F462344

General Info

Members Datasets Scaffolds Average Seq Length
549 250 1098 283

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100030497|Ga0075434_1000304974
Length 304
Sequence MSVSTAAPSPAVPSRAAGLPLASRLAAFRTEGLPVIPIVILLVLMFTAVFAEFIVPHNPEVGSLSQRFKPPVWIAGGSSAHLLGTDHIGRDVLSRLIFGARVSMIVGFTAVIFAGVLGTALGIVSGYFGGWVDQVIMRVTDTWLALPALTFAIFLAAIVGPSEWNIVIILGAVYWTRYARVIRGEVLSLKERDFVRLAIVAGCSKWKIMRKHILPNVLNSAIVLATLMLGVVIVTEAALSFLGVGVPPPKPAWGLMLADGKKGLMAGYWWLTVFPGVCIVLMVLSANLLGDWLRVKLDPQLRQL

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
250 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.91
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 2.73
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100030497 3300006871 Bacteria 5310
2 JGI25406J46586_10057238 3300003203 Unclassified 1275
3 Ga0070690_100047268 3300005330 Bacteria 2738
4 Ga0070690_100178902 3300005330 Bacteria 1465
5 Ga0068869_100010180 3300005334 Bacteria 6123
6 Ga0070680_100023019 3300005336 Bacteria 4965
7 Ga0070680_100283095 3300005336 Bacteria 1405
8 Ga0070689_100093751 3300005340 Bacteria 2370
9 Ga0070691_10001306 3300005341 Bacteria 10581
10 Ga0070691_10041358 3300005341 Bacteria 2179
11 Ga0070691_10170426 3300005341 Bacteria 1128
12 Ga0070661_100036789 3300005344 Bacteria 3558
13 Ga0070669_100066673 3300005353 Bacteria 2654
14 Ga0070674_100074583 3300005356 Bacteria 2408
15 Ga0070673_100082142 3300005364 Bacteria 2615
16 Ga0070673_100185650 3300005364 Bacteria 1782
17 Ga0070659_100220917 3300005366 Bacteria 1564
18 Ga0070703_10011632 3300005406 Bacteria 2488
19 Ga0070703_10015466 3300005406 Bacteria 2183
20 Ga0070714_100094967 3300005435 Bacteria 2618
21 Ga0070701_10004446 3300005438 Bacteria 5681
22 Ga0070701_10134864 3300005438 Bacteria 1406
23 Ga0070705_100013022 3300005440 Bacteria 4244
24 Ga0070705_100101479 3300005440 Bacteria 1818
25 Ga0070705_100103288 3300005440 Bacteria 1804
26 Ga0070700_100036815 3300005441 Bacteria 2971
27 Ga0070694_100004360 3300005444 Bacteria 8507
28 Ga0070694_100047963 3300005444 Bacteria 2872
29 Ga0070694_100057177 3300005444 Bacteria 2651
30 Ga0070694_100144773 3300005444 Bacteria 1730
31 Ga0070678_100124692 3300005456 Bacteria 2036
32 Ga0070662_100068033 3300005457 Bacteria 2617
33 Ga0070681_10227042 3300005458 Bacteria 1782
34 Ga0070681_10518024 3300005458 Bacteria 1106
35 Ga0068867_100049511 3300005459 Bacteria 3094
36 Ga0068867_100218019 3300005459 Bacteria 1536
37 Ga0070706_100029003 3300005467 Bacteria 5097
38 Ga0070706_100041777 3300005467 Bacteria 4234
39 Ga0070706_100073920 3300005467 Bacteria 3156
40 Ga0070706_100075770 3300005467 Bacteria 3114
41 Ga0070706_100185198 3300005467 Bacteria 1945
42 Ga0070706_100203258 3300005467 Bacteria 1850
43 Ga0070707_100004668 3300005468 Bacteria 12831
44 Ga0070707_100042921 3300005468 Bacteria 4330
45 Ga0070707_100117242 3300005468 Bacteria 2584
46 Ga0070707_100182610 3300005468 Bacteria 2045
47 Ga0070698_100003620 3300005471 Bacteria 16986
48 Ga0070698_100073429 3300005471 Bacteria 3427
49 Ga0070698_100081656 3300005471 Bacteria 3226
50 Ga0070698_100445921 3300005471 Bacteria 1230
51 Ga0070699_100029439 3300005518 Bacteria 4734
52 Ga0070699_100030865 3300005518 Bacteria 4626
53 Ga0070679_100081658 3300005530 Bacteria 3222
54 Ga0070679_100216637 3300005530 Unclassified 1877
55 Ga0070684_100003405 3300005535 Bacteria 11934
56 Ga0070697_100102244 3300005536 Bacteria 2381
57 Ga0070697_100268904 3300005536 Bacteria 1461
58 Ga0068853_100467448 3300005539 Bacteria 1188
59 Ga0070672_100014565 3300005543 Bacteria 5576
60 Ga0070686_100141230 3300005544 Bacteria 1677
61 Ga0070695_100000486 3300005545 Bacteria 20702
62 Ga0070695_100005906 3300005545 Bacteria 7223
63 Ga0070695_100006683 3300005545 Bacteria 6819
64 Ga0070695_100006977 3300005545 Bacteria 6692
65 Ga0070695_100030571 3300005545 Bacteria 3354
66 Ga0070696_100006808 3300005546 Bacteria 7632
67 Ga0070665_100423047 3300005548 Bacteria 1341
68 Ga0070704_100023823 3300005549 Bacteria 4006
69 Ga0070704_100037034 3300005549 Bacteria 3329
70 Ga0070704_100059931 3300005549 Bacteria 2717
71 Ga0070704_100159070 3300005549 Bacteria 1785
72 Ga0070704_100164686 3300005549 Bacteria 1757
73 Ga0068855_100047139 3300005563 Bacteria 5092
74 Ga0068855_100107060 3300005563 Bacteria 3212
75 Ga0068857_100004916 3300005577 Bacteria 11340
76 Ga0068856_100029378 3300005614 Bacteria 5370
77 Ga0068856_100096072 3300005614 Bacteria 2952
78 Ga0068856_100679883 3300005614 Bacteria 1050
79 Ga0068852_100019640 3300005616 Bacteria 5354
80 Ga0068866_10160323 3300005718 Bacteria 1311
81 Ga0068861_100090766 3300005719 Bacteria 2411
82 Ga0068861_100149343 3300005719 Bacteria 1916
83 Ga0068863_100122637 3300005841 Bacteria 2479
84 Ga0068863_100479640 3300005841 Bacteria 1223
85 Ga0068860_100116823 3300005843 Bacteria 2552
86 Ga0068860_100230487 3300005843 Bacteria 1800
87 Ga0068862_100054736 3300005844 Bacteria 3416
88 Ga0068862_100065352 3300005844 Bacteria 3133
89 Ga0068862_100164322 3300005844 Bacteria 1983
90 Ga0081455_10000302 3300005937 Bacteria 65101
91 Ga0081455_10000666 3300005937 Bacteria 44517
92 Ga0081540_1033259 3300005983 Bacteria 2802
93 Ga0081539_10000020 3300005985 Bacteria 366549
94 Ga0075365_10152600 3300006038 Bacteria 1607
95 Ga0070716_100093733 3300006173 Bacteria 1824
96 Ga0070712_100103053 3300006175 Bacteria 2115
97 Ga0070712_100139027 3300006175 Bacteria 1851
98 Ga0075369_10014460 3300006186 Bacteria 3153
99 Ga0075369_10105602 3300006186 Bacteria 1266
100 Ga0075370_10138624 3300006353 Bacteria 1421
101 Ga0075428_100001365 3300006844 Bacteria 25940
102 Ga0075428_100002513 3300006844 Bacteria 19932
103 Ga0075428_100002795 3300006844 Bacteria 18990
104 Ga0075428_100004121 3300006844 Bacteria 16002
105 Ga0075428_100039429 3300006844 Bacteria 5199
106 Ga0075428_100204396 3300006844 Bacteria 2135
107 Ga0075428_100213671 3300006844 Bacteria 2084
108 Ga0075428_100594518 3300006844 Bacteria 1182
109 Ga0075428_100609597 3300006844 Bacteria 1166
110 Ga0075430_100000052 3300006846 Bacteria 60703
111 Ga0075430_100003056 3300006846 Bacteria 13990
112 Ga0075430_100008106 3300006846 Bacteria 8881
113 Ga0075430_100079600 3300006846 Bacteria 2746
114 Ga0075430_100097897 3300006846 Bacteria 2451
115 Ga0075430_100140448 3300006846 Bacteria 2012
116 Ga0075430_100287322 3300006846 Bacteria 1360
117 Ga0075431_100000038 3300006847 Bacteria 68191
118 Ga0075431_100000309 3300006847 Bacteria 38472
119 Ga0075431_100003208 3300006847 Bacteria 15823
120 Ga0075431_100003560 3300006847 Bacteria 15083
121 Ga0075431_100007008 3300006847 Bacteria 11202
122 Ga0075431_100028574 3300006847 Bacteria 5733
123 Ga0075431_100037217 3300006847 Bacteria 5015
124 Ga0075431_100050327 3300006847 Bacteria 4296
125 Ga0075431_100146686 3300006847 Bacteria 2432
126 Ga0075433_10016949 3300006852 Bacteria 6020
127 Ga0075433_10036035 3300006852 Bacteria 4259
128 Ga0075433_10077845 3300006852 Bacteria 2921
129 Ga0075433_10080881 3300006852 Bacteria 2864
130 Ga0075433_10161872 3300006852 Bacteria 1992
131 Ga0075433_10162649 3300006852 Bacteria 1987
132 Ga0075433_10212773 3300006852 Bacteria 1718
133 Ga0075433_10264177 3300006852 Bacteria 1525
134 Ga0075433_10272616 3300006852 Bacteria 1500
135 Ga0075434_100069045 3300006871 Bacteria 3522
136 Ga0075434_100096127 3300006871 Bacteria 2968
137 Ga0075434_100123969 3300006871 Bacteria 2600
138 Ga0075434_100163274 3300006871 Bacteria 2247
139 Ga0075434_100437403 3300006871 Bacteria 1329
140 Ga0075434_100651254 3300006871 Unclassified 1072
141 Ga0075429_100000898 3300006880 Bacteria 23530
142 Ga0075429_100004919 3300006880 Bacteria 11517
143 Ga0075429_100004927 3300006880 Bacteria 11504
144 Ga0075429_100029569 3300006880 Bacteria 4758
145 Ga0075429_100091607 3300006880 Bacteria 2652
146 Ga0075429_100184156 3300006880 Bacteria 1830
147 Ga0075435_100003234 3300007076 Bacteria 11027
148 Ga0075435_100014830 3300007076 Bacteria 5842
149 Ga0075435_100034131 3300007076 Bacteria 4028
150 Ga0075435_100098773 3300007076 Bacteria 2417
151 Ga0075435_100215666 3300007076 Bacteria 1629
152 Ga0099794_10006950 3300007265 Bacteria 4615
153 Ga0099794_10077387 3300007265 Bacteria 1636
154 Ga0111539_10000552 3300009094 Bacteria 47861
155 Ga0111539_10004281 3300009094 Bacteria 18675
156 Ga0111539_10113883 3300009094 Bacteria 3172
157 Ga0111539_10128679 3300009094 Bacteria 2966
158 Ga0111539_10248727 3300009094 Bacteria 2070
159 Ga0111539_10340568 3300009094 Bacteria 1746
160 Ga0111539_10537460 3300009094 Bacteria 1362
161 Ga0111539_10852033 3300009094 Bacteria 1060
162 Ga0105245_10391694 3300009098 Bacteria 1386
163 Ga0105247_10300078 3300009101 Bacteria 1114
164 Ga0105247_10394175 3300009101 Bacteria 985
165 Ga0114129_10000919 3300009147 Bacteria 38401
166 Ga0114129_10002604 3300009147 Bacteria 25084
167 Ga0114129_10009756 3300009147 Bacteria 13694
168 Ga0114129_10016331 3300009147 Bacteria 10568
169 Ga0114129_10016728 3300009147 Bacteria 10446
170 Ga0114129_10016827 3300009147 Bacteria 10410
171 Ga0114129_10044316 3300009147 Bacteria 6258
172 Ga0114129_10056789 3300009147 Bacteria 5481
173 Ga0114129_10099934 3300009147 Bacteria 4014
174 Ga0114129_10305772 3300009147 Bacteria 2118
175 Ga0114129_10360925 3300009147 Bacteria 1922
176 Ga0114129_10521735 3300009147 Bacteria 1549
177 Ga0114129_10600362 3300009147 Bacteria 1426
178 Ga0114129_10857813 3300009147 Bacteria 1154
179 Ga0105243_10034011 3300009148 Bacteria 3944
180 Ga0105243_10146589 3300009148 Bacteria 2020
181 Ga0105243_10184410 3300009148 Bacteria 1817
182 Ga0105241_10049300 3300009174 Bacteria 3206
183 Ga0105242_10013272 3300009176 Bacteria 6361
184 Ga0105248_10052063 3300009177 Bacteria 4594
185 Ga0105248_10167472 3300009177 Bacteria 2477
186 Ga0105238_10013568 3300009551 Bacteria 8226
187 Ga0105249_10257934 3300009553 Bacteria 1731
188 Ga0105249_10409967 3300009553 Bacteria 1387
189 Ga0105246_10210075 3300011119 Bacteria 1519
190 Ga0157371_10047325 3300013102 Bacteria 3058
191 Ga0157370_10597115 3300013104 Bacteria 1011
192 Ga0157369_10038752 3300013105 Bacteria 5210
193 Ga0157374_10155548 3300013296 Bacteria 2225
194 Ga0157374_10172217 3300013296 Bacteria 2112
195 Ga0157378_10085835 3300013297 Bacteria 2852
196 Ga0163162_10149302 3300013306 Bacteria 2454
197 Ga0157372_10114313 3300013307 Bacteria 3094
198 Ga0157372_10888242 3300013307 Bacteria 1034
199 Ga0157375_10031764 3300013308 Bacteria 4998
200 Ga0163163_10084127 3300014325 Bacteria 3187
201 Ga0182008_10096729 3300014497 Bacteria 1457
202 Ga0163161_10296578 3300017792 Bacteria 1272
203 Ga0206356_10548587 3300020070 Bacteria 1489
204 Ga0206350_11380830 3300020080 Bacteria 1189
205 Ga0213876_10237204 3300021384 Bacteria 969
206 Ga0224712_10012862 3300022467 Bacteria 2648
207 Ga0207426_1046375 3300025302 Bacteria 1316
208 Ga0207653_10021994 3300025885 Bacteria 2025
209 Ga0207653_10049843 3300025885 Bacteria 1391
210 Ga0207647_10064617 3300025904 Bacteria 2223
211 Ga0207647_10141531 3300025904 Bacteria 1410
212 Ga0207685_10013532 3300025905 Bacteria 2526
213 Ga0207643_10062898 3300025908 Bacteria 2121
214 Ga0207684_10030532 3300025910 Bacteria 4587
215 Ga0207684_10040928 3300025910 Bacteria 3929
216 Ga0207684_10041705 3300025910 Bacteria 3890
217 Ga0207684_10056676 3300025910 Bacteria 3325
218 Ga0207684_10251082 3300025910 Bacteria 1526
219 Ga0207693_10052009 3300025915 Bacteria 3213
220 Ga0207693_10111503 3300025915 Bacteria 2146
221 Ga0207660_10366235 3300025917 Bacteria 1157
222 Ga0207657_10116574 3300025919 Bacteria 2201
223 Ga0207649_10022741 3300025920 Bacteria 3622
224 Ga0207652_10050772 3300025921 Bacteria 3554
225 Ga0207646_10035476 3300025922 Bacteria 4504
226 Ga0207646_10050043 3300025922 Bacteria 3741
227 Ga0207646_10058200 3300025922 Bacteria 3452
228 Ga0207646_10178122 3300025922 Bacteria 1920
229 Ga0207694_10032416 3300025924 Bacteria 4000
230 Ga0207650_10256101 3300025925 Bacteria 1418
231 Ga0207659_10057627 3300025926 Bacteria 2786
232 Ga0207706_10031319 3300025933 Bacteria 4739
233 Ga0207706_10049981 3300025933 Bacteria 3695
234 Ga0207706_10055724 3300025933 Bacteria 3485
235 Ga0207686_10049117 3300025934 Bacteria 2617
236 Ga0207686_10105481 3300025934 Bacteria 1890
237 Ga0207709_10013989 3300025935 Bacteria 4430
238 Ga0207665_10000522 3300025939 Bacteria 25926
239 Ga0207691_10035022 3300025940 Bacteria 4665
240 Ga0207691_10217369 3300025940 Bacteria 1658
241 Ga0207711_10181224 3300025941 Bacteria 1916
242 Ga0207689_10005613 3300025942 Bacteria 11180
243 Ga0207689_10012502 3300025942 Bacteria 7252
244 Ga0207661_10020435 3300025944 Bacteria 4950
245 Ga0207679_10011214 3300025945 Bacteria 5792
246 Ga0207712_10129746 3300025961 Bacteria 1919
247 Ga0207712_10220247 3300025961 Bacteria 1517
248 Ga0207668_10033646 3300025972 Bacteria 3397
249 Ga0207668_10337103 3300025972 Bacteria 1257
250 Ga0207677_10232308 3300026023 Bacteria 1486
251 Ga0207639_10031224 3300026041 Bacteria 3914
252 Ga0207702_10006161 3300026078 Bacteria 10379
253 Ga0207702_10063224 3300026078 Bacteria 3164
254 Ga0207641_10065111 3300026088 Bacteria 3117
255 Ga0207641_10308901 3300026088 Bacteria 1496
256 Ga0207648_10110621 3300026089 Bacteria 2412
257 Ga0207648_10153788 3300026089 Bacteria 2030
258 Ga0207648_10188273 3300026089 Bacteria 1828
259 Ga0207676_10403143 3300026095 Bacteria 1279
260 Ga0207674_10003977 3300026116 Bacteria 17968
261 Ga0207674_10523885 3300026116 Bacteria 1145
262 Ga0207675_100060260 3300026118 Bacteria 3543
263 Ga0207675_100060331 3300026118 Bacteria 3541
264 Ga0207675_100130311 3300026118 Bacteria 2384
265 Ga0207675_100164904 3300026118 Bacteria 2115
266 Ga0207683_10139314 3300026121 Bacteria 2185
267 Ga0207698_10021425 3300026142 Bacteria 4470
268 Ga0209981_1001844 3300027378 Bacteria 2695
269 Ga0209982_1002551 3300027552 Bacteria 2563
270 Ga0209970_1000999 3300027614 Bacteria 5030
271 Ga0210002_1003634 3300027617 Bacteria 2281
272 Ga0209983_1000359 3300027665 Bacteria 9610
273 Ga0209983_1008156 3300027665 Bacteria 2142
274 Ga0209588_1003205 3300027671 Bacteria 4517
275 Ga0209971_1000091 3300027682 Bacteria 27342
276 Ga0209971_1023439 3300027682 Bacteria 1473
277 Ga0209966_1000471 3300027695 Bacteria 10948
278 Ga0209966_1029230 3300027695 Bacteria 1110
279 Ga0209998_10000487 3300027717 Bacteria 10916
280 Ga0209974_10000497 3300027876 Bacteria 13125
281 Ga0207428_10000173 3300027907 Bacteria 90064
282 Ga0207428_10005690 3300027907 Bacteria 11584
283 Ga0207428_10028359 3300027907 Bacteria 4652
284 Ga0207428_10094552 3300027907 Bacteria 2317
285 Ga0268266_10176261 3300028379 Bacteria 1944
286 Ga0268266_10290582 3300028379 Bacteria 1522
287 Ga0268266_10559387 3300028379 Bacteria 1096
288 Ga0268265_10045342 3300028380 Bacteria 3280
289 Ga0268265_10057568 3300028380 Bacteria 2963
290 Ga0268264_10148547 3300028381 Bacteria 2099
291 Ga0307408_100014396 3300031548 Bacteria 5254
292 Ga0307408_100047261 3300031548 Bacteria 3081
293 Ga0307406_10090638 3300031901 Bacteria 2058
294 Ga0307416_100020346 3300032002 Bacteria 4733
295 Ga0307416_100124457 3300032002 Bacteria 2306
296 Ga0307416_100379428 3300032002 Bacteria 1443
297 Ga0307411_10069133 3300032005 Bacteria 2384
298 Ga0373958_0011565 3300034819 Bacteria 1494
299 Ga0373929_0019172 3300035085 Bacteria 1367
300 Ga0373940_0056931 3300035088 Bacteria 1110
301 Ga0373932_0025365 3300035112 Bacteria 1604
302 Ga0373939_0003477 3300035114 Bacteria 3697
303 Ga0373945_0043832 3300035116 Bacteria 1625
304 Ga0373953_0002546 3300035117 Bacteria 5506
305 Ga0373953_0116865 3300035117 Bacteria 1131
306 Ga0373954_0010485 3300035118 Bacteria 4089
307 Ga0373954_0086383 3300035118 Bacteria 1503
308 Ga0373956_0033976 3300035119 Bacteria 2245
309 Ga0373961_0001772 3300035241 Bacteria 5961
310 Ga0373962_0006367 3300035242 Bacteria 2859
311 Ga0373931_0001525 3300035691 Bacteria 9986
312 Ga0373931_0011575 3300035691 Bacteria 4261
313 Ga0373935_0421911 3300035692 Bacteria 960
314 Ga0373927_0060036 3300035695 Bacteria 2460
315 Ga0373933_0006509 3300035724 Bacteria 6360
316 Ga0373933_0035959 3300035724 Bacteria 2896
317 Ga0373947_0024333 3300035725 Bacteria 3529
318 Ga0373947_0112780 3300035725 Bacteria 1720
319 Ga0373937_0003961 3300036401 Bacteria 12519
320 Ga0373937_0005068 3300036401 Bacteria 11213
321 Ga0373925_0072582 3300037068 Bacteria 2604
322 Ga0395899_0019687 3300037312 Bacteria 5124
323 Ga0395900_0015260 3300037418 Bacteria 7833
324 Ga0395900_0033238 3300037418 Bacteria 5309
325 Ga0395898_0021228 3300037466 Bacteria 6587
326 Ga0395901_0015493 3300038443 Bacteria 7762
327 Ga0395901_0021176 3300038443 Bacteria 6659
328 Ga0395901_0360982 3300038443 Bacteria 1498
329 Ga0242420_006449 3300038996 Bacteria 1854
330 Ga0436365_1637095 3300039437 Bacteria 3023
331 Ga0436362_0597598 3300039453 Bacteria 1316
332 Ga0439460_0003075 3300042461 Bacteria 4033
333 Ga0439460_0020358 3300042461 Bacteria 1803
334 Ga0451577_0002345 3300042876 Bacteria 22791
335 Ga0451577_0030609 3300042876 Bacteria 4862
336 Ga0451577_0105087 3300042876 Bacteria 2524
337 Ga0453683_0014510 3300044673 Bacteria 5112
338 Ga0453683_0021239 3300044673 Bacteria 4145
339 Ga0453684_0021719 3300044712 Bacteria 9569
340 Ga0451576_0005434 3300045051 Bacteria 15978
341 Ga0451576_0053050 3300045051 Bacteria 4249
342 Ga0451576_0144686 3300045051 Bacteria 2478
343 Ga0451576_0355353 3300045051 Bacteria 1534
344 Ga0495592_0087330 3300046454 Bacteria 2244
345 Ga0495638_0006471 3300046460 Bacteria 8520
346 Ga0495580_0203499 3300046472 Bacteria 1364
347 Ga0495584_0080535 3300046491 Bacteria 1639
348 Ga0495594_0123576 3300046499 Bacteria 1464
349 Ga0495594_0216361 3300046499 Bacteria 1092
350 Ga0495628_0096459 3300046516 Bacteria 2284
351 Ga0495640_0093768 3300046533 Bacteria 1978
352 Ga0495656_0004975 3300046615 Bacteria 4578
353 Ga0495599_0041473 3300046678 Bacteria 2890
354 Ga0495658_0128836 3300046683 Bacteria 1538
355 Ga0495658_0258622 3300046683 Bacteria 1096
356 Ga0495669_0050276 3300046684 Bacteria 1869
357 Ga0495674_0120764 3300047319 Bacteria 2214
358 Ga0496101_0095823 3300048904 Bacteria 2214
359 Ga0496102_0044173 3300048905 Bacteria 4043
360 Ga0496102_0166379 3300048905 Bacteria 2075
361 Ga0496102_0257210 3300048905 Bacteria 1646
362 Ga0496103_0015830 3300048906 Bacteria 4497
363 Ga0496104_0029980 3300048907 Bacteria 5051
364 Ga0496105_0083681 3300048908 Bacteria 2635
365 Ga0496107_0156770 3300048910 Bacteria 1686
366 Ga0496108_0026850 3300048911 Bacteria 4752
367 Ga0496108_0055272 3300048911 Bacteria 3333
368 Ga0496109_0020386 3300048912 Bacteria 5856
369 Ga0496110_0026516 3300048913 Bacteria 4960
370 Ga0496110_0063298 3300048913 Bacteria 3268
371 Ga0496111_0090599 3300048914 Bacteria 2240
372 Ga0496114_0127528 3300048917 Bacteria 2194
373 Ga0496119_0000546 3300048922 Bacteria 51240
374 Ga0496122_0002881 3300048925 Bacteria 23547
375 Ga0496123_0005437 3300048926 Bacteria 12825
376 Ga0496126_0027540 3300048929 Bacteria 5427
377 Ga0501031_0063074 3300049568 Bacteria 2415
378 Ga0501033_0055416 3300049570 Bacteria 2931
379 Ga0501033_0251018 3300049570 Bacteria 1254
380 Ga0501033_0287657 3300049570 Bacteria 1159
381 Ga0501034_0001551 3300049571 Bacteria 30141
382 Ga0501034_0005696 3300049571 Bacteria 13542
383 Ga0501034_0559236 3300049571 Bacteria 1053
384 Ga0501034_0593761 3300049571 Bacteria 1013
385 Ga0501036_0244287 3300049572 Bacteria 1505
386 Ga0501038_0204474 3300049574 Bacteria 1583
387 Ga0501039_0010436 3300049575 Bacteria 7078
388 Ga0501039_0114487 3300049575 Bacteria 2110
389 Ga0501040_0184780 3300049576 Bacteria 1478
390 Ga0501041_0002268 3300049577 Bacteria 10876
391 Ga0501041_0122101 3300049577 Bacteria 1619
392 Ga0501042_0004738 3300049578 Bacteria 8684
393 Ga0501042_0224816 3300049578 Bacteria 1354
394 Ga0501043_0077379 3300049579 Bacteria 2614
395 Ga0501046_0000256 3300049580 Bacteria 54366
396 Ga0501046_0043384 3300049580 Bacteria 3581
397 Ga0501046_0177130 3300049580 Bacteria 1597
398 Ga0501046_0242836 3300049580 Bacteria 1328
399 Ga0501046_0417689 3300049580 Bacteria 967
400 Ga0501047_0031300 3300049581 Bacteria 5131
401 Ga0501048_0015816 3300049582 Bacteria 5566
402 Ga0501067_0014703 3300049583 Bacteria 4330
403 Ga0501068_0003189 3300049584 Bacteria 8782
404 Ga0501069_0048946 3300049585 Bacteria 2349
405 Ga0501069_0052978 3300049585 Bacteria 2260
406 Ga0501070_0450073 3300049586 Bacteria 1038
407 Ga0501070_0533406 3300049586 Bacteria 941
408 Ga0501071_0031991 3300049587 Bacteria 3733
409 Ga0501071_0132005 3300049587 Bacteria 1856
410 Ga0501071_0143229 3300049587 Bacteria 1781
411 Ga0501072_0028873 3300049588 Bacteria 4330
412 Ga0501072_0055625 3300049588 Bacteria 3118
413 Ga0501072_0055626 3300049588 Bacteria 3118
414 Ga0501072_0099772 3300049588 Bacteria 2308
415 Ga0501072_0104538 3300049588 Bacteria 2252
416 Ga0501072_0121234 3300049588 Bacteria 2083
417 Ga0501074_0034129 3300049590 Bacteria 3688
418 Ga0501074_0357526 3300049590 Bacteria 1036
419 Ga0501075_0003599 3300049591 Bacteria 10385
420 Ga0501075_0080905 3300049591 Bacteria 2459
421 Ga0501075_0097622 3300049591 Bacteria 2230
422 Ga0501075_0129245 3300049591 Bacteria 1924
423 Ga0501076_0002735 3300049592 Bacteria 12207
424 Ga0501076_0004588 3300049592 Bacteria 9833
425 Ga0501076_0005794 3300049592 Bacteria 8914
426 Ga0501076_0188170 3300049592 Bacteria 1684
427 Ga0501076_0301746 3300049592 Bacteria 1313
428 Ga0501076_0542287 3300049592 Bacteria 959
429 Ga0501077_0002642 3300049593 Bacteria 10733
430 Ga0501077_0053630 3300049593 Bacteria 2560
431 Ga0501077_0249450 3300049593 Bacteria 1129
432 Ga0501079_0002601 3300049741 Bacteria 13121
433 Ga0501079_0005395 3300049741 Bacteria 9524
434 Ga0501079_0053889 3300049741 Bacteria 3103
435 Ga0501079_0136058 3300049741 Bacteria 1913
436 Ga0501079_0236116 3300049741 Bacteria 1428
437 Ga0501080_0087696 3300049742 Bacteria 2891
438 Ga0501080_0149411 3300049742 Bacteria 2160
439 Ga0501080_0311233 3300049742 Bacteria 1427
440 Ga0501081_0002007 3300049743 Bacteria 12673
441 Ga0501081_0038180 3300049743 Bacteria 3279
442 Ga0501081_0095777 3300049743 Bacteria 2093
443 Ga0501081_0129196 3300049743 Bacteria 1804
444 Ga0501081_0210372 3300049743 Bacteria 1412
445 Ga0501083_0004985 3300049744 Bacteria 9413
446 Ga0501083_0053708 3300049744 Bacteria 2705
447 Ga0501045_0000178 3300049824 Bacteria 35077
448 Ga0501045_0096279 3300049824 Bacteria 2190
449 Ga0501045_0110250 3300049824 Bacteria 2040
450 Ga0501045_0179213 3300049824 Bacteria 1579
451 nmdc:mga03683_56283_c1 3300050489 Bacteria 1653
452 nmdc:mga06z11_111188_c1 3300050494 Bacteria 1517
453 nmdc:mga05p37_113254_c1 3300050507 Bacteria 3335
454 nmdc:mga05p37_15883_c1 3300050507 Bacteria 9057
455 nmdc:mga05p37_29407_c1 3300050507 Bacteria 6705
456 nmdc:mga05p37_30746_c1 3300050507 Bacteria 6553
457 nmdc:mga05p37_38575_c1 3300050507 Bacteria 5860
458 nmdc:mga05p37_390182_c1 3300050507 Bacteria 1629
459 nmdc:mga05p37_422611_c1 3300050507 Bacteria 1551
460 nmdc:mga05p37_4960_c1 3300050507 Bacteria 15593
461 nmdc:mga05p37_5898_c1 3300050507 Bacteria 14410
462 nmdc:mga05p37_652662_c1 3300050507 Bacteria 1178
463 nmdc:mga05p37_74134_c1 3300050507 Bacteria 4189
464 nmdc:mga05p37_8835_c1 3300050507 Bacteria 11903
465 nmdc:mga09592_124616_c1 3300050508 Bacteria 2214
466 nmdc:mga09592_1465_c1 3300050508 Bacteria 18943
467 nmdc:mga09592_194728_c1 3300050508 Bacteria 1755
468 nmdc:mga09592_26346_c1 3300050508 Bacteria 4816
469 nmdc:mga09592_7120_c1 3300050508 Bacteria 9093
470 nmdc:mga09592_73577_c1 3300050508 Bacteria 2903
471 nmdc:mga09592_88982_c1 3300050508 Bacteria 2637
472 nmdc:mga0qj67_140130_c1 3300050509 Bacteria 1961
473 nmdc:mga0qj67_15200_c1 3300050509 Bacteria 5826
474 nmdc:mga0qj67_30561_c1 3300050509 Bacteria 4194
475 nmdc:mga0qj67_364310_c1 3300050509 Bacteria 1168
476 nmdc:mga0qj67_449_c1 3300050509 Bacteria 28141
477 nmdc:mga0qj67_5329_c1 3300050509 Bacteria 9382
478 nmdc:mga0qj67_71070_c1 3300050509 Bacteria 2777
479 nmdc:mga06r32_1206_c1 3300050510 Bacteria 23285
480 nmdc:mga06r32_161042_c1 3300050510 Bacteria 2227
481 nmdc:mga06r32_282795_c1 3300050510 Bacteria 1646
482 nmdc:mga06r32_29446_c1 3300050510 Bacteria 5146
483 nmdc:mga06r32_29463_c1 3300050510 Bacteria 5145
484 nmdc:mga06r32_37763_c1 3300050510 Bacteria 4569
485 nmdc:mga06r32_40957_c1 3300050510 Bacteria 4400
486 nmdc:mga06r32_4577_c1 3300050510 Bacteria 12400
487 nmdc:mga06r32_4734_c1 3300050510 Bacteria 12237
488 nmdc:mga06r32_5623_c1 3300050510 Bacteria 11275
489 nmdc:mga06r32_75773_c1 3300050510 Bacteria 3266
490 nmdc:mga06r32_966_c1 3300050510 Bacteria 25673
491 nmdc:mga08y16_12285_c1 3300050511 Bacteria 9003
492 nmdc:mga08y16_164755_c1 3300050511 Bacteria 2303
493 nmdc:mga08y16_171520_c1 3300050511 Bacteria 2253
494 nmdc:mga08y16_181022_c1 3300050511 Bacteria 2189
495 nmdc:mga08y16_2085_c1 3300050511 Bacteria 20512
496 nmdc:mga08y16_559732_c1 3300050511 Bacteria 1156
497 nmdc:mga08y16_83181_c1 3300050511 Bacteria 3336
498 nmdc:mga0n895_109937_c1 3300050512 Bacteria 2772
499 nmdc:mga0n895_130456_c1 3300050512 Bacteria 2538
500 nmdc:mga0n895_156062_c1 3300050512 Bacteria 2313
501 nmdc:mga0n895_17105_c1 3300050512 Bacteria 6678
502 nmdc:mga0n895_217483_c1 3300050512 Bacteria 1940
503 nmdc:mga0n895_50835_c1 3300050512 Bacteria 4065
504 nmdc:mga0n895_567804_c1 3300050512 Bacteria 1139
505 nmdc:mga0n895_65749_c1 3300050512 Bacteria 3590
506 nmdc:mga0rr50_12033_c1 3300050513 Bacteria 3854
507 nmdc:mga0rr50_15534_c1 3300050513 Bacteria 5029
508 nmdc:mga0rr50_6209_c1 3300050513 Bacteria 7244
509 nmdc:mga08x19_2285_c1 3300050514 Bacteria 11635
510 nmdc:mga08x19_82235_c1 3300050514 Bacteria 2116
511 nmdc:mga08x19_88983_c1 3300050514 Bacteria 2036
512 nmdc:mga0a205_12064_c1 3300050515 Bacteria 6964
513 nmdc:mga0a205_148663_c1 3300050515 Bacteria 2243
514 nmdc:mga0a205_16698_c1 3300050515 Bacteria 3184
515 nmdc:mga0a205_217470_c1 3300050515 Bacteria 1797
516 nmdc:mga0a205_2612_c1 3300050515 Bacteria 15917
517 nmdc:mga0a205_342726_c1 3300050515 Bacteria 1363
518 nmdc:mga0a205_353862_c1 3300050515 Bacteria 1336
519 nmdc:mga0a205_36620_c1 3300050515 Bacteria 4715
520 nmdc:mga0a205_460716_c1 3300050515 Bacteria 1131
521 nmdc:mga0a205_4755_c1 3300050515 Bacteria 12202
522 nmdc:mga0a205_85448_c1 3300050515 Bacteria 3047
523 nmdc:mga0a205_98794_c1 3300050515 Bacteria 2817
524 nmdc:mga0sz30_13173_c2 3300050516 Bacteria 2770
525 nmdc:mga0sz30_51673_c1 3300050516 Bacteria 1744
526 Ga0495601_0079689 3300053077 Bacteria 2100
527 Ga0495619_0035758 3300053085 Bacteria 3232
528 Ga0495619_0039442 3300053085 Bacteria 3083
529 Ga0500646_0053349 3300053090 Bacteria 1172
530 Ga0500556_0000431 3300053104 Bacteria 29930
531 Ga0501084_0002999 3300054114 Bacteria 13674
532 Ga0501084_0013238 3300054114 Bacteria 6827
533 Ga0501084_0029766 3300054114 Bacteria 4568
534 Ga0501084_0256596 3300054114 Bacteria 1476
535 Ga0590071_019838 3300059421 Bacteria 1583
536 Ga0590075_018354 3300059424 Bacteria 1730
537 Ga0587082_011752 3300059504 Bacteria 1287
538 Ga0587078_001161 3300059646 Bacteria 2276
539 Ga0501082_0005151 3300060353 Bacteria 11379
540 Ga0501082_0012756 3300060353 Bacteria 7222
541 Ga0501082_0053769 3300060353 Bacteria 3470
542 Ga0501082_0292033 3300060353 Bacteria 1419
543 Ga0530510_0000152 3300061734 Bacteria 41201
544 Ga0530510_0052644 3300061734 Bacteria 2941
545 Ga0530510_0061626 3300061734 Bacteria 2716
546 Ga0530510_0144342 3300061734 Bacteria 1755
547 Ga0530510_0175877 3300061734 Bacteria 1586
548 2916974218 2916971899 Bacteria 4250608
549 2919450961 2919450847 Bacteria 5631160
550 Ga0075434_100030497
551 JGI25406J46586_10057238
552 Ga0070690_100047268
553 Ga0070690_100178902
554 Ga0068869_100010180
555 Ga0070680_100023019
556 Ga0070680_100283095
557 Ga0070689_100093751
558 Ga0070691_10001306
559 Ga0070691_10041358
560 Ga0070691_10170426
561 Ga0070661_100036789
562 Ga0070669_100066673
563 Ga0070674_100074583
564 Ga0070673_100082142
565 Ga0070673_100185650
566 Ga0070659_100220917
567 Ga0070703_10011632
568 Ga0070703_10015466
569 Ga0070714_100094967
570 Ga0070701_10004446
571 Ga0070701_10134864
572 Ga0070705_100013022
573 Ga0070705_100101479
574 Ga0070705_100103288
575 Ga0070700_100036815
576 Ga0070694_100004360
577 Ga0070694_100047963
578 Ga0070694_100057177
579 Ga0070694_100144773
580 Ga0070678_100124692
581 Ga0070662_100068033
582 Ga0070681_10227042
583 Ga0070681_10518024
584 Ga0068867_100049511
585 Ga0068867_100218019
586 Ga0070706_100029003
587 Ga0070706_100041777
588 Ga0070706_100073920
589 Ga0070706_100075770
590 Ga0070706_100185198
591 Ga0070706_100203258
592 Ga0070707_100004668
593 Ga0070707_100042921
594 Ga0070707_100117242
595 Ga0070707_100182610
596 Ga0070698_100003620
597 Ga0070698_100073429
598 Ga0070698_100081656
599 Ga0070698_100445921
600 Ga0070699_100029439
601 Ga0070699_100030865
602 Ga0070679_100081658
603 Ga0070679_100216637
604 Ga0070684_100003405
605 Ga0070697_100102244
606 Ga0070697_100268904
607 Ga0068853_100467448
608 Ga0070672_100014565
609 Ga0070686_100141230
610 Ga0070695_100000486
611 Ga0070695_100005906
612 Ga0070695_100006683
613 Ga0070695_100006977
614 Ga0070695_100030571
615 Ga0070696_100006808
616 Ga0070665_100423047
617 Ga0070704_100023823
618 Ga0070704_100037034
619 Ga0070704_100059931
620 Ga0070704_100159070
621 Ga0070704_100164686
622 Ga0068855_100047139
623 Ga0068855_100107060
624 Ga0068857_100004916
625 Ga0068856_100029378
626 Ga0068856_100096072
627 Ga0068856_100679883
628 Ga0068852_100019640
629 Ga0068866_10160323
630 Ga0068861_100090766
631 Ga0068861_100149343
632 Ga0068863_100122637
633 Ga0068863_100479640
634 Ga0068860_100116823
635 Ga0068860_100230487
636 Ga0068862_100054736
637 Ga0068862_100065352
638 Ga0068862_100164322
639 Ga0081455_10000302
640 Ga0081455_10000666
641 Ga0081540_1033259
642 Ga0081539_10000020
643 Ga0075365_10152600
644 Ga0070716_100093733
645 Ga0070712_100103053
646 Ga0070712_100139027
647 Ga0075369_10014460
648 Ga0075369_10105602
649 Ga0075370_10138624
650 Ga0075428_100001365
651 Ga0075428_100002513
652 Ga0075428_100002795
653 Ga0075428_100004121
654 Ga0075428_100039429
655 Ga0075428_100204396
656 Ga0075428_100213671
657 Ga0075428_100594518
658 Ga0075428_100609597
659 Ga0075430_100000052
660 Ga0075430_100003056
661 Ga0075430_100008106
662 Ga0075430_100079600
663 Ga0075430_100097897
664 Ga0075430_100140448
665 Ga0075430_100287322
666 Ga0075431_100000038
667 Ga0075431_100000309
668 Ga0075431_100003208
669 Ga0075431_100003560
670 Ga0075431_100007008
671 Ga0075431_100028574
672 Ga0075431_100037217
673 Ga0075431_100050327
674 Ga0075431_100146686
675 Ga0075433_10016949
676 Ga0075433_10036035
677 Ga0075433_10077845
678 Ga0075433_10080881
679 Ga0075433_10161872
680 Ga0075433_10162649
681 Ga0075433_10212773
682 Ga0075433_10264177
683 Ga0075433_10272616
684 Ga0075434_100069045
685 Ga0075434_100096127
686 Ga0075434_100123969
687 Ga0075434_100163274
688 Ga0075434_100437403
689 Ga0075434_100651254
690 Ga0075429_100000898
691 Ga0075429_100004919
692 Ga0075429_100004927
693 Ga0075429_100029569
694 Ga0075429_100091607
695 Ga0075429_100184156
696 Ga0075435_100003234
697 Ga0075435_100014830
698 Ga0075435_100034131
699 Ga0075435_100098773
700 Ga0075435_100215666
701 Ga0099794_10006950
702 Ga0099794_10077387
703 Ga0111539_10000552
704 Ga0111539_10004281
705 Ga0111539_10113883
706 Ga0111539_10128679
707 Ga0111539_10248727
708 Ga0111539_10340568
709 Ga0111539_10537460
710 Ga0111539_10852033
711 Ga0105245_10391694
712 Ga0105247_10300078
713 Ga0105247_10394175
714 Ga0114129_10000919
715 Ga0114129_10002604
716 Ga0114129_10009756
717 Ga0114129_10016331
718 Ga0114129_10016728
719 Ga0114129_10016827
720 Ga0114129_10044316
721 Ga0114129_10056789
722 Ga0114129_10099934
723 Ga0114129_10305772
724 Ga0114129_10360925
725 Ga0114129_10521735
726 Ga0114129_10600362
727 Ga0114129_10857813
728 Ga0105243_10034011
729 Ga0105243_10146589
730 Ga0105243_10184410
731 Ga0105241_10049300
732 Ga0105242_10013272
733 Ga0105248_10052063
734 Ga0105248_10167472
735 Ga0105238_10013568
736 Ga0105249_10257934
737 Ga0105249_10409967
738 Ga0105246_10210075
739 Ga0157371_10047325
740 Ga0157370_10597115
741 Ga0157369_10038752
742 Ga0157374_10155548
743 Ga0157374_10172217
744 Ga0157378_10085835
745 Ga0163162_10149302
746 Ga0157372_10114313
747 Ga0157372_10888242
748 Ga0157375_10031764
749 Ga0163163_10084127
750 Ga0182008_10096729
751 Ga0163161_10296578
752 Ga0206356_10548587
753 Ga0206350_11380830
754 Ga0213876_10237204
755 Ga0224712_10012862
756 Ga0207426_1046375
757 Ga0207653_10021994
758 Ga0207653_10049843
759 Ga0207647_10064617
760 Ga0207647_10141531
761 Ga0207685_10013532
762 Ga0207643_10062898
763 Ga0207684_10030532
764 Ga0207684_10040928
765 Ga0207684_10041705
766 Ga0207684_10056676
767 Ga0207684_10251082
768 Ga0207693_10052009
769 Ga0207693_10111503
770 Ga0207660_10366235
771 Ga0207657_10116574
772 Ga0207649_10022741
773 Ga0207652_10050772
774 Ga0207646_10035476
775 Ga0207646_10050043
776 Ga0207646_10058200
777 Ga0207646_10178122
778 Ga0207694_10032416
779 Ga0207650_10256101
780 Ga0207659_10057627
781 Ga0207706_10031319
782 Ga0207706_10049981
783 Ga0207706_10055724
784 Ga0207686_10049117
785 Ga0207686_10105481
786 Ga0207709_10013989
787 Ga0207665_10000522
788 Ga0207691_10035022
789 Ga0207691_10217369
790 Ga0207711_10181224
791 Ga0207689_10005613
792 Ga0207689_10012502
793 Ga0207661_10020435
794 Ga0207679_10011214
795 Ga0207712_10129746
796 Ga0207712_10220247
797 Ga0207668_10033646
798 Ga0207668_10337103
799 Ga0207677_10232308
800 Ga0207639_10031224
801 Ga0207702_10006161
802 Ga0207702_10063224
803 Ga0207641_10065111
804 Ga0207641_10308901
805 Ga0207648_10110621
806 Ga0207648_10153788
807 Ga0207648_10188273
808 Ga0207676_10403143
809 Ga0207674_10003977
810 Ga0207674_10523885
811 Ga0207675_100060260
812 Ga0207675_100060331
813 Ga0207675_100130311
814 Ga0207675_100164904
815 Ga0207683_10139314
816 Ga0207698_10021425
817 Ga0209981_1001844
818 Ga0209982_1002551
819 Ga0209970_1000999
820 Ga0210002_1003634
821 Ga0209983_1000359
822 Ga0209983_1008156
823 Ga0209588_1003205
824 Ga0209971_1000091
825 Ga0209971_1023439
826 Ga0209966_1000471
827 Ga0209966_1029230
828 Ga0209998_10000487
829 Ga0209974_10000497
830 Ga0207428_10000173
831 Ga0207428_10005690
832 Ga0207428_10028359
833 Ga0207428_10094552
834 Ga0268266_10176261
835 Ga0268266_10290582
836 Ga0268266_10559387
837 Ga0268265_10045342
838 Ga0268265_10057568
839 Ga0268264_10148547
840 Ga0307408_100014396
841 Ga0307408_100047261
842 Ga0307406_10090638
843 Ga0307416_100020346
844 Ga0307416_100124457
845 Ga0307416_100379428
846 Ga0307411_10069133
847 Ga0373958_0011565
848 Ga0373929_0019172
849 Ga0373940_0056931
850 Ga0373932_0025365
851 Ga0373939_0003477
852 Ga0373945_0043832
853 Ga0373953_0002546
854 Ga0373953_0116865
855 Ga0373954_0010485
856 Ga0373954_0086383
857 Ga0373956_0033976
858 Ga0373961_0001772
859 Ga0373962_0006367
860 Ga0373931_0001525
861 Ga0373931_0011575
862 Ga0373935_0421911
863 Ga0373927_0060036
864 Ga0373933_0006509
865 Ga0373933_0035959
866 Ga0373947_0024333
867 Ga0373947_0112780
868 Ga0373937_0003961
869 Ga0373937_0005068
870 Ga0373925_0072582
871 Ga0395899_0019687
872 Ga0395900_0015260
873 Ga0395900_0033238
874 Ga0395898_0021228
875 Ga0395901_0015493
876 Ga0395901_0021176
877 Ga0395901_0360982
878 Ga0242420_006449
879 Ga0436365_1637095
880 Ga0436362_0597598
881 Ga0439460_0003075
882 Ga0439460_0020358
883 Ga0451577_0002345
884 Ga0451577_0030609
885 Ga0451577_0105087
886 Ga0453683_0014510
887 Ga0453683_0021239
888 Ga0453684_0021719
889 Ga0451576_0005434
890 Ga0451576_0053050
891 Ga0451576_0144686
892 Ga0451576_0355353
893 Ga0495592_0087330
894 Ga0495638_0006471
895 Ga0495580_0203499
896 Ga0495584_0080535
897 Ga0495594_0123576
898 Ga0495594_0216361
899 Ga0495628_0096459
900 Ga0495640_0093768
901 Ga0495656_0004975
902 Ga0495599_0041473
903 Ga0495658_0128836
904 Ga0495658_0258622
905 Ga0495669_0050276
906 Ga0495674_0120764
907 Ga0496101_0095823
908 Ga0496102_0044173
909 Ga0496102_0166379
910 Ga0496102_0257210
911 Ga0496103_0015830
912 Ga0496104_0029980
913 Ga0496105_0083681
914 Ga0496107_0156770
915 Ga0496108_0026850
916 Ga0496108_0055272
917 Ga0496109_0020386
918 Ga0496110_0026516
919 Ga0496110_0063298
920 Ga0496111_0090599
921 Ga0496114_0127528
922 Ga0496119_0000546
923 Ga0496122_0002881
924 Ga0496123_0005437
925 Ga0496126_0027540
926 Ga0501031_0063074
927 Ga0501033_0055416
928 Ga0501033_0251018
929 Ga0501033_0287657
930 Ga0501034_0001551
931 Ga0501034_0005696
932 Ga0501034_0559236
933 Ga0501034_0593761
934 Ga0501036_0244287
935 Ga0501038_0204474
936 Ga0501039_0010436
937 Ga0501039_0114487
938 Ga0501040_0184780
939 Ga0501041_0002268
940 Ga0501041_0122101
941 Ga0501042_0004738
942 Ga0501042_0224816
943 Ga0501043_0077379
944 Ga0501046_0000256
945 Ga0501046_0043384
946 Ga0501046_0177130
947 Ga0501046_0242836
948 Ga0501046_0417689
949 Ga0501047_0031300
950 Ga0501048_0015816
951 Ga0501067_0014703
952 Ga0501068_0003189
953 Ga0501069_0048946
954 Ga0501069_0052978
955 Ga0501070_0450073
956 Ga0501070_0533406
957 Ga0501071_0031991
958 Ga0501071_0132005
959 Ga0501071_0143229
960 Ga0501072_0028873
961 Ga0501072_0055625
962 Ga0501072_0055626
963 Ga0501072_0099772
964 Ga0501072_0104538
965 Ga0501072_0121234
966 Ga0501074_0034129
967 Ga0501074_0357526
968 Ga0501075_0003599
969 Ga0501075_0080905
970 Ga0501075_0097622
971 Ga0501075_0129245
972 Ga0501076_0002735
973 Ga0501076_0004588
974 Ga0501076_0005794
975 Ga0501076_0188170
976 Ga0501076_0301746
977 Ga0501076_0542287
978 Ga0501077_0002642
979 Ga0501077_0053630
980 Ga0501077_0249450
981 Ga0501079_0002601
982 Ga0501079_0005395
983 Ga0501079_0053889
984 Ga0501079_0136058
985 Ga0501079_0236116
986 Ga0501080_0087696
987 Ga0501080_0149411
988 Ga0501080_0311233
989 Ga0501081_0002007
990 Ga0501081_0038180
991 Ga0501081_0095777
992 Ga0501081_0129196
993 Ga0501081_0210372
994 Ga0501083_0004985
995 Ga0501083_0053708
996 Ga0501045_0000178
997 Ga0501045_0096279
998 Ga0501045_0110250
999 Ga0501045_0179213
1000 nmdc:mga03683_56283_c1
1001 nmdc:mga06z11_111188_c1
1002 nmdc:mga05p37_113254_c1
1003 nmdc:mga05p37_15883_c1
1004 nmdc:mga05p37_29407_c1
1005 nmdc:mga05p37_30746_c1
1006 nmdc:mga05p37_38575_c1
1007 nmdc:mga05p37_390182_c1
1008 nmdc:mga05p37_422611_c1
1009 nmdc:mga05p37_4960_c1
1010 nmdc:mga05p37_5898_c1
1011 nmdc:mga05p37_652662_c1
1012 nmdc:mga05p37_74134_c1
1013 nmdc:mga05p37_8835_c1
1014 nmdc:mga09592_124616_c1
1015 nmdc:mga09592_1465_c1
1016 nmdc:mga09592_194728_c1
1017 nmdc:mga09592_26346_c1
1018 nmdc:mga09592_7120_c1
1019 nmdc:mga09592_73577_c1
1020 nmdc:mga09592_88982_c1
1021 nmdc:mga0qj67_140130_c1
1022 nmdc:mga0qj67_15200_c1
1023 nmdc:mga0qj67_30561_c1
1024 nmdc:mga0qj67_364310_c1
1025 nmdc:mga0qj67_449_c1
1026 nmdc:mga0qj67_5329_c1
1027 nmdc:mga0qj67_71070_c1
1028 nmdc:mga06r32_1206_c1
1029 nmdc:mga06r32_161042_c1
1030 nmdc:mga06r32_282795_c1
1031 nmdc:mga06r32_29446_c1
1032 nmdc:mga06r32_29463_c1
1033 nmdc:mga06r32_37763_c1
1034 nmdc:mga06r32_40957_c1
1035 nmdc:mga06r32_4577_c1
1036 nmdc:mga06r32_4734_c1
1037 nmdc:mga06r32_5623_c1
1038 nmdc:mga06r32_75773_c1
1039 nmdc:mga06r32_966_c1
1040 nmdc:mga08y16_12285_c1
1041 nmdc:mga08y16_164755_c1
1042 nmdc:mga08y16_171520_c1
1043 nmdc:mga08y16_181022_c1
1044 nmdc:mga08y16_2085_c1
1045 nmdc:mga08y16_559732_c1
1046 nmdc:mga08y16_83181_c1
1047 nmdc:mga0n895_109937_c1
1048 nmdc:mga0n895_130456_c1
1049 nmdc:mga0n895_156062_c1
1050 nmdc:mga0n895_17105_c1
1051 nmdc:mga0n895_217483_c1
1052 nmdc:mga0n895_50835_c1
1053 nmdc:mga0n895_567804_c1
1054 nmdc:mga0n895_65749_c1
1055 nmdc:mga0rr50_12033_c1
1056 nmdc:mga0rr50_15534_c1
1057 nmdc:mga0rr50_6209_c1
1058 nmdc:mga08x19_2285_c1
1059 nmdc:mga08x19_82235_c1
1060 nmdc:mga08x19_88983_c1
1061 nmdc:mga0a205_12064_c1
1062 nmdc:mga0a205_148663_c1
1063 nmdc:mga0a205_16698_c1
1064 nmdc:mga0a205_217470_c1
1065 nmdc:mga0a205_2612_c1
1066 nmdc:mga0a205_342726_c1
1067 nmdc:mga0a205_353862_c1
1068 nmdc:mga0a205_36620_c1
1069 nmdc:mga0a205_460716_c1
1070 nmdc:mga0a205_4755_c1
1071 nmdc:mga0a205_85448_c1
1072 nmdc:mga0a205_98794_c1
1073 nmdc:mga0sz30_13173_c2
1074 nmdc:mga0sz30_51673_c1
1075 Ga0495601_0079689
1076 Ga0495619_0035758
1077 Ga0495619_0039442
1078 Ga0500646_0053349
1079 Ga0500556_0000431
1080 Ga0501084_0002999
1081 Ga0501084_0013238
1082 Ga0501084_0029766
1083 Ga0501084_0256596
1084 Ga0590071_019838
1085 Ga0590075_018354
1086 Ga0587082_011752
1087 Ga0587078_001161
1088 Ga0501082_0005151
1089 Ga0501082_0012756
1090 Ga0501082_0053769
1091 Ga0501082_0292033
1092 Ga0530510_0000152
1093 Ga0530510_0052644
1094 Ga0530510_0061626
1095 Ga0530510_0144342
1096 Ga0530510_0175877
1097 2916974218
1098 2919450961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

118

303

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.579 85 256
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.4741 85 256
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.4687 68 252
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.4611 143 254
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.3605 68 252
ID Description Score Start End Superfamily
af_P77463_85_288_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6196 91 252 1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5973 65 254 1.10.3720.10
af_P0AGH3_48_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5959 127 257 1.10.3720.10
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5948 129 256 1.10.3720.10
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5941 65 255 1.10.3720.10
ID Description Score Start End GO Terms
AF-W9V1L6-F1-model_v4 Dipeptide transport system permease protein dppC 0.8909 110 251 GO:0005886
GO:0071916
AF-F3FVR9-F1-model_v4 Binding-protein dependent transport system inner membrane protein 0.8745 105 219 GO:0005886
GO:0055085
AF-F3FVR9-F1-model_v4 Binding-protein dependent transport system inner membrane protein 0.8676 105 219 GO:0005886
GO:0055085
AF-W9V1L6-F1-model_v4 Dipeptide transport system permease protein dppC 0.8631 110 251 GO:0005886
GO:0071916
AF-A0A5N9GED5-F1-model_v4 ABC transporter permease 0.8153 138 260 GO:0005886
GO:0055085

Map