga0307413_11225693 | 3300031824 | Bacteria | 653 |
| 279 | Ga0307410_10055411 | 3300031852 | Bacteria | 2691 |
| 280 | Ga0307410_10109687 | 3300031852 | Bacteria | 1995 |
| 281 | Ga0307410_10287140 | 3300031852 | Bacteria | 1293 |
| 282 | Ga0307410_10539063 | 3300031852 | Bacteria | 965 |
| 283 | Ga0307410_10554060 | 3300031852 | Bacteria | 953 |
| 284 | Ga0307410_11074995 | 3300031852 | Bacteria | 696 |
| 285 | Ga0307410_11401875 | 3300031852 | Bacteria | 613 |
| 286 | Ga0307410_11410036 | 3300031852 | Bacteria | 612 |
| 287 | Ga0307406_10050625 | 3300031901 | Bacteria | 2634 |
| 288 | Ga0307406_10090576 | 3300031901 | Bacteria | 2058 |
| 289 | Ga0307406_10106032 | 3300031901 | Bacteria | 1924 |
| 290 | Ga0307406_10208987 | 3300031901 | Bacteria | 1442 |
| 291 | Ga0307406_10394589 | 3300031901 | Bacteria | 1095 |
| 292 | Ga0307406_10428026 | 3300031901 | Bacteria | 1056 |
| 293 | Ga0307406_10729885 | 3300031901 | Bacteria | 830 |
| 294 | Ga0307406_10898912 | 3300031901 | Bacteria | 754 |
| 295 | Ga0307406_11346141 | 3300031901 | Bacteria | 624 |
| 296 | Ga0307407_10078216 | 3300031903 | Bacteria | 1992 |
| 297 | Ga0307407_10193828 | 3300031903 | Bacteria | 1356 |
| 298 | Ga0307407_11495820 | 3300031903 | Bacteria | 534 |
| 299 | Ga0307412_10001551 | 3300031911 | Bacteria | 12691 |
| 300 | Ga0307412_10003245 | 3300031911 | Bacteria | 9042 |
| 301 | Ga0307412_10076123 | 3300031911 | Bacteria | 2304 |
| 302 | Ga0307412_10082451 | 3300031911 | Bacteria | 2227 |
| 303 | Ga0307412_10106765 | 3300031911 | Bacteria | 1991 |
| 304 | Ga0307412_10143051 | 3300031911 | Bacteria | 1754 |
| 305 | Ga0307412_10164618 | 3300031911 | Bacteria | 1652 |
| 306 | Ga0307412_10225463 | 3300031911 | Bacteria | 1439 |
| 307 | Ga0307412_10289088 | 3300031911 | Bacteria | 1290 |
| 308 | Ga0307412_10333068 | 3300031911 | Bacteria | 1212 |
| 309 | Ga0307412_10538722 | 3300031911 | Bacteria | 978 |
| 310 | Ga0307412_10566504 | 3300031911 | Bacteria | 956 |
| 311 | Ga0307412_10573201 | 3300031911 | Bacteria | 951 |
| 312 | Ga0307412_10596572 | 3300031911 | Bacteria | 935 |
| 313 | Ga0307412_11122878 | 3300031911 | Bacteria | 700 |
| 314 | Ga0307412_11125554 | 3300031911 | Bacteria | 700 |
| 315 | Ga0307412_11274211 | 3300031911 | Bacteria | 661 |
| 316 | Ga0307412_11339296 | 3300031911 | Bacteria | 646 |
| 317 | Ga0307412_11538914 | 3300031911 | Bacteria | 606 |
| 318 | Ga0307409_100094765 | 3300031995 | Bacteria | 2457 |
| 319 | Ga0307409_100397355 | 3300031995 | Bacteria | 1315 |
| 320 | Ga0307409_100550759 | 3300031995 | Bacteria | 1132 |
| 321 | Ga0307409_100559332 | 3300031995 | Bacteria | 1124 |
| 322 | Ga0307409_100560315 | 3300031995 | Bacteria | 1123 |
| 323 | Ga0307409_100936069 | 3300031995 | Bacteria | 882 |
| 324 | Ga0307409_102018102 | 3300031995 | Bacteria | 606 |
| 325 | Ga0307416_100002549 | 3300032002 | Bacteria | 10500 |
| 326 | Ga0307416_100049705 | 3300032002 | Bacteria | 3336 |
| 327 | Ga0307416_100057475 | 3300032002 | Bacteria | 3147 |
| 328 | Ga0307416_100071336 | 3300032002 | Bacteria | 2885 |
| 329 | Ga0307416_100450459 | 3300032002 | Bacteria | 1339 |
| 330 | Ga0307416_100724940 | 3300032002 | Bacteria | 1085 |
| 331 | Ga0307416_100932513 | 3300032002 | Bacteria | 969 |
| 332 | Ga0307416_101243409 | 3300032002 | Bacteria | 850 |
| 333 | Ga0307416_101278636 | 3300032002 | Bacteria | 839 |
| 334 | Ga0307416_101788507 | 3300032002 | Bacteria | 718 |
| 335 | Ga0307414_10000486 | 3300032004 | Bacteria | 20663 |
| 336 | Ga0307414_10001040 | 3300032004 | Bacteria | 14198 |
| 337 | Ga0307414_10005017 | 3300032004 | Bacteria | 7246 |
| 338 | Ga0307414_10006477 | 3300032004 | Bacteria | 6528 |
| 339 | Ga0307414_10011626 | 3300032004 | Bacteria | 5171 |
| 340 | Ga0307414_10039170 | 3300032004 | Bacteria | 3190 |
| 341 | Ga0307414_10044651 | 3300032004 | Bacteria | 3029 |
| 342 | Ga0307414_10049873 | 3300032004 | Bacteria | 2896 |
| 343 | Ga0307414_10073472 | 3300032004 | Bacteria | 2474 |
| 344 | Ga0307414_10120441 | 3300032004 | Bacteria | 2016 |
| 345 | Ga0307414_10140986 | 3300032004 | Bacteria | 1887 |
| 346 | Ga0307414_10275259 | 3300032004 | Bacteria | 1412 |
| 347 | Ga0307414_10308300 | 3300032004 | Bacteria | 1342 |
| 348 | Ga0307414_10457785 | 3300032004 | Bacteria | 1120 |
| 349 | Ga0307414_10562784 | 3300032004 | Bacteria | 1017 |
| 350 | Ga0307414_10581634 | 3300032004 | Bacteria | 1002 |
| 351 | Ga0307414_10652973 | 3300032004 | Bacteria | 948 |
| 352 | Ga0307414_10674212 | 3300032004 | Bacteria | 934 |
| 353 | Ga0307414_10769207 | 3300032004 | Bacteria | 876 |
| 354 | Ga0307414_10771345 | 3300032004 | Bacteria | 875 |
| 355 | Ga0307414_10814078 | 3300032004 | Bacteria | 852 |
| 356 | Ga0307414_10861851 | 3300032004 | Bacteria | 829 |
| 357 | Ga0307414_10875399 | 3300032004 | Bacteria | 822 |
| 358 | Ga0307414_10914101 | 3300032004 | Bacteria | 805 |
| 359 | Ga0307414_10971483 | 3300032004 | Bacteria | 781 |
| 360 | Ga0307414_11147998 | 3300032004 | Bacteria | 718 |
| 361 | Ga0307414_11388252 | 3300032004 | Bacteria | 653 |
| 362 | Ga0307414_12168960 | 3300032004 | Unclassified | 519 |
| 363 | Ga0307411_10035984 | 3300032005 | Bacteria | 3097 |
| 364 | Ga0307411_10073330 | 3300032005 | Bacteria | 2328 |
| 365 | Ga0307411_10192888 | 3300032005 | Bacteria | 1557 |
| 366 | Ga0307411_10236009 | 3300032005 | Bacteria | 1428 |
| 367 | Ga0307411_10268432 | 3300032005 | Bacteria | 1352 |
| 368 | Ga0307411_10418424 | 3300032005 | Bacteria | 1112 |
| 369 | Ga0307411_10498630 | 3300032005 | Bacteria | 1029 |
| 370 | Ga0307411_10717687 | 3300032005 | Bacteria | 872 |
| 371 | Ga0307411_10964729 | 3300032005 | Bacteria | 761 |
| 372 | Ga0307411_10980616 | 3300032005 | Bacteria | 755 |
| 373 | Ga0307411_10980658 | 3300032005 | Bacteria | 755 |
| 374 | Ga0307411_11500314 | 3300032005 | Bacteria | 619 |
| 375 | Ga0307411_11823706 | 3300032005 | Bacteria | 565 |
| 376 | Ga0307415_100004677 | 3300032126 | Bacteria | 7158 |
| 377 | Ga0307415_100027986 | 3300032126 | Bacteria | 3579 |
| 378 | Ga0307415_100191462 | 3300032126 | Bacteria | 1614 |
| 379 | Ga0307415_100356638 | 3300032126 | Bacteria | 1233 |
| 380 | Ga0307415_100375923 | 3300032126 | Bacteria | 1205 |
| 381 | Ga0307415_100555002 | 3300032126 | Bacteria | 1014 |
| 382 | Ga0307415_100766427 | 3300032126 | Bacteria | 877 |
| 383 | Ga0307415_100787717 | 3300032126 | Bacteria | 866 |
| 384 | Ga0307415_101457828 | 3300032126 | Bacteria | 653 |
| 385 | Ga0307415_101762801 | 3300032126 | Bacteria | 598 |
| 386 | Ga0395900_1247259 | 3300037418 | Bacteria | 658 |
| 387 | Ga0395905_0112865 | 3300037471 | Bacteria | 2553 |
| 388 | Ga0395905_0128838 | 3300037471 | Bacteria | 2380 |
| 389 | Ga0395901_0121559 | 3300038443 | Bacteria | 2744 |
| 390 | Ga0436365_1296624 | 3300039437 | Bacteria | 1320 |
| 391 | Ga0436365_1764132 | 3300039437 | Bacteria | 605 |
| 392 | Ga0436363_1205530 | 3300039450 | Bacteria | 521 |
| 393 | Ga0439453_0132671 | 3300041408 | Bacteria | 580 |
| 394 | Ga0439465_0368210 | 3300041413 | Unclassified | 544 |
| 395 | Ga0451793_0089535 | 3300041452 | Bacteria | 786 |
| 396 | Ga0439441_137588 | 3300042001 | Bacteria | 569 |
| 397 | Ga0439442_064523 | 3300042002 | Bacteria | 777 |
| 398 | Ga0439432_062657 | 3300042006 | Bacteria | 1144 |
| 399 | Ga0439432_172598 | 3300042006 | Unclassified | 631 |
| 400 | Ga0439449_0123456 | 3300042007 | Bacteria | 962 |
| 401 | Ga0450912_026182 | 3300042116 | Bacteria | 587 |
| 402 | Ga0439464_0001561 | 3300042439 | Bacteria | 5435 |
| 403 | Ga0466965_0072769 | 3300044683 | Bacteria | 1730 |
| 404 | Ga0451576_0494190 | 3300045051 | Bacteria | 1285 |
| 405 | Ga0495650_0040089 | 3300046471 | Bacteria | 2015 |
| 406 | Ga0495596_0170864 | 3300046500 | Bacteria | 845 |
| 407 | Ga0495616_0000187 | 3300046513 | Bacteria | 51726 |
| 408 | Ga0495643_0011914 | 3300046522 | Bacteria | 5267 |
| 409 | Ga0495663_0040407 | 3300046525 | Bacteria | 1416 |
| 410 | Ga0495663_0068786 | 3300046525 | Bacteria | 1124 |
| 411 | Ga0495663_0112274 | 3300046525 | Bacteria | 906 |
| 412 | Ga0495663_0160484 | 3300046525 | Bacteria | 771 |
| 413 | Ga0495663_0227550 | 3300046525 | Bacteria | 657 |
| 414 | Ga0495654_0015755 | 3300046530 | Bacteria | 4010 |
| 415 | Ga0495654_0030157 | 3300046530 | Bacteria | 2761 |
| 416 | Ga0495654_0087132 | 3300046530 | Bacteria | 1454 |
| 417 | Ga0495598_0004644 | 3300046537 | Bacteria | 2988 |
| 418 | Ga0495598_0459613 | 3300046537 | Bacteria | 505 |
| 419 | Ga0495621_0006102 | 3300046539 | Bacteria | 3501 |
| 420 | Ga0495621_0028095 | 3300046539 | Bacteria | 1910 |
| 421 | Ga0495633_0284799 | 3300046558 | Bacteria | 751 |
| 422 | Ga0495668_0000024 | 3300046616 | Bacteria | 359469 |
| 423 | Ga0495668_0019448 | 3300046616 | Bacteria | 3914 |
| 424 | Ga0495668_0043954 | 3300046616 | Bacteria | 2483 |
| 425 | Ga0495611_0336069 | 3300046648 | Bacteria | 694 |
| 426 | Ga0495625_0000196 | 3300046660 | Bacteria | 96006 |
| 427 | Ga0495659_0027612 | 3300046664 | Bacteria | 1959 |
| 428 | Ga0495669_0000602 | 3300046684 | Bacteria | 15746 |
| 429 | Ga0495669_0022836 | 3300046684 | Bacteria | 2719 |
| 430 | Ga0495669_0436980 | 3300046684 | Bacteria | 635 |
| 431 | Ga0495670_0091718 | 3300046691 | Bacteria | 1555 |
| 432 | Ga0495670_0365382 | 3300046691 | Bacteria | 778 |
| 433 | Ga0495649_0393355 | 3300046694 | Bacteria | 696 |
| 434 | Ga0495636_0226809 | 3300047318 | Bacteria | 859 |
| 435 | Ga0495677_0138458 | 3300047445 | Bacteria | 934 |
| 436 | Ga0495681_0351738 | 3300047470 | Bacteria | 560 |
| 437 | Ga0495686_0000701 | 3300047472 | Bacteria | 45238 |
| 438 | Ga0496100_0144000 | 3300048903 | Bacteria | 1693 |
| 439 | Ga0496101_0305200 | 3300048904 | Bacteria | 1247 |
| 440 | Ga0496102_0504780 | 3300048905 | Bacteria | 1132 |
| 441 | Ga0496102_0624794 | 3300048905 | Bacteria | 1000 |
| 442 | Ga0496102_0735933 | 3300048905 | Bacteria | 909 |
| 443 | Ga0496103_0047920 | 3300048906 | Bacteria | 2641 |
| 444 | Ga0496104_0051151 | 3300048907 | Bacteria | 3899 |
| 445 | Ga0496105_0004419 | 3300048908 | Bacteria | 10585 |
| 446 | Ga0496106_1460242 | 3300048909 | Bacteria | 527 |
| 447 | Ga0496108_0283881 | 3300048911 | Bacteria | 1441 |
| 448 | Ga0496109_0025686 | 3300048912 | Bacteria | 5250 |
| 449 | Ga0496110_0001413 | 3300048913 | Bacteria | 17353 |
| 450 | Ga0496111_0011130 | 3300048914 | Bacteria | 6055 |
| 451 | Ga0496113_1097698 | 3300048916 | Bacteria | 624 |
| 452 | Ga0496114_0146039 | 3300048917 | Bacteria | 2050 |
| 453 | Ga0496117_0037162 | 3300048920 | Bacteria | 3632 |
| 454 | Ga0496118_0000339 | 3300048921 | Bacteria | 80008 |
| 455 | Ga0496118_0020455 | 3300048921 | Bacteria | 5868 |
| 456 | Ga0496120_0184115 | 3300048923 | Bacteria | 1023 |
| 457 | Ga0496121_0000222 | 3300048924 | Bacteria | 123595 |
| 458 | Ga0495678_017250 | 3300049459 | Bacteria | 3278 |
| 459 | Ga0501290_000464 | 3300049513 | Bacteria | 6297 |
| 460 | Ga0501290_006459 | 3300049513 | Bacteria | 1469 |
| 461 | Ga0501292_000026 | 3300049515 | Bacteria | 42153 |
| 462 | Ga0501293_001367 | 3300049516 | Bacteria | 1834 |
| 463 | Ga0501294_000620 | 3300049517 | Bacteria | 4032 |
| 464 | Ga0501297_003055 | 3300049520 | Bacteria | 1650 |
| 465 | Ga0501298_022812 | 3300049521 | Bacteria | 1182 |
| 466 | Ga0501300_004021 | 3300049523 | Bacteria | 2186 |
| 467 | Ga0501300_004703 | 3300049523 | Bacteria | 2019 |
| 468 | Ga0501300_021080 | 3300049523 | Bacteria | 951 |
| 469 | Ga0501301_001208 | 3300049524 | Bacteria | 1622 |
| 470 | Ga0501031_0051644 | 3300049568 | Bacteria | 2678 |
| 471 | Ga0501032_0165002 | 3300049569 | Bacteria | 1453 |
| 472 | Ga0501033_0001955 | 3300049570 | Bacteria | 17935 |
| 473 | Ga0501036_0225590 | 3300049572 | Bacteria | 1572 |
| 474 | Ga0501036_1549534 | 3300049572 | Bacteria | 536 |
| 475 | Ga0501037_0168433 | 3300049573 | Bacteria | 1558 |
| 476 | Ga0501038_0045845 | 3300049574 | Bacteria | 3793 |
| 477 | Ga0501038_0050719 | 3300049574 | Bacteria | 3585 |
| 478 | Ga0501039_0121354 | 3300049575 | Bacteria | 2048 |
| 479 | Ga0501043_0046027 | 3300049579 | Bacteria | 3430 |
| 480 | Ga0501047_0639593 | 3300049581 | Bacteria | 883 |
| 481 | Ga0501047_1452705 | 3300049581 | Bacteria | 501 |
| 482 | Ga0501048_0290394 | 3300049582 | Bacteria | 1163 |
| 483 | Ga0501071_0450790 | 3300049587 | Bacteria | 985 |
| 484 | Ga0501071_1331330 | 3300049587 | Bacteria | 555 |
| 485 | Ga0501202_004276 | 3300049652 | Bacteria | 2497 |
| 486 | Ga0501206_000824 | 3300049653 | Bacteria | 3798 |
| 487 | Ga0501217_296631 | 3300049661 | Bacteria | 533 |
| 488 | Ga0501222_000640 | 3300049662 | Bacteria | 5129 |
| 489 | Ga0501223_002932 | 3300049663 | Bacteria | 3743 |
| 490 | Ga0501223_005742 | 3300049663 | Bacteria | 2594 |
| 491 | Ga0501223_006203 | 3300049663 | Bacteria | 2481 |
| 492 | Ga0501224_000020 | 3300049664 | Bacteria | 74346 |
| 493 | Ga0501224_009136 | 3300049664 | Bacteria | 1449 |
| 494 | Ga0501227_010889 | 3300049665 | Bacteria | 1976 |
| 495 | Ga0501227_016975 | 3300049665 | Bacteria | 1640 |
| 496 | Ga0501233_007168 | 3300049668 | Bacteria | 2117 |
| 497 | Ga0501233_048660 | 3300049668 | Bacteria | 1020 |
| 498 | Ga0501235_001905 | 3300049669 | Bacteria | 4460 |
| 499 | Ga0501235_002921 | 3300049669 | Bacteria | 3680 |
| 500 | Ga0501243_041061 | 3300049675 | Bacteria | 813 |
| 501 | Ga0501247_037872 | 3300049677 | Bacteria | 680 |
| 502 | Ga0501257_000131 | 3300049686 | Bacteria | 17065 |
| 503 | Ga0501259_000268 | 3300049688 | Bacteria | 8191 |
| 504 | Ga0501261_000046 | 3300049690 | Bacteria | 24263 |
| 505 | Ga0501221_005058 | 3300049704 | Bacteria | 2196 |
| 506 | Ga0501225_0000009 | 3300049705 | Bacteria | 90065 |
| 507 | Ga0501229_003848 | 3300049706 | Bacteria | 1814 |
| 508 | Ga0501245_001012 | 3300049708 | Bacteria | 3613 |
| 509 | Ga0501268_091764 | 3300049765 | Bacteria | 640 |
| 510 | Ga0501276_002528 | 3300049773 | Bacteria | 1293 |
| 511 | Ga0501279_000027 | 3300049775 | Bacteria | 40843 |
| 512 | Ga0501280_000044 | 3300049776 | Bacteria | 37121 |
| 513 | Ga0501280_001131 | 3300049776 | Bacteria | 5332 |
| 514 | Ga0501281_00442 | 3300049777 | Bacteria | 4033 |
| 515 | Ga0501282_000334 | 3300049778 | Bacteria | 5704 |
| 516 | Ga0501283_009832 | 3300049779 | Bacteria | 1400 |
| 517 | Ga0501035_0018153 | 3300049822 | Bacteria | 6481 |
| 518 | Ga0501044_0196206 | 3300049823 | Bacteria | 1978 |
| 519 | Ga0501226_000187 | 3300049853 | Bacteria | 9961 |
| 520 | Ga0501284_01647 | 3300050005 | Bacteria | 1194 |
| 521 | nmdc:mga06r32_1106451_c1 | 3300050510 | Bacteria | 741 |
| 522 | nmdc:mga06r32_14029_c1 | 3300050510 | Bacteria | 7265 |
| 523 | nmdc:mga08y16_719013_c1 | 3300050511 | Bacteria | 997 |
| 524 | Ga0500643_000065 | 3300053087 | Bacteria | 119995 |
| 525 | Ga0500643_000488 | 3300053087 | Bacteria | 28843 |
| 526 | Ga0500643_100970 | 3300053087 | Bacteria | 782 |
| 527 | Ga0500592_000140 | 3300053116 | Bacteria | 15045 |
| 528 | Ga0500592_000384 | 3300053116 | Bacteria | 7453 |
| 529 | Ga0500592_028997 | 3300053116 | Bacteria | 893 |
| 530 | Ga0500592_061242 | 3300053116 | Bacteria | 616 |
| 531 | Ga0500658_0402787 | 3300053134 | Bacteria | 626 |
| 532 | Ga0500559_0002322 | 3300053136 | Bacteria | 9970 |
| 533 | Ga0500568_0001688 | 3300053139 | Bacteria | 13785 |
| 534 | Ga0500590_000142 | 3300053148 | Bacteria | 19990 |
| 535 | Ga0500604_0009046 | 3300053151 | Bacteria | 2650 |
| 536 | Ga0500604_0015383 | 3300053151 | Bacteria | 2095 |
| 537 | Ga0500604_0028845 | 3300053151 | Bacteria | 1614 |
| 538 | Ga0500627_0000043 | 3300053158 | Bacteria | 65441 |
| 539 | Ga0500627_0000551 | 3300053158 | Bacteria | 10092 |
| 540 | Ga0500627_0161586 | 3300053158 | Bacteria | 1010 |
| 541 | Ga0500611_044866 | 3300053727 | Bacteria | 987 |
| 542 | Ga0500661_000036 | 3300055283 | Bacteria | 19851 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221560 | 2643822372 | 133 |
| 2 | iso_pu_bacteria | 2643221563 | 2643833600 | 133 |
| 3 | iso_pu_bacteria | 2643221608 | 2644054527 | 133 |
| 4 | iso_pu_bacteria | 2852653556 | 2852656692 | 133 |
| 5 | iso_pu_bacteria | 2852680915 | 2852682088 | 133 |
| 6 | iso_pu_bacteria | 2882806704 | 2882808292 | 133 |
| 7 | iso_pu_bacteria | 2885429604 | 2885430748 | 133 |
| 8 | 3300025940 | Ga0207691_10305900 | Ga0207691_103059002 | 134 |
| 9 | 3300037418 | Ga0395900_1247259 | Ga0395900_1247259_235_639 | 134 |
| 10 | 3300031251 | Ga0265327_10070126 | Ga0265327_100701263 | 135 |
| 11 | 3300031548 | Ga0307408_100280484 | Ga0307408_1002804841 | 135 |
| 12 | 3300031731 | Ga0307405_10132371 | Ga0307405_101323713 | 135 |
| 13 | 3300031901 | Ga0307406_10050625 | Ga0307406_100506252 | 135 |
| 14 | 3300031911 | Ga0307412_10143051 | Ga0307412_101430513 | 135 |
| 15 | 3300039450 | Ga0436363_1205530 | Ga0436363_1205530_54_461 | 135 |
| 16 | 3300005335 | Ga0070666_10087145 | Ga0070666_100871452 | 136 |
| 17 | 3300005353 | Ga0070669_100096449 | Ga0070669_1000964492 | 136 |
| 18 | 3300005367 | Ga0070667_100002350 | Ga0070667_10000235012 | 136 |
| 19 | 3300005548 | Ga0070665_100005505 | Ga0070665_10000550512 | 136 |
| 20 | 3300005617 | Ga0068859_100775763 | Ga0068859_1007757632 | 136 |
| 21 | 3300005841 | Ga0068863_100000014 | Ga0068863_10000001463 | 136 |
| 22 | 3300005843 | Ga0068860_100000007 | Ga0068860_100000007172 | 136 |
| 23 | 3300005844 | Ga0068862_100012958 | Ga0068862_1000129581 | 136 |
| 24 | 3300006931 | Ga0097620_100775718 | Ga0097620_1007757182 | 136 |
| 25 | 3300009177 | Ga0105248_10104896 | Ga0105248_101048962 | 136 |
| 26 | 3300025903 | Ga0207680_10081041 | Ga0207680_100810412 | 136 |
| 27 | 3300025986 | Ga0207658_10003755 | Ga0207658_100037556 | 136 |
| 28 | 3300026035 | Ga0207703_10051426 | Ga0207703_100514263 | 136 |
| 29 | 3300026088 | Ga0207641_10000126 | Ga0207641_1000012640 | 136 |
| 30 | 3300028379 | Ga0268266_10011921 | Ga0268266_100119217 | 136 |
| 31 | 3300028380 | Ga0268265_10008961 | Ga0268265_100089618 | 136 |
| 32 | 3300028381 | Ga0268264_10000077 | Ga0268264_1000007767 | 136 |
| 33 | 3300031911 | Ga0307412_11538914 | Ga0307412_115389141 | 136 |
| 34 | 3300032004 | Ga0307414_10005017 | Ga0307414_100050172 | 136 |
| 35 | 3300044683 | Ga0466965_0072769 | Ga0466965_0072769_552_962 | 136 |
| 36 | 3300048905 | Ga0496102_0624794 | Ga0496102_0624794_133_543 | 136 |
| 37 | 3300048905 | Ga0496102_0735933 | Ga0496102_0735933_486_896 | 136 |
| 38 | 3300048907 | Ga0496104_0051151 | Ga0496104_0051151_2201_2611 | 136 |
| 39 | 3300048908 | Ga0496105_0004419 | Ga0496105_0004419_91_501 | 136 |
| 40 | 3300048923 | Ga0496120_0184115 | Ga0496120_0184115_289_699 | 136 |
| 41 | 2162886006 | SwRhRL3b_contig_86265 | SwRhRL3b_0238.00000270 | 137 |
| 42 | 2162886007 | SwRhRL2b_contig_650828 | SwRhRL2b_0643.00004970 | 137 |
| 43 | 3300001976 | JGI24752J21851_1000370 | JGI24752J21851_10003705 | 137 |
| 44 | 3300002076 | JGI24749J21850_1006682 | JGI24749J21850_10066822 | 137 |
| 45 | 3300002244 | JGI24742J22300_10022985 | JGI24742J22300_100229851 | 137 |
| 46 | 3300002244 | JGI24742J22300_10068936 | JGI24742J22300_100689361 | 137 |
| 47 | 3300002459 | JGI24751J29686_10117683 | JGI24751J29686_101176831 | 137 |
| 48 | 3300003781 | Ga0055536_1002465 | Ga0055536_10024655 | 137 |
| 49 | 3300003781 | Ga0055536_1003362 | Ga0055536_10033623 | 137 |
| 50 | 3300003781 | Ga0055536_1026479 | Ga0055536_10264793 | 137 |
| 51 | 3300003784 | Ga0055534_1017433 | Ga0055534_10174331 | 137 |
| 52 | 3300003791 | Ga0055530_10002163 | Ga0055530_100021638 | 137 |
| 53 | 3300003794 | Ga0055531_10002264 | Ga0055531_100022648 | 137 |
| 54 | 3300003794 | Ga0055531_10002939 | Ga0055531_100029398 | 137 |
| 55 | 3300003911 | JGI25405J52794_10014256 | JGI25405J52794_100142562 | 137 |
| 56 | 3300005289 | Ga0065704_10123386 | Ga0065704_101233863 | 137 |
| 57 | 3300005290 | Ga0065712_10353773 | Ga0065712_103537732 | 137 |
| 58 | 3300005293 | Ga0065715_10135674 | Ga0065715_101356742 | 137 |
| 59 | 3300005293 | Ga0065715_10160311 | Ga0065715_101603113 | 137 |
| 60 | 3300005293 | Ga0065715_10165694 | Ga0065715_101656942 | 137 |
| 61 | 3300005295 | Ga0065707_10081814 | Ga0065707_1008181418 | 137 |
| 62 | 3300005295 | Ga0065707_10121622 | Ga0065707_101216223 | 137 |
| 63 | 3300005295 | Ga0065707_10124743 | Ga0065707_101247433 | 137 |
| 64 | 3300005295 | Ga0065707_11085056 | Ga0065707_110850561 | 137 |
| 65 | 3300005327 | Ga0070658_10055435 | Ga0070658_100554354 | 137 |
| 66 | 3300005328 | Ga0070676_10071866 | Ga0070676_100718664 | 137 |
| 67 | 3300005328 | Ga0070676_10240287 | Ga0070676_102402872 | 137 |
| 68 | 3300005328 | Ga0070676_10474792 | Ga0070676_104747921 | 137 |
| 69 | 3300005331 | Ga0070670_100000081 | Ga0070670_10000008180 | 137 |
| 70 | 3300005331 | Ga0070670_100000350 | Ga0070670_10000035027 | 137 |
| 71 | 3300005331 | Ga0070670_100020103 | Ga0070670_1000201036 | 137 |
| 72 | 3300005331 | Ga0070670_100220323 | Ga0070670_1002203232 | 137 |
| 73 | 3300005333 | Ga0070677_10014798 | Ga0070677_100147981 | 137 |
| 74 | 3300005338 | Ga0068868_100489190 | Ga0068868_1004891902 | 137 |
| 75 | 3300005344 | Ga0070661_100172245 | Ga0070661_1001722452 | 137 |
| 76 | 3300005344 | Ga0070661_100752338 | Ga0070661_1007523382 | 137 |
| 77 | 3300005347 | Ga0070668_100135102 | Ga0070668_1001351023 | 137 |
| 78 | 3300005347 | Ga0070668_100185402 | Ga0070668_1001854022 | 137 |
| 79 | 3300005347 | Ga0070668_100521949 | Ga0070668_1005219492 | 137 |
| 80 | 3300005347 | Ga0070668_100708749 | Ga0070668_1007087492 | 137 |
| 81 | 3300005353 | Ga0070669_100001581 | Ga0070669_10000158118 | 137 |
| 82 | 3300005353 | Ga0070669_100026397 | Ga0070669_1000263972 | 137 |
| 83 | 3300005353 | Ga0070669_100054890 | Ga0070669_1000548905 | 137 |
| 84 | 3300005354 | Ga0070675_100001857 | Ga0070675_10000185714 | 137 |
| 85 | 3300005354 | Ga0070675_100002352 | Ga0070675_1000023524 | 137 |
| 86 | 3300005354 | Ga0070675_100006205 | Ga0070675_1000062056 | 137 |
| 87 | 3300005354 | Ga0070675_100256398 | Ga0070675_1002563983 | 137 |
| 88 | 3300005355 | Ga0070671_100001032 | Ga0070671_10000103214 | 137 |
| 89 | 3300005355 | Ga0070671_100224229 | Ga0070671_1002242293 | 137 |
| 90 | 3300005355 | Ga0070671_101411729 | Ga0070671_1014117291 | 137 |
| 91 | 3300005356 | Ga0070674_100001573 | Ga0070674_1000015733 | 137 |
| 92 | 3300005356 | Ga0070674_100033419 | Ga0070674_1000334195 | 137 |
| 93 | 3300005356 | Ga0070674_100057994 | Ga0070674_1000579942 | 137 |
| 94 | 3300005364 | Ga0070673_100003253 | Ga0070673_1000032539 | 137 |
| 95 | 3300005364 | Ga0070673_100267958 | Ga0070673_1002679582 | 137 |
| 96 | 3300005367 | Ga0070667_100000774 | Ga0070667_10000077417 | 137 |
| 97 | 3300005367 | Ga0070667_100020574 | Ga0070667_1000205746 | 137 |
| 98 | 3300005367 | Ga0070667_100035262 | Ga0070667_1000352625 | 137 |
| 99 | 3300005438 | Ga0070701_10026160 | Ga0070701_100261602 | 137 |
| 100 | 3300005445 | Ga0070708_101635723 | Ga0070708_1016357231 | 137 |
| 101 | 3300005455 | Ga0070663_100070130 | Ga0070663_1000701302 | 137 |
| 102 | 3300005455 | Ga0070663_100097585 | Ga0070663_1000975851 | 137 |
| 103 | 3300005456 | Ga0070678_100038160 | Ga0070678_1000381602 | 137 |
| 104 | 3300005456 | Ga0070678_100127885 | Ga0070678_1001278853 | 137 |
| 105 | 3300005457 | Ga0070662_100002989 | Ga0070662_10000298912 | 137 |
| 106 | 3300005457 | Ga0070662_100008923 | Ga0070662_1000089235 | 137 |
| 107 | 3300005457 | Ga0070662_100645689 | Ga0070662_1006456892 | 137 |
| 108 | 3300005457 | Ga0070662_100845829 | Ga0070662_1008458292 | 137 |
| 109 | 3300005459 | Ga0068867_100022921 | Ga0068867_1000229213 | 137 |
| 110 | 3300005518 | Ga0070699_102217228 | Ga0070699_1022172281 | 137 |
| 111 | 3300005539 | Ga0068853_100051988 | Ga0068853_1000519881 | 137 |
| 112 | 3300005539 | Ga0068853_100501538 | Ga0068853_1005015381 | 137 |
| 113 | 3300005543 | Ga0070672_100005889 | Ga0070672_1000058896 | 137 |
| 114 | 3300005543 | Ga0070672_100016447 | Ga0070672_1000164472 | 137 |
| 115 | 3300005543 | Ga0070672_100513576 | Ga0070672_1005135761 | 137 |
| 116 | 3300005548 | Ga0070665_100056228 | Ga0070665_1000562284 | 137 |
| 117 | 3300005564 | Ga0070664_100004435 | Ga0070664_1000044356 | 137 |
| 118 | 3300005564 | Ga0070664_100114616 | Ga0070664_1001146163 | 137 |
| 119 | 3300005564 | Ga0070664_100467324 | Ga0070664_1004673242 | 137 |
| 120 | 3300005577 | Ga0068857_100587402 | Ga0068857_1005874022 | 137 |
| 121 | 3300005577 | Ga0068857_101646225 | Ga0068857_1016462251 | 137 |
| 122 | 3300005578 | Ga0068854_100165413 | Ga0068854_1001654133 | 137 |
| 123 | 3300005617 | Ga0068859_100046644 | Ga0068859_1000466445 | 137 |
| 124 | 3300005617 | Ga0068859_100083693 | Ga0068859_1000836931 | 137 |
| 125 | 3300005617 | Ga0068859_101022323 | Ga0068859_1010223232 | 137 |
| 126 | 3300005618 | Ga0068864_100000016 | Ga0068864_10000001684 | 137 |
| 127 | 3300005618 | Ga0068864_100031131 | Ga0068864_1000311314 | 137 |
| 128 | 3300005719 | Ga0068861_100124437 | Ga0068861_1001244373 | 137 |
| 129 | 3300005834 | Ga0068851_10178826 | Ga0068851_101788262 | 137 |
| 130 | 3300005840 | Ga0068870_10077948 | Ga0068870_100779482 | 137 |
| 131 | 3300005840 | Ga0068870_10395111 | Ga0068870_103951112 | 137 |
| 132 | 3300005841 | Ga0068863_100000089 | Ga0068863_10000008959 | 137 |
| 133 | 3300005843 | Ga0068860_102227977 | Ga0068860_1022279771 | 137 |
| 134 | 3300005844 | Ga0068862_100000068 | Ga0068862_10000006885 | 137 |
| 135 | 3300005844 | Ga0068862_100006350 | Ga0068862_10000635011 | 137 |
| 136 | 3300005844 | Ga0068862_100177953 | Ga0068862_1001779531 | 137 |
| 137 | 3300005844 | Ga0068862_102571033 | Ga0068862_1025710331 | 137 |
| 138 | 3300005937 | Ga0081455_10000100 | Ga0081455_1000010088 | 137 |
| 139 | 3300005985 | Ga0081539_10100337 | Ga0081539_101003372 | 137 |
| 140 | 3300006358 | Ga0068871_100297756 | Ga0068871_1002977562 | 137 |
| 141 | 3300006844 | Ga0075428_100895044 | Ga0075428_1008950442 | 137 |
| 142 | 3300006931 | Ga0097620_100046642 | Ga0097620_1000466425 | 137 |
| 143 | 3300006931 | Ga0097620_100083693 | Ga0097620_1000836931 | 137 |
| 144 | 3300006931 | Ga0097620_101022303 | Ga0097620_1010223032 | 137 |
| 145 | 3300009094 | Ga0111539_10256176 | Ga0111539_102561761 | 137 |
| 146 | 3300009094 | Ga0111539_10639484 | Ga0111539_106394842 | 137 |
| 147 | 3300009101 | Ga0105247_10009279 | Ga0105247_100092795 | 137 |
| 148 | 3300009177 | Ga0105248_10000021 | Ga0105248_1000002151 | 137 |
| 149 | 3300009177 | Ga0105248_10525636 | Ga0105248_105256362 | 137 |
| 150 | 3300009553 | Ga0105249_10000162 | Ga0105249_1000016244 | 137 |
| 151 | 3300009553 | Ga0105249_10138372 | Ga0105249_101383722 | 137 |
| 152 | 3300009553 | Ga0105249_10209781 | Ga0105249_102097812 | 137 |
| 153 | 3300009553 | Ga0105249_11216989 | Ga0105249_112169892 | 137 |
| 154 | 3300013102 | Ga0157371_10464224 | Ga0157371_104642242 | 137 |
| 155 | 3300013104 | Ga0157370_10362754 | Ga0157370_103627541 | 137 |
| 156 | 3300013297 | Ga0157378_10012259 | Ga0157378_100122594 | 137 |
| 157 | 3300013297 | Ga0157378_10064485 | Ga0157378_100644852 | 137 |
| 158 | 3300013306 | Ga0163162_10092656 | Ga0163162_100926564 | 137 |
| 159 | 3300013307 | Ga0157372_10913192 | Ga0157372_109131921 | 137 |
| 160 | 3300013307 | Ga0157372_10973748 | Ga0157372_109737482 | 137 |
| 161 | 3300013308 | Ga0157375_10055112 | Ga0157375_100551126 | 137 |
| 162 | 3300013308 | Ga0157375_10543734 | Ga0157375_105437342 | 137 |
| 163 | 3300013308 | Ga0157375_13300480 | Ga0157375_133004801 | 137 |
| 164 | 3300014325 | Ga0163163_10223509 | Ga0163163_102235092 | 137 |
| 165 | 3300014326 | Ga0157380_10000062 | Ga0157380_1000006239 | 137 |
| 166 | 3300014326 | Ga0157380_10735166 | Ga0157380_107351662 | 137 |
| 167 | 3300014968 | Ga0157379_10303499 | Ga0157379_103034991 | 137 |
| 168 | 3300014968 | Ga0157379_11103863 | Ga0157379_111038632 | 137 |
| 169 | 3300017792 | Ga0163161_10016024 | Ga0163161_100160246 | 137 |
| 170 | 3300017792 | Ga0163161_10020224 | Ga0163161_100202245 | 137 |
| 171 | 3300017792 | Ga0163161_11230669 | Ga0163161_112306691 | 137 |
| 172 | 3300025291 | Ga0209675_1003647 | Ga0209675_10036473 | 137 |
| 173 | 3300025292 | Ga0209676_1000045 | Ga0209676_100004519 | 137 |
| 174 | 3300025292 | Ga0209676_1000211 | Ga0209676_10002118 | 137 |
| 175 | 3300025292 | Ga0209676_1000465 | Ga0209676_10004656 | 137 |
| 176 | 3300025292 | Ga0209676_1082234 | Ga0209676_10822341 | 137 |
| 177 | 3300025294 | Ga0209025_1003047 | Ga0209025_10030473 | 137 |
| 178 | 3300025297 | Ga0209758_1036580 | Ga0209758_10365803 | 137 |
| 179 | 3300025298 | Ga0209050_1000047 | Ga0209050_1000047193 | 137 |
| 180 | 3300025298 | Ga0209050_1003310 | Ga0209050_10033108 | 137 |
| 181 | 3300025298 | Ga0209050_1031783 | Ga0209050_10317833 | 137 |
| 182 | 3300025304 | Ga0209257_1000076 | Ga0209257_1000076149 | 137 |
| 183 | 3300025304 | Ga0209257_1000644 | Ga0209257_10006449 | 137 |
| 184 | 3300025304 | Ga0209257_1001050 | Ga0209257_10010507 | 137 |
| 185 | 3300025304 | Ga0209257_1042769 | Ga0209257_10427693 | 137 |
| 186 | 3300025315 | Ga0207697_10004192 | Ga0207697_100041923 | 137 |
| 187 | 3300025735 | Ga0207713_1048207 | Ga0207713_10482073 | 137 |
| 188 | 3300025893 | Ga0207682_10000428 | Ga0207682_1000042814 | 137 |
| 189 | 3300025900 | Ga0207710_10031675 | Ga0207710_100316752 | 137 |
| 190 | 3300025901 | Ga0207688_10134847 | Ga0207688_101348472 | 137 |
| 191 | 3300025903 | Ga0207680_10289558 | Ga0207680_102895582 | 137 |
| 192 | 3300025907 | Ga0207645_10174856 | Ga0207645_101748562 | 137 |
| 193 | 3300025908 | Ga0207643_10119887 | Ga0207643_101198873 | 137 |
| 194 | 3300025909 | Ga0207705_11069947 | Ga0207705_110699471 | 137 |
| 195 | 3300025918 | Ga0207662_10224523 | Ga0207662_102245232 | 137 |
| 196 | 3300025919 | Ga0207657_10421338 | Ga0207657_104213382 | 137 |
| 197 | 3300025920 | Ga0207649_10120255 | Ga0207649_101202553 | 137 |
| 198 | 3300025920 | Ga0207649_10603037 | Ga0207649_106030372 | 137 |
| 199 | 3300025923 | Ga0207681_10018328 | Ga0207681_100183286 | 137 |
| 200 | 3300025923 | Ga0207681_10020618 | Ga0207681_100206182 | 137 |
| 201 | 3300025923 | Ga0207681_11204108 | Ga0207681_112041082 | 137 |
| 202 | 3300025923 | Ga0207681_11535641 | Ga0207681_115356411 | 137 |
| 203 | 3300025925 | Ga0207650_10000069 | Ga0207650_1000006919 | 137 |
| 204 | 3300025925 | Ga0207650_10011078 | Ga0207650_100110788 | 137 |
| 205 | 3300025925 | Ga0207650_10015737 | Ga0207650_100157375 | 137 |
| 206 | 3300025925 | Ga0207650_10355668 | Ga0207650_103556682 | 137 |
| 207 | 3300025925 | Ga0207650_10465713 | Ga0207650_104657131 | 137 |
| 208 | 3300025926 | Ga0207659_10002256 | Ga0207659_1000225611 | 137 |
| 209 | 3300025926 | Ga0207659_10021111 | Ga0207659_100211115 | 137 |
| 210 | 3300025926 | Ga0207659_10344972 | Ga0207659_103449721 | 137 |
| 211 | 3300025931 | Ga0207644_10007270 | Ga0207644_100072707 | 137 |
| 212 | 3300025931 | Ga0207644_10027624 | Ga0207644_100276242 | 137 |
| 213 | 3300025931 | Ga0207644_10194663 | Ga0207644_101946633 | 137 |
| 214 | 3300025931 | Ga0207644_10369746 | Ga0207644_103697462 | 137 |
| 215 | 3300025931 | Ga0207644_11027778 | Ga0207644_110277782 | 137 |
| 216 | 3300025933 | Ga0207706_10005825 | Ga0207706_1000582511 | 137 |
| 217 | 3300025933 | Ga0207706_10008036 | Ga0207706_100080365 | 137 |
| 218 | 3300025933 | Ga0207706_10069641 | Ga0207706_100696415 | 137 |
| 219 | 3300025933 | Ga0207706_10360039 | Ga0207706_103600392 | 137 |
| 220 | 3300025937 | Ga0207669_10031264 | Ga0207669_100312644 | 137 |
| 221 | 3300025937 | Ga0207669_10267926 | Ga0207669_102679262 | 137 |
| 222 | 3300025940 | Ga0207691_10012970 | Ga0207691_100129706 | 137 |
| 223 | 3300025940 | Ga0207691_10041883 | Ga0207691_100418832 | 137 |
| 224 | 3300025940 | Ga0207691_10091188 | Ga0207691_100911883 | 137 |
| 225 | 3300025941 | Ga0207711_10000025 | Ga0207711_10000025247 | 137 |
| 226 | 3300025941 | Ga0207711_10029142 | Ga0207711_100291426 | 137 |
| 227 | 3300025945 | Ga0207679_10029566 | Ga0207679_100295663 | 137 |
| 228 | 3300025945 | Ga0207679_10126589 | Ga0207679_101265894 | 137 |
| 229 | 3300025945 | Ga0207679_10481234 | Ga0207679_104812342 | 137 |
| 230 | 3300025960 | Ga0207651_10002735 | Ga0207651_100027358 | 137 |
| 231 | 3300025960 | Ga0207651_10205915 | Ga0207651_102059152 | 137 |
| 232 | 3300025961 | Ga0207712_10000316 | Ga0207712_1000031644 | 137 |
| 233 | 3300025961 | Ga0207712_10501626 | Ga0207712_105016262 | 137 |
| 234 | 3300025961 | Ga0207712_11046943 | Ga0207712_110469431 | 137 |
| 235 | 3300025972 | Ga0207668_10283104 | Ga0207668_102831042 | 137 |
| 236 | 3300025972 | Ga0207668_10401185 | Ga0207668_104011852 | 137 |
| 237 | 3300025972 | Ga0207668_10513619 | Ga0207668_105136192 | 137 |
| 238 | 3300025972 | Ga0207668_10579674 | Ga0207668_105796742 | 137 |
| 239 | 3300025981 | Ga0207640_10015531 | Ga0207640_100155313 | 137 |
| 240 | 3300025981 | Ga0207640_10185237 | Ga0207640_101852373 | 137 |
| 241 | 3300025981 | Ga0207640_10315565 | Ga0207640_103155652 | 137 |
| 242 | 3300025981 | Ga0207640_10761989 | Ga0207640_107619892 | 137 |
| 243 | 3300025986 | Ga0207658_10000153 | Ga0207658_1000015331 | 137 |
| 244 | 3300025986 | Ga0207658_10013637 | Ga0207658_100136372 | 137 |
| 245 | 3300025986 | Ga0207658_10031859 | Ga0207658_100318595 | 137 |
| 246 | 3300026023 | Ga0207677_11030995 | Ga0207677_110309951 | 137 |
| 247 | 3300026041 | Ga0207639_10853013 | Ga0207639_108530132 | 137 |
| 248 | 3300026041 | Ga0207639_11106212 | Ga0207639_111062121 | 137 |
| 249 | 3300026067 | Ga0207678_10033605 | Ga0207678_100336055 | 137 |
| 250 | 3300026067 | Ga0207678_10077225 | Ga0207678_100772255 | 137 |
| 251 | 3300026088 | Ga0207641_10000103 | Ga0207641_1000010377 | 137 |
| 252 | 3300026088 | Ga0207641_11007564 | Ga0207641_110075642 | 137 |
| 253 | 3300026089 | Ga0207648_10013089 | Ga0207648_100130895 | 137 |
| 254 | 3300026095 | Ga0207676_10000044 | Ga0207676_1000004477 | 137 |
| 255 | 3300026095 | Ga0207676_10014379 | Ga0207676_100143797 | 137 |
| 256 | 3300026095 | Ga0207676_10296681 | Ga0207676_102966812 | 137 |
| 257 | 3300026116 | Ga0207674_10021373 | Ga0207674_100213733 | 137 |
| 258 | 3300026116 | Ga0207674_10092050 | Ga0207674_100920504 | 137 |
| 259 | 3300026116 | Ga0207674_11224864 | Ga0207674_112248641 | 137 |
| 260 | 3300026118 | Ga0207675_100023583 | Ga0207675_1000235833 | 137 |
| 261 | 3300026121 | Ga0207683_10090131 | Ga0207683_100901312 | 137 |
| 262 | 3300027462 | Ga0210000_1039011 | Ga0210000_10390111 | 137 |
| 263 | 3300027665 | Ga0209983_1026286 | Ga0209983_10262862 | 137 |
| 264 | 3300027876 | Ga0209974_10082323 | Ga0209974_100823231 | 137 |
| 265 | 3300028379 | Ga0268266_10021435 | Ga0268266_100214354 | 137 |
| 266 | 3300028380 | Ga0268265_10000142 | Ga0268265_1000014277 | 137 |
| 267 | 3300028380 | Ga0268265_10003941 | Ga0268265_100039412 | 137 |
| 268 | 3300028380 | Ga0268265_10050543 | Ga0268265_100505436 | 137 |
| 269 | 3300028380 | Ga0268265_10140648 | Ga0268265_101406483 | 137 |
| 270 | 3300028380 | Ga0268265_10232761 | Ga0268265_102327613 | 137 |
| 271 | 3300028380 | Ga0268265_10482227 | Ga0268265_104822272 | 137 |
| 272 | 3300028380 | Ga0268265_10509200 | Ga0268265_105092002 | 137 |
| 273 | 3300028381 | Ga0268264_10014949 | Ga0268264_100149494 | 137 |
| 274 | 3300028381 | Ga0268264_11768635 | Ga0268264_117686351 | 137 |
| 275 | 3300028786 | Ga0307517_10024515 | Ga0307517_100245157 | 137 |
| 276 | 3300031548 | Ga0307408_100106205 | Ga0307408_1001062052 | 137 |
| 277 | 3300031548 | Ga0307408_100227630 | Ga0307408_1002276302 | 137 |
| 278 | 3300031548 | Ga0307408_100503852 | Ga0307408_1005038522 | 137 |
| 279 | 3300031548 | Ga0307408_100531677 | Ga0307408_1005316772 | 137 |
| 280 | 3300031548 | Ga0307408_100536190 | Ga0307408_1005361902 | 137 |
| 281 | 3300031548 | Ga0307408_100596645 | Ga0307408_1005966452 | 137 |
| 282 | 3300031548 | Ga0307408_100843115 | Ga0307408_1008431152 | 137 |
| 283 | 3300031548 | Ga0307408_101091946 | Ga0307408_1010919462 | 137 |
| 284 | 3300031548 | Ga0307408_101627284 | Ga0307408_1016272841 | 137 |
| 285 | 3300031548 | Ga0307408_101994713 | Ga0307408_1019947131 | 137 |
| 286 | 3300031731 | Ga0307405_10250198 | Ga0307405_102501982 | 137 |
| 287 | 3300031731 | Ga0307405_10531051 | Ga0307405_105310512 | 137 |
| 288 | 3300031731 | Ga0307405_10662991 | Ga0307405_106629912 | 137 |
| 289 | 3300031731 | Ga0307405_10671713 | Ga0307405_106717132 | 137 |
| 290 | 3300031824 | Ga0307413_10023759 | Ga0307413_100237593 | 137 |
| 291 | 3300031824 | Ga0307413_10071876 | Ga0307413_100718762 | 137 |
| 292 | 3300031824 | Ga0307413_10107199 | Ga0307413_101071992 | 137 |
| 293 | 3300031824 | Ga0307413_10386333 | Ga0307413_103863332 | 137 |
| 294 | 3300031824 | Ga0307413_10564836 | Ga0307413_105648362 | 137 |
| 295 | 3300031824 | Ga0307413_10696192 | Ga0307413_106961922 | 137 |
| 296 | 3300031824 | Ga0307413_10822615 | Ga0307413_108226152 | 137 |
| 297 | 3300031824 | Ga0307413_11225693 | Ga0307413_112256931 | 137 |
| 298 | 3300031852 | Ga0307410_10055411 | Ga0307410_100554112 | 137 |
| 299 | 3300031852 | Ga0307410_10109687 | Ga0307410_101096873 | 137 |
| 300 | 3300031852 | Ga0307410_10287140 | Ga0307410_102871402 | 137 |
| 301 | 3300031852 | Ga0307410_10539063 | Ga0307410_105390632 | 137 |
| 302 | 3300031852 | Ga0307410_10554060 | Ga0307410_105540602 | 137 |
| 303 | 3300031852 | Ga0307410_11074995 | Ga0307410_110749952 | 137 |
| 304 | 3300031852 | Ga0307410_11401875 | Ga0307410_114018751 | 137 |
| 305 | 3300031852 | Ga0307410_11410036 | Ga0307410_114100361 | 137 |
| 306 | 3300031901 | Ga0307406_10090576 | Ga0307406_100905762 | 137 |
| 307 | 3300031901 | Ga0307406_10106032 | Ga0307406_101060322 | 137 |
| 308 | 3300031901 | Ga0307406_10208987 | Ga0307406_102089872 | 137 |
| 309 | 3300031901 | Ga0307406_10394589 | Ga0307406_103945892 | 137 |
| 310 | 3300031901 | Ga0307406_10428026 | Ga0307406_104280262 | 137 |
| 311 | 3300031901 | Ga0307406_10729885 | Ga0307406_107298851 | 137 |
| 312 | 3300031901 | Ga0307406_10898912 | Ga0307406_108989121 | 137 |
| 313 | 3300031901 | Ga0307406_11346141 | Ga0307406_113461411 | 137 |
| 314 | 3300031903 | Ga0307407_10078216 | Ga0307407_100782163 | 137 |
| 315 | 3300031903 | Ga0307407_10193828 | Ga0307407_101938282 | 137 |
| 316 | 3300031903 | Ga0307407_11495820 | Ga0307407_114958201 | 137 |
| 317 | 3300031911 | Ga0307412_10001551 | Ga0307412_1000155110 | 137 |
| 318 | 3300031911 | Ga0307412_10003245 | Ga0307412_100032455 | 137 |
| 319 | 3300031911 | Ga0307412_10076123 | Ga0307412_100761233 | 137 |
| 320 | 3300031911 | Ga0307412_10082451 | Ga0307412_100824514 | 137 |
| 321 | 3300031911 | Ga0307412_10106765 | Ga0307412_101067651 | 137 |
| 322 | 3300031911 | Ga0307412_10164618 | Ga0307412_101646182 | 137 |
| 323 | 3300031911 | Ga0307412_10225463 | Ga0307412_102254632 | 137 |
| 324 | 3300031911 | Ga0307412_10289088 | Ga0307412_102890882 | 137 |
| 325 | 3300031911 | Ga0307412_10333068 | Ga0307412_103330682 | 137 |
| 326 | 3300031911 | Ga0307412_10538722 | Ga0307412_105387222 | 137 |
| 327 | 3300031911 | Ga0307412_10566504 | Ga0307412_105665042 | 137 |
| 328 | 3300031911 | Ga0307412_10573201 | Ga0307412_105732011 | 137 |
| 329 | 3300031911 | Ga0307412_10596572 | Ga0307412_105965722 | 137 |
| 330 | 3300031911 | Ga0307412_11122878 | Ga0307412_111228782 | 137 |
| 331 | 3300031911 | Ga0307412_11125554 | Ga0307412_111255541 | 137 |
| 332 | 3300031911 | Ga0307412_11274211 | Ga0307412_112742112 | 137 |
| 333 | 3300031911 | Ga0307412_11339296 | Ga0307412_113392962 | 137 |
| 334 | 3300031995 | Ga0307409_100094765 | Ga0307409_1000947653 | 137 |
| 335 | 3300031995 | Ga0307409_100397355 | Ga0307409_1003973552 | 137 |
| 336 | 3300031995 | Ga0307409_100550759 | Ga0307409_1005507592 | 137 |
| 337 | 3300031995 | Ga0307409_100559332 | Ga0307409_1005593321 | 137 |
| 338 | 3300031995 | Ga0307409_100560315 | Ga0307409_1005603152 | 137 |
| 339 | 3300031995 | Ga0307409_100936069 | Ga0307409_1009360692 | 137 |
| 340 | 3300031995 | Ga0307409_102018102 | Ga0307409_1020181021 | 137 |
| 341 | 3300032002 | Ga0307416_100002549 | Ga0307416_1000025492 | 137 |
| 342 | 3300032002 | Ga0307416_100049705 | Ga0307416_1000497054 | 137 |
| 343 | 3300032002 | Ga0307416_100057475 | Ga0307416_1000574752 | 137 |
| 344 | 3300032002 | Ga0307416_100071336 | Ga0307416_1000713362 | 137 |
| 345 | 3300032002 | Ga0307416_100450459 | Ga0307416_1004504592 | 137 |
| 346 | 3300032002 | Ga0307416_100724940 | Ga0307416_1007249401 | 137 |
| 347 | 3300032002 | Ga0307416_100932513 | Ga0307416_1009325132 | 137 |
| 348 | 3300032002 | Ga0307416_101243409 | Ga0307416_1012434092 | 137 |
| 349 | 3300032002 | Ga0307416_101278636 | Ga0307416_1012786362 | 137 |
| 350 | 3300032002 | Ga0307416_101788507 | Ga0307416_1017885072 | 137 |
| 351 | 3300032004 | Ga0307414_10000486 | Ga0307414_100004863 | 137 |
| 352 | 3300032004 | Ga0307414_10001040 | Ga0307414_1000104011 | 137 |
| 353 | 3300032004 | Ga0307414_10006477 | Ga0307414_100064774 | 137 |
| 354 | 3300032004 | Ga0307414_10011626 | Ga0307414_100116265 | 137 |
| 355 | 3300032004 | Ga0307414_10039170 | Ga0307414_100391702 | 137 |
| 356 | 3300032004 | Ga0307414_10044651 | Ga0307414_100446513 | 137 |
| 357 | 3300032004 | Ga0307414_10049873 | Ga0307414_100498732 | 137 |
| 358 | 3300032004 | Ga0307414_10073472 | Ga0307414_100734722 | 137 |
| 359 | 3300032004 | Ga0307414_10120441 | Ga0307414_101204413 | 137 |
| 360 | 3300032004 | Ga0307414_10140986 | Ga0307414_101409862 | 137 |
| 361 | 3300032004 | Ga0307414_10275259 | Ga0307414_102752593 | 137 |
| 362 | 3300032004 | Ga0307414_10308300 | Ga0307414_103083001 | 137 |
| 363 | 3300032004 | Ga0307414_10457785 | Ga0307414_104577852 | 137 |
| 364 | 3300032004 | Ga0307414_10562784 | Ga0307414_105627842 | 137 |
| 365 | 3300032004 | Ga0307414_10581634 | Ga0307414_105816342 | 137 |
| 366 | 3300032004 | Ga0307414_10652973 | Ga0307414_106529732 | 137 |
| 367 | 3300032004 | Ga0307414_10674212 | Ga0307414_106742122 | 137 |
| 368 | 3300032004 | Ga0307414_10769207 | Ga0307414_107692071 | 137 |
| 369 | 3300032004 | Ga0307414_10771345 | Ga0307414_107713452 | 137 |
| 370 | 3300032004 | Ga0307414_10814078 | Ga0307414_108140782 | 137 |
| 371 | 3300032004 | Ga0307414_10861851 | Ga0307414_108618511 | 137 |
| 372 | 3300032004 | Ga0307414_10875399 | Ga0307414_108753991 | 137 |
| 373 | 3300032004 | Ga0307414_10914101 | Ga0307414_109141012 | 137 |
| 374 | 3300032004 | Ga0307414_10971483 | Ga0307414_109714832 | 137 |
| 375 | 3300032004 | Ga0307414_11147998 | Ga0307414_111479982 | 137 |
| 376 | 3300032004 | Ga0307414_11388252 | Ga0307414_113882521 | 137 |
| 377 | 3300032004 | Ga0307414_12168960 | Ga0307414_121689601 | 137 |
| 378 | 3300032005 | Ga0307411_10035984 | Ga0307411_100359845 | 137 |
| 379 | 3300032005 | Ga0307411_10073330 | Ga0307411_100733304 | 137 |
| 380 | 3300032005 | Ga0307411_10192888 | Ga0307411_101928882 | 137 |
| 381 | 3300032005 | Ga0307411_10236009 | Ga0307411_102360092 | 137 |
| 382 | 3300032005 | Ga0307411_10268432 | Ga0307411_102684323 | 137 |
| 383 | 3300032005 | Ga0307411_10418424 | Ga0307411_104184242 | 137 |
| 384 | 3300032005 | Ga0307411_10498630 | Ga0307411_104986302 | 137 |
| 385 | 3300032005 | Ga0307411_10717687 | Ga0307411_107176871 | 137 |
| 386 | 3300032005 | Ga0307411_10964729 | Ga0307411_109647292 | 137 |
| 387 | 3300032005 | Ga0307411_10980616 | Ga0307411_109806162 | 137 |
| 388 | 3300032005 | Ga0307411_10980658 | Ga0307411_109806581 | 137 |
| 389 | 3300032005 | Ga0307411_11500314 | Ga0307411_115003141 | 137 |
| 390 | 3300032005 | Ga0307411_11823706 | Ga0307411_118237061 | 137 |
| 391 | 3300032126 | Ga0307415_100004677 | Ga0307415_1000046773 | 137 |
| 392 | 3300032126 | Ga0307415_100027986 | Ga0307415_1000279862 | 137 |
| 393 | 3300032126 | Ga0307415_100191462 | Ga0307415_1001914623 | 137 |
| 394 | 3300032126 | Ga0307415_100356638 | Ga0307415_1003566382 | 137 |
| 395 | 3300032126 | Ga0307415_100375923 | Ga0307415_1003759231 | 137 |
| 396 | 3300032126 | Ga0307415_100555002 | Ga0307415_1005550022 | 137 |
| 397 | 3300032126 | Ga0307415_100766427 | Ga0307415_1007664271 | 137 |
| 398 | 3300032126 | Ga0307415_100787717 | Ga0307415_1007877172 | 137 |
| 399 | 3300032126 | Ga0307415_101457828 | Ga0307415_1014578282 | 137 |
| 400 | 3300032126 | Ga0307415_101762801 | Ga0307415_1017628011 | 137 |
| 401 | 3300037471 | Ga0395905_0112865 | Ga0395905_0112865_1266_1679 | 137 |
| 402 | 3300037471 | Ga0395905_0128838 | Ga0395905_0128838_1336_1749 | 137 |
| 403 | 3300038443 | Ga0395901_0121559 | Ga0395901_0121559_1881_2294 | 137 |
| 404 | 3300039437 | Ga0436365_1296624 | Ga0436365_1296624_802_1215 | 137 |
| 405 | 3300039437 | Ga0436365_1764132 | Ga0436365_1764132_124_537 | 137 |
| 406 | 3300041408 | Ga0439453_0132671 | Ga0439453_0132671_61_474 | 137 |
| 407 | 3300041413 | Ga0439465_0368210 | Ga0439465_0368210_48_461 | 137 |
| 408 | 3300041452 | Ga0451793_0089535 | Ga0451793_0089535_292_705 | 137 |
| 409 | 3300042001 | Ga0439441_137588 | Ga0439441_137588_26_439 | 137 |
| 410 | 3300042002 | Ga0439442_064523 | Ga0439442_064523_198_611 | 137 |
| 411 | 3300042006 | Ga0439432_062657 | Ga0439432_062657_202_615 | 137 |
| 412 | 3300042006 | Ga0439432_172598 | Ga0439432_172598_174_587 | 137 |
| 413 | 3300042007 | Ga0439449_0123456 | Ga0439449_0123456_349_762 | 137 |
| 414 | 3300042116 | Ga0450912_026182 | Ga0450912_026182_17_430 | 137 |
| 415 | 3300042439 | Ga0439464_0001561 | Ga0439464_0001561_3799_4212 | 137 |
| 416 | 3300045051 | Ga0451576_0494190 | Ga0451576_0494190_560_973 | 137 |
| 417 | 3300046471 | Ga0495650_0040089 | Ga0495650_0040089_1474_1887 | 137 |
| 418 | 3300046500 | Ga0495596_0170864 | Ga0495596_0170864_81_494 | 137 |
| 419 | 3300046513 | Ga0495616_0000187 | Ga0495616_0000187_39023_39436 | 137 |
| 420 | 3300046522 | Ga0495643_0011914 | Ga0495643_0011914_503_916 | 137 |
| 421 | 3300046525 | Ga0495663_0040407 | Ga0495663_0040407_765_1178 | 137 |
| 422 | 3300046525 | Ga0495663_0068786 | Ga0495663_0068786_699_1112 | 137 |
| 423 | 3300046525 | Ga0495663_0112274 | Ga0495663_0112274_165_578 | 137 |
| 424 | 3300046525 | Ga0495663_0160484 | Ga0495663_0160484_181_594 | 137 |
| 425 | 3300046525 | Ga0495663_0227550 | Ga0495663_0227550_119_532 | 137 |
| 426 | 3300046530 | Ga0495654_0015755 | Ga0495654_0015755_3056_3469 | 137 |
| 427 | 3300046530 | Ga0495654_0030157 | Ga0495654_0030157_824_1237 | 137 |
| 428 | 3300046530 | Ga0495654_0087132 | Ga0495654_0087132_92_505 | 137 |
| 429 | 3300046537 | Ga0495598_0004644 | Ga0495598_0004644_2111_2524 | 137 |
| 430 | 3300046537 | Ga0495598_0459613 | Ga0495598_0459613_41_454 | 137 |
| 431 | 3300046539 | Ga0495621_0006102 | Ga0495621_0006102_2783_3196 | 137 |
| 432 | 3300046539 | Ga0495621_0028095 | Ga0495621_0028095_521_934 | 137 |
| 433 | 3300046558 | Ga0495633_0284799 | Ga0495633_0284799_16_429 | 137 |
| 434 | 3300046616 | Ga0495668_0000024 | Ga0495668_0000024_189294_189707 | 137 |
| 435 | 3300046616 | Ga0495668_0019448 | Ga0495668_0019448_1006_1419 | 137 |
| 436 | 3300046616 | Ga0495668_0043954 | Ga0495668_0043954_985_1398 | 137 |
| 437 | 3300046648 | Ga0495611_0336069 | Ga0495611_0336069_172_585 | 137 |
| 438 | 3300046660 | Ga0495625_0000196 | Ga0495625_0000196_6813_7226 | 137 |
| 439 | 3300046664 | Ga0495659_0027612 | Ga0495659_0027612_1490_1903 | 137 |
| 440 | 3300046684 | Ga0495669_0000602 | Ga0495669_0000602_11299_11727 | 137 |
| 441 | 3300046684 | Ga0495669_0022836 | Ga0495669_0022836_1751_2164 | 137 |
| 442 | 3300046684 | Ga0495669_0436980 | Ga0495669_0436980_128_541 | 137 |
| 443 | 3300046691 | Ga0495670_0091718 | Ga0495670_0091718_446_859 | 137 |
| 444 | 3300046691 | Ga0495670_0365382 | Ga0495670_0365382_57_470 | 137 |
| 445 | 3300046694 | Ga0495649_0393355 | Ga0495649_0393355_131_544 | 137 |
| 446 | 3300047318 | Ga0495636_0226809 | Ga0495636_0226809_187_600 | 137 |
| 447 | 3300047445 | Ga0495677_0138458 | Ga0495677_0138458_428_856 | 137 |
| 448 | 3300047470 | Ga0495681_0351738 | Ga0495681_0351738_10_423 | 137 |
| 449 | 3300047472 | Ga0495686_0000701 | Ga0495686_0000701_34298_34711 | 137 |
| 450 | 3300048903 | Ga0496100_0144000 | Ga0496100_0144000_192_617 | 137 |
| 451 | 3300048904 | Ga0496101_0305200 | Ga0496101_0305200_591_1031 | 137 |
| 452 | 3300048905 | Ga0496102_0504780 | Ga0496102_0504780_174_587 | 137 |
| 453 | 3300048906 | Ga0496103_0047920 | Ga0496103_0047920_1067_1507 | 137 |
| 454 | 3300048909 | Ga0496106_1460242 | Ga0496106_1460242_77_505 | 137 |
| 455 | 3300048911 | Ga0496108_0283881 | Ga0496108_0283881_314_742 | 137 |
| 456 | 3300048912 | Ga0496109_0025686 | Ga0496109_0025686_878_1306 | 137 |
| 457 | 3300048913 | Ga0496110_0001413 | Ga0496110_0001413_10207_10635 | 137 |
| 458 | 3300048914 | Ga0496111_0011130 | Ga0496111_0011130_5114_5542 | 137 |
| 459 | 3300048916 | Ga0496113_1097698 | Ga0496113_1097698_135_563 | 137 |
| 460 | 3300048917 | Ga0496114_0146039 | Ga0496114_0146039_1074_1502 | 137 |
| 461 | 3300048920 | Ga0496117_0037162 | Ga0496117_0037162_2913_3353 | 137 |
| 462 | 3300048921 | Ga0496118_0000339 | Ga0496118_0000339_51719_52159 | 137 |
| 463 | 3300048921 | Ga0496118_0020455 | Ga0496118_0020455_5076_5507 | 137 |
| 464 | 3300048924 | Ga0496121_0000222 | Ga0496121_0000222_75413_75844 | 137 |
| 465 | 3300049459 | Ga0495678_017250 | Ga0495678_017250_2638_3051 | 137 |
| 466 | 3300049513 | Ga0501290_000464 | Ga0501290_000464_1069_1482 | 137 |
| 467 | 3300049513 | Ga0501290_006459 | Ga0501290_006459_268_681 | 137 |
| 468 | 3300049515 | Ga0501292_000026 | Ga0501292_000026_27553_27966 | 137 |
| 469 | 3300049516 | Ga0501293_001367 | Ga0501293_001367_61_474 | 137 |
| 470 | 3300049517 | Ga0501294_000620 | Ga0501294_000620_2556_2969 | 137 |
| 471 | 3300049520 | Ga0501297_003055 | Ga0501297_003055_163_576 | 137 |
| 472 | 3300049521 | Ga0501298_022812 | Ga0501298_022812_706_1119 | 137 |
| 473 | 3300049523 | Ga0501300_004021 | Ga0501300_004021_769_1182 | 137 |
| 474 | 3300049523 | Ga0501300_004703 | Ga0501300_004703_785_1198 | 137 |
| 475 | 3300049523 | Ga0501300_021080 | Ga0501300_021080_400_813 | 137 |
| 476 | 3300049524 | Ga0501301_001208 | Ga0501301_001208_690_1103 | 137 |
| 477 | 3300049568 | Ga0501031_0051644 | Ga0501031_0051644_122_535 | 137 |
| 478 | 3300049569 | Ga0501032_0165002 | Ga0501032_0165002_382_795 | 137 |
| 479 | 3300049570 | Ga0501033_0001955 | Ga0501033_0001955_14578_14991 | 137 |
| 480 | 3300049572 | Ga0501036_0225590 | Ga0501036_0225590_1089_1502 | 137 |
| 481 | 3300049572 | Ga0501036_1549534 | Ga0501036_1549534_106_519 | 137 |
| 482 | 3300049573 | Ga0501037_0168433 | Ga0501037_0168433_1046_1459 | 137 |
| 483 | 3300049574 | Ga0501038_0045845 | Ga0501038_0045845_3025_3438 | 137 |
| 484 | 3300049574 | Ga0501038_0050719 | Ga0501038_0050719_552_965 | 137 |
| 485 | 3300049575 | Ga0501039_0121354 | Ga0501039_0121354_346_759 | 137 |
| 486 | 3300049579 | Ga0501043_0046027 | Ga0501043_0046027_1685_2098 | 137 |
| 487 | 3300049581 | Ga0501047_0639593 | Ga0501047_0639593_70_483 | 137 |
| 488 | 3300049581 | Ga0501047_1452705 | Ga0501047_1452705_58_471 | 137 |
| 489 | 3300049582 | Ga0501048_0290394 | Ga0501048_0290394_703_1116 | 137 |
| 490 | 3300049587 | Ga0501071_0450790 | Ga0501071_0450790_66_479 | 137 |
| 491 | 3300049587 | Ga0501071_1331330 | Ga0501071_1331330_118_531 | 137 |
| 492 | 3300049652 | Ga0501202_004276 | Ga0501202_004276_1256_1669 | 137 |
| 493 | 3300049653 | Ga0501206_000824 | Ga0501206_000824_2517_2930 | 137 |
| 494 | 3300049661 | Ga0501217_296631 | Ga0501217_296631_81_494 | 137 |
| 495 | 3300049662 | Ga0501222_000640 | Ga0501222_000640_1670_2083 | 137 |
| 496 | 3300049663 | Ga0501223_002932 | Ga0501223_002932_239_652 | 137 |
| 497 | 3300049663 | Ga0501223_005742 | Ga0501223_005742_1030_1443 | 137 |
| 498 | 3300049663 | Ga0501223_006203 | Ga0501223_006203_1354_1767 | 137 |
| 499 | 3300049664 | Ga0501224_000020 | Ga0501224_000020_3092_3505 | 137 |
| 500 | 3300049664 | Ga0501224_009136 | Ga0501224_009136_980_1393 | 137 |
| 501 | 3300049665 | Ga0501227_010889 | Ga0501227_010889_1442_1855 | 137 |
| 502 | 3300049665 | Ga0501227_016975 | Ga0501227_016975_710_1123 | 137 |
| 503 | 3300049668 | Ga0501233_007168 | Ga0501233_007168_1199_1612 | 137 |
| 504 | 3300049668 | Ga0501233_048660 | Ga0501233_048660_573_986 | 137 |
| 505 | 3300049669 | Ga0501235_001905 | Ga0501235_001905_859_1272 | 137 |
| 506 | 3300049669 | Ga0501235_002921 | Ga0501235_002921_3018_3431 | 137 |
| 507 | 3300049675 | Ga0501243_041061 | Ga0501243_041061_41_454 | 137 |
| 508 | 3300049677 | Ga0501247_037872 | Ga0501247_037872_209_622 | 137 |
| 509 | 3300049686 | Ga0501257_000131 | Ga0501257_000131_1555_1968 | 137 |
| 510 | 3300049688 | Ga0501259_000268 | Ga0501259_000268_6722_7135 | 137 |
| 511 | 3300049690 | Ga0501261_000046 | Ga0501261_000046_756_1169 | 137 |
| 512 | 3300049704 | Ga0501221_005058 | Ga0501221_005058_506_919 | 137 |
| 513 | 3300049705 | Ga0501225_0000009 | Ga0501225_0000009_45582_45995 | 137 |
| 514 | 3300049706 | Ga0501229_003848 | Ga0501229_003848_571_984 | 137 |
| 515 | 3300049708 | Ga0501245_001012 | Ga0501245_001012_667_1080 | 137 |
| 516 | 3300049765 | Ga0501268_091764 | Ga0501268_091764_18_431 | 137 |
| 517 | 3300049773 | Ga0501276_002528 | Ga0501276_002528_131_544 | 137 |
| 518 | 3300049775 | Ga0501279_000027 | Ga0501279_000027_9289_9702 | 137 |
| 519 | 3300049776 | Ga0501280_000044 | Ga0501280_000044_1062_1475 | 137 |
| 520 | 3300049776 | Ga0501280_001131 | Ga0501280_001131_1047_1460 | 137 |
| 521 | 3300049777 | Ga0501281_00442 | Ga0501281_00442_3420_3833 | 137 |
| 522 | 3300049778 | Ga0501282_000334 | Ga0501282_000334_1340_1753 | 137 |
| 523 | 3300049779 | Ga0501283_009832 | Ga0501283_009832_256_669 | 137 |
| 524 | 3300049822 | Ga0501035_0018153 | Ga0501035_0018153_219_632 | 137 |
| 525 | 3300049823 | Ga0501044_0196206 | Ga0501044_0196206_1116_1529 | 137 |
| 526 | 3300049853 | Ga0501226_000187 | Ga0501226_000187_259_672 | 137 |
| 527 | 3300050005 | Ga0501284_01647 | Ga0501284_01647_364_777 | 137 |
| 528 | 3300050510 | nmdc:mga06r32_1106451_c1 | nmdc:mga06r32_1106451_c1_238_651 | 137 |
| 529 | 3300050510 | nmdc:mga06r32_14029_c1 | nmdc:mga06r32_14029_c1_1550_1969 | 137 |
| 530 | 3300050511 | nmdc:mga08y16_719013_c1 | nmdc:mga08y16_719013_c1_47_460 | 137 |
| 531 | 3300053087 | Ga0500643_000065 | Ga0500643_000065_70555_70968 | 137 |
| 532 | 3300053087 | Ga0500643_000488 | Ga0500643_000488_9535_9948 | 137 |
| 533 | 3300053087 | Ga0500643_100970 | Ga0500643_100970_231_644 | 137 |
| 534 | 3300053116 | Ga0500592_000140 | Ga0500592_000140_13203_13616 | 137 |
| 535 | 3300053116 | Ga0500592_000384 | Ga0500592_000384_6739_7152 | 137 |
| 536 | 3300053116 | Ga0500592_028997 | Ga0500592_028997_379_792 | 137 |
| 537 | 3300053116 | Ga0500592_061242 | Ga0500592_061242_112_525 | 137 |
| 538 | 3300053134 | Ga0500658_0402787 | Ga0500658_0402787_11_424 | 137 |
| 539 | 3300053136 | Ga0500559_0002322 | Ga0500559_0002322_8174_8587 | 137 |
| 540 | 3300053139 | Ga0500568_0001688 | Ga0500568_0001688_4144_4557 | 137 |
| 541 | 3300053148 | Ga0500590_000142 | Ga0500590_000142_317_730 | 137 |
| 542 | 3300053151 | Ga0500604_0009046 | Ga0500604_0009046_1091_1504 | 137 |
| 543 | 3300053151 | Ga0500604_0015383 | Ga0500604_0015383_1664_2077 | 137 |
| 544 | 3300053151 | Ga0500604_0028845 | Ga0500604_0028845_217_630 | 137 |
| 545 | 3300053158 | Ga0500627_0000043 | Ga0500627_0000043_59058_59471 | 137 |
| 546 | 3300053158 | Ga0500627_0000551 | Ga0500627_0000551_3163_3576 | 137 |
| 547 | 3300053158 | Ga0500627_0161586 | Ga0500627_0161586_492_905 | 137 |
| 548 | 3300053727 | Ga0500611_044866 | Ga0500611_044866_395_808 | 137 |
| 549 | 3300055283 | Ga0500661_000036 | Ga0500661_000036_10677_11090 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar