metagRoot

F462217

General Info

Members	Datasets	Scaffolds	Average Seq Length
548	365	406	352

Family's Representative Sequence

Representative Sequence	3300009036\|Ga0105244_10005895\|Ga0105244_100058958
Length	415
Sequence	MAPWLNTASVCCQGRINAPPTFCRGAIHGALAKYRTRLLINSDLRWLRGRNLRNLWTSYLCLILVMSHYSLRLQWMLLLIASLTLGVALQLFHLPAALLLGPMITGTVMGLCGATLRIDKRLFILAQAVLGCMIAQSLSPAILTPLLNDWPVVLAVLILTLAASGLSGFLLVRFSNLPGPTGAWGSSPGGASAMVAMAGDFGADVRLVAFMQYLRVLFVATAAAVVARIGLDTSGGAAEPIWFPALNRGFLLTLGVMAAGAWLGQRLRIPSGALLLPALTGAMLQGSQIATLQVPEWLLALAYALIGWSVGLRFTRPIFLLALRTLPQMLASILGLMVLCAALAWMLTRVLHIDLMTAYLATSPGGLDTVAIIAAGSRVDMTFVMALQTLRLFTILLTGPALARFISRFAHPRAG

Samples

	Sample ID	Description	Type	Environment
1	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
2	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
3	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
4	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
5	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
6	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
7	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
8	2537561728	Pectobacterium wasabiae CFBP 3304	Isolate	Rhizoplane
9	2547132181	Kosakonia sacchari SP1	Isolate	Stem
10	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
11	2558860983	Allorhizobium undicola ATCC 700741	Isolate	Rhizoplane
12	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
13	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
14	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
15	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
16	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
17	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
18	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
19	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
20	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
21	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
22	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
23	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
24	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
25	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
26	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
27	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
28	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
29	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
30	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
31	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
32	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
33	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
34	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
35	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
36	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
37	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
38	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
39	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
40	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
41	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
42	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
43	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
44	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
45	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
46	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
47	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
48	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
49	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
50	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
51	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
52	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
53	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
54	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
55	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
56	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
57	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
58	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
59	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
60	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
61	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
62	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
63	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
64	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
65	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
66	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
67	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
68	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
69	2654587920	Serratia plymuthica HRO-C48	Isolate	Rhizosphere
70	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
71	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
72	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
73	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
74	2687453601	Serratia plymuthica 3Rp8	Isolate	Unclassified
75	2706794495	Dickeya zeae ZJU1202	Isolate	Unclassified
76	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
77	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
78	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
79	2791354903	Mangrovibacter phragmitis MP23	Isolate	Unclassified
80	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
81	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
82	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
83	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
84	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
85	2842333319	Skermanella aerolata SEMIA 4010	Isolate	Nodule
86	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
87	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
88	2842775625	Roseomonas sp. R-71825	Isolate	Unclassified
89	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
90	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
91	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
92	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
93	2854601825	Dickeya dianthicola SS70	Isolate	Stem Tuber
94	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
95	2858466076	Pectobacterium polaris SS28	Isolate	Stem Tuber
96	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
97	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
98	2871272651	Pectobacterium carotovorum SS96	Isolate	Stem Tuber
99	2871282230	Pectobacterium parmentieri SS90	Isolate	Stem Tuber
100	2876601092	Pantoea endophytica 596	Isolate	Unclassified
101	2888350351	Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1	Isolate	Nodule
102	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
103	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
104	2889016732	Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1	Isolate	Nodule
105	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
106	2904504865	Serratia marcescens 1822	Isolate	Unclassified
107	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
108	2906354277	Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1	Isolate	Nodule
109	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
110	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
111	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
112	2919150387	Rahnella aceris 1817	Isolate	Unclassified
113	2922130491	Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1	Isolate	Nodule
114	2922185730	Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	Isolate	Nodule
115	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
116	2927143783	Rahnella sp. 2050	Isolate	Unclassified
117	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
118	2935625433	Kosakonia sp. 1610	Isolate	Rhizosphere
119	2937822353	Mesorhizobium neociceri CCANP35	Isolate	Nodule
120	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
121	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
122	2939577877	Serratia sp. 509	Isolate	Rhizosphere
123	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
124	2939617950	Kosakonia cowanii 2056	Isolate	Rhizosphere
125	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
126	2958100919	Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1	Isolate	Nodule
127	2958115193	Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1	Isolate	Nodule
128	2965119406	Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1	Isolate	Nodule
129	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
130	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
131	2974435778	Kosakonia cowanii SORGH_AS 304	Isolate	Unclassified
132	2977971508	Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1	Isolate	Nodule
133	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
134	2979710463	Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1	Isolate	Nodule
135	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
136	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
137	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
138	2987666974	Mesorhizobium sp. WSM4306	Isolate	Unclassified
139	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
140	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
141	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
142	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
143	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
144	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
145	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
146	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
147	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
148	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
149	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
150	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
151	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
152	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
153	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
154	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
155	3300005272	Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1	Metagenome	Rhizosphere
156	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
157	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
158	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
159	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
160	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
161	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
162	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
163	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
164	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
165	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
166	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
167	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
168	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
169	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
170	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
171	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
172	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
173	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
174	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
175	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
176	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
177	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
178	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
179	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
180	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
181	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
182	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
183	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
184	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
185	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
186	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
187	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
188	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
189	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
190	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
191	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
192	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
193	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
194	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
195	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
196	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
197	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
198	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
199	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
200	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
201	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
202	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
203	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
204	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
205	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
206	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
207	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
208	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
209	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
210	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
211	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
212	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
213	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
214	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
215	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
216	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
217	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
218	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
219	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
220	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
221	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
222	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
223	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
224	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
225	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
226	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
227	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
228	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
229	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
230	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
231	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
250	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
254	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
255	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
256	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
257	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
258	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
259	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
260	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
261	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
262	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
263	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
264	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
265	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
266	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
267	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
268	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
269	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
270	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
271	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
272	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
273	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
274	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
275	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
276	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
277	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
278	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
279	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
280	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
281	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
282	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
283	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
284	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
285	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
286	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
287	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
288	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
289	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
290	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
291	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
292	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
293	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
294	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
295	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
296	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
297	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
298	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
299	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
300	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
301	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
302	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
303	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
304	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
305	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
306	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
307	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
308	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
309	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
310	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
311	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
312	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
313	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
314	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
315	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
316	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
317	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
318	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
319	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
320	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
321	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
322	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
323	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
324	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
325	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
326	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
327	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
328	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
329	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
330	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
331	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
332	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
333	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
334	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
335	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
336	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
337	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
338	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
339	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
340	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
341	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
342	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
343	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
344	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
345	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
346	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
347	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
348	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
349	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
350	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
351	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
352	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
353	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
354	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
355	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
356	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
357	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
358	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
359	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
360	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
361	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
362	640753048	Serratia proteamaculans 568	Isolate	Endosphere
363	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
364	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
365	8019504834	Atlantibacter hermannii 1903	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	74.09
Metatranscriptomes	0
Isolates	25.91

Biome Distribution

Category	Percentage (%)
Aerial Root	0.73
Bulb	0
Endosphere	6.93
Nodule	3.83
Rhizoplane	11.31
Rhizosphere	57.12
Stem	0.18
Stem Tuber	0.91
Unclassified	18.98

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	RicEn_C2005	2010549000	Bacteria	2507
2	JGI24739J22299_10000016	3300001989	Bacteria	51238
3	JGI25162J39368_1000187	3300002737	Bacteria	65144
4	JGI25163J39215_1000498	3300002771	Bacteria	11707
5	JGI25164J39214_1000152	3300002772	Bacteria	65144
6	JGI25152J39213_1001503	3300002773	Bacteria	9927
7	JGI25406J46586_10000723	3300003203	Bacteria	15399
8	rootH1_10039424	3300003323	Bacteria	18307
9	Ga0055538_1000109	3300003751	Bacteria	65144
10	Ga0055539_1000158	3300003752	Bacteria	65144
11	Ga0055533_1000160	3300003756	Bacteria	65144
12	Ga0055525_1000212	3300003759	Bacteria	65144
13	Ga0055540_1006571	3300003792	Bacteria	4584
14	Ga0055531_10001041	3300003794	Bacteria	21965
15	Ga0055541_1000104	3300003841	Bacteria	65144
16	Ga0058692_1000145	3300003856	Bacteria	44977
17	Ga0058692_1000179	3300003856	Bacteria	38966
18	Ga0058692_1002280	3300003856	Bacteria	6496
19	Ga0065703_1019815	3300005272	Bacteria	2379
20	Ga0065704_10000450	3300005289	Bacteria	46008
21	Ga0070680_100011594	3300005336	Bacteria	6828
22	Ga0070682_100008453	3300005337	Bacteria	5810
23	Ga0070689_100176343	3300005340	Bacteria	1734
24	Ga0070691_10014257	3300005341	Bacteria	3645
25	Ga0070659_100102322	3300005366	Bacteria	2306
26	Ga0070703_10002437	3300005406	Bacteria	5362
27	Ga0070709_10035506	3300005434	Plasmid	3030
28	Ga0070701_10022828	3300005438	Bacteria	3005
29	Ga0070705_100000099	3300005440	Bacteria	48829
30	Ga0070700_100001390	3300005441	Bacteria	12017
31	Ga0070694_100016461	3300005444	Bacteria	4653
32	Ga0070708_100029816	3300005445	Bacteria	4708
33	Ga0070662_100001198	3300005457	Bacteria	15942
34	Ga0070662_100033556	3300005457	Bacteria	3615
35	Ga0070681_10004974	3300005458	Bacteria	12787
36	Ga0070681_10074931	3300005458	Bacteria	3345
37	Ga0068867_100115897	3300005459	Unclassified	2064
38	Ga0070698_100353996	3300005471	Bacteria	1400
39	Ga0070699_100015987	3300005518	Bacteria	6442
40	Ga0070679_100019729	3300005530	Bacteria	6561
41	Ga0068853_100006640	3300005539	Bacteria	9216
42	Ga0070695_100000415	3300005545	Bacteria	22065
43	Ga0070696_100000612	3300005546	Bacteria	22908
44	Ga0070693_100037933	3300005547	Bacteria	2690
45	Ga0070693_100046188	3300005547	Bacteria	2472
46	Ga0070665_100000449	3300005548	Bacteria	59974
47	Ga0070665_100136994	3300005548	Bacteria	2451
48	Ga0070704_100002687	3300005549	Bacteria	10051
49	Ga0068855_100073715	3300005563	Bacteria	3966
50	Ga0068855_100079146	3300005563	Bacteria	3812
51	Ga0068857_100014837	3300005577	Bacteria	6795
52	Ga0068854_100133003	3300005578	Bacteria	1901
53	Ga0068864_100020441	3300005618	Bacteria	5539
54	Ga0068863_100331962	3300005841	Bacteria	1478
55	Ga0068860_100009348	3300005843	Bacteria	9738
56	Ga0068862_100001149	3300005844	Bacteria	25094
57	Ga0081540_1015352	3300005983	Bacteria	4852
58	Ga0081539_10001256	3300005985	Bacteria	45022
59	Ga0081539_10087343	3300005985	Bacteria	1620
60	Ga0075365_10032328	3300006038	Bacteria	3362
61	Ga0075364_10035976	3300006051	Bacteria	3201
62	Ga0070716_100090654	3300006173	Viruses	1850
63	Ga0075431_100031186	3300006847	Bacteria	5490
64	Ga0075431_100173382	3300006847	Bacteria	2216
65	Ga0075429_100052172	3300006880	Bacteria	3558
66	Ga0079104_1000204	3300006946	Bacteria	82921
67	Ga0079104_1001489	3300006946	Bacteria	15601
68	Ga0079104_1007364	3300006946	Bacteria	4007
69	Ga0105251_10000251	3300009011	Bacteria	53888
70	Ga0105251_10000386	3300009011	Bacteria	43038
71	Ga0105251_10000533	3300009011	Bacteria	35947
72	Ga0105251_10001214	3300009011	Bacteria	22276
73	Ga0105251_10001714	3300009011	Bacteria	18353
74	Ga0105251_10001849	3300009011	Bacteria	17399
75	Ga0105251_10018008	3300009011	Bacteria	3769
76	Ga0105251_10036107	3300009011	Bacteria	2435
77	Ga0105251_10048751	3300009011	Bacteria	2029
78	Ga0105244_10000551	3300009036	Bacteria	33478
79	Ga0105244_10000566	3300009036	Bacteria	33080
80	Ga0105244_10005549	3300009036	Bacteria	8359
81	Ga0105244_10005895	3300009036	Bacteria	8042
82	Ga0105244_10020337	3300009036	Bacteria	3690
83	Ga0105244_10067329	3300009036	Bacteria	1791
84	Ga0105250_10000049	3300009092	Bacteria	121303
85	Ga0105250_10000070	3300009092	Bacteria	96227
86	Ga0105250_10004810	3300009092	Bacteria	6150
87	Ga0105250_10007980	3300009092	Bacteria	4518
88	Ga0105250_10019352	3300009092	Bacteria	2753
89	Ga0105240_10019390	3300009093	Bacteria	9087
90	Ga0105240_10062804	3300009093	Bacteria	4623
91	Ga0105247_10000462	3300009101	Bacteria	34066
92	Ga0105243_10057691	3300009148	Bacteria	3092
93	Ga0105241_10000010	3300009174	Bacteria	253836
94	Ga0105241_10002458	3300009174	Bacteria	13919
95	Ga0105237_10012940	3300009545	Bacteria	8763
96	Ga0105238_10018446	3300009551	Bacteria	7101
97	Ga0105238_10112872	3300009551	Bacteria	2697
98	Ga0105249_10033094	3300009553	Bacteria	4679
99	Ga0105239_10428361	3300010375	Bacteria	1499
100	Ga0105246_10008080	3300011119	Bacteria	6458
101	Ga0105246_10027557	3300011119	Bacteria	3724
102	Ga0157373_10000114	3300013100	Bacteria	63657
103	Ga0157373_10007292	3300013100	Bacteria	8237
104	Ga0157373_10015780	3300013100	Bacteria	5513
105	Ga0157373_10032858	3300013100	Bacteria	3734
106	Ga0157371_10000102	3300013102	Bacteria	129057
107	Ga0157371_10000554	3300013102	Bacteria	44435
108	Ga0157371_10000577	3300013102	Bacteria	43493
109	Ga0157371_10002937	3300013102	Bacteria	15903
110	Ga0157370_10000444	3300013104	Bacteria	51739
111	Ga0157370_10153869	3300013104	Bacteria	2140
112	Ga0157369_10006441	3300013105	Bacteria	13607
113	Ga0157369_10283711	3300013105	Bacteria	1724
114	Ga0157372_10000062	3300013307	Bacteria	119721
115	Ga0157372_10013953	3300013307	Bacteria	8585
116	Ga0157372_10016801	3300013307	Bacteria	7855
117	Ga0157372_10151690	3300013307	Bacteria	2675
118	Ga0182008_10001384	3300014497	Bacteria	16416
119	Ga0182008_10013615	3300014497	Bacteria	4275
120	Ga0182006_1028672	3300015261	Bacteria	2262
121	Ga0182007_10007880	3300015262	Bacteria	4421
122	Ga0163161_10000006	3300017792	Bacteria	302708
123	Ga0209760_100370	3300025207	Bacteria	11942
124	Ga0209784_100064	3300025224	Bacteria	158058
125	Ga0209566_100079	3300025225	Bacteria	158058
126	Ga0209674_100194	3300025226	Bacteria	65330
127	Ga0209563_100152	3300025230	Bacteria	65330
128	Ga0207427_100181	3300025231	Bacteria	65330
129	Ga0209437_100092	3300025233	Bacteria	240044
130	Ga0209437_100149	3300025233	Bacteria	158058
131	Ga0209677_100148	3300025253	Bacteria	65330
132	Ga0209129_1000021	3300025258	Bacteria	445018
133	Ga0209233_1001869	3300025261	Bacteria	8090
134	Ga0209673_1033129	3300025273	Bacteria	1581
135	Ga0209758_1061476	3300025297	Bacteria	1236
136	Ga0209051_1001488	3300025303	Bacteria	19623
137	Ga0209051_1017416	3300025303	Bacteria	3212
138	Ga0209257_1000022	3300025304	Bacteria	765258
139	Ga0207696_1000003	3300025711	Bacteria	860639
140	Ga0207696_1000038	3300025711	Bacteria	328221
141	Ga0207696_1000046	3300025711	Bacteria	291327
142	Ga0207696_1000146	3300025711	Bacteria	121312
143	Ga0207696_1000404	3300025711	Bacteria	40294
144	Ga0207696_1000534	3300025711	Bacteria	30992
145	Ga0207655_1000111	3300025728	Bacteria	170772
146	Ga0207655_1000208	3300025728	Bacteria	102775
147	Ga0207655_1001676	3300025728	Bacteria	19510
148	Ga0207655_1002700	3300025728	Bacteria	13913
149	Ga0207655_1004584	3300025728	Bacteria	9732
150	Ga0207655_1004934	3300025728	Bacteria	9255
151	Ga0207655_1018316	3300025728	Bacteria	3721
152	Ga0207713_1000002	3300025735	Bacteria	1061749
153	Ga0207713_1000035	3300025735	Bacteria	263228
154	Ga0207713_1000045	3300025735	Bacteria	235202
155	Ga0207713_1000056	3300025735	Bacteria	217615
156	Ga0207713_1000075	3300025735	Bacteria	179242
157	Ga0207713_1000613	3300025735	Bacteria	35114
158	Ga0207713_1014147	3300025735	Bacteria	4162
159	Ga0207713_1075954	3300025735	Bacteria	1224
160	Ga0207713_1080881	3300025735	Bacteria	1169
161	Ga0207710_10000024	3300025900	Bacteria	319633
162	Ga0207654_10000010	3300025911	Bacteria	304367
163	Ga0207707_10050167	3300025912	Bacteria	3636
164	Ga0207695_10192207	3300025913	Bacteria	1958
165	Ga0207660_10032045	3300025917	Bacteria	3625
166	Ga0207660_10115366	3300025917	Bacteria	2027
167	Ga0207694_10001920	3300025924	Bacteria	17241
168	Ga0207690_10048628	3300025932	Bacteria	2822
169	Ga0207706_10042594	3300025933	Bacteria	4024
170	Ga0207706_10087682	3300025933	Bacteria	2737
171	Ga0207665_10009713	3300025939	Bacteria	6317
172	Ga0207712_10010558	3300025961	Bacteria	5865
173	Ga0207678_10017231	3300026067	Bacteria	6342
174	Ga0207708_10036522	3300026075	Bacteria	3741
175	Ga0207648_10100254	3300026089	Bacteria	2537
176	Ga0207676_10008399	3300026095	Bacteria	7341
177	Ga0207674_10002390	3300026116	Bacteria	23728
178	Ga0207674_10172146	3300026116	Bacteria	2118
179	Ga0209281_1000139	3300027111	Bacteria	179588
180	Ga0209281_1000181	3300027111	Bacteria	146200
181	Ga0209371_1000027	3300027312	Bacteria	448853
182	Ga0209371_1000029	3300027312	Bacteria	424797
183	Ga0209371_1000063	3300027312	Bacteria	218863
184	Ga0209371_1000068	3300027312	Bacteria	209008
185	Ga0209371_1000260	3300027312	Bacteria	63961
186	Ga0209371_1000617	3300027312	Bacteria	31694
187	Ga0209371_1001252	3300027312	Bacteria	18113
188	Ga0209371_1001510	3300027312	Bacteria	15464
189	Ga0209371_1002324	3300027312	Bacteria	10815
190	Ga0209371_1006227	3300027312	Bacteria	4475
191	Ga0268266_10000110	3300028379	Bacteria	171840
192	Ga0268266_10036956	3300028379	Bacteria	4161
193	Ga0268266_10049425	3300028379	Bacteria	3607
194	Ga0268266_10389130	3300028379	Bacteria	1316
195	Ga0268264_10001287	3300028381	Bacteria	23683
196	Ga0307515_10000788	3300028794	Bacteria	72975
197	Ga0307515_10025749	3300028794	Bacteria	10161
198	Ga0265338_10004126	3300028800	Bacteria	19881
199	Ga0268256_1000032	3300030500	Bacteria	424603
200	Ga0268256_1000060	3300030500	Bacteria	218807
201	Ga0268256_1000064	3300030500	Bacteria	210320
202	Ga0268256_1000207	3300030500	Bacteria	66635
203	Ga0268256_1000386	3300030500	Bacteria	40664
204	Ga0268256_1001070	3300030500	Bacteria	18113
205	Ga0268256_1017498	3300030500	Bacteria	2016
206	Ga0268256_1025567	3300030500	Bacteria	1497
207	Ga0307511_10008029	3300030521	Bacteria	10581
208	Ga0265327_10031935	3300031251	Bacteria	2954
209	Ga0307513_10086474	3300031456	Bacteria	3213
210	Ga0307406_10108482	3300031901	Bacteria	1906
211	Ga0307412_10109536	3300031911	Bacteria	1969
212	Ga0307411_10153188	3300032005	Bacteria	1716
213	Ga0395899_0039264	3300037312	Bacteria	3544
214	Ga0395900_0127511	3300037418	Bacteria	2609
215	Ga0395900_0302137	3300037418	Bacteria	1586
216	Ga0395898_0025810	3300037466	Bacteria	5917
217	Ga0395905_0082749	3300037471	Bacteria	3007
218	Ga0395901_0028242	3300038443	Bacteria	5771
219	Ga0395901_0125526	3300038443	Bacteria	2697
220	Ga0436360_0707506	3300039438	Bacteria	2348
221	Ga0439438_000014	3300041405	Bacteria	130876
222	Ga0439447_002527	3300041407	Bacteria	6651
223	Ga0439466_0000008	3300041411	Bacteria	246721
224	Ga0439431_0021593	3300041997	Bacteria	1546
225	Ga0439432_004459	3300042006	Bacteria	5112
226	Ga0439432_010110	3300042006	Bacteria	3280
227	Ga0439449_0051093	3300042007	Bacteria	1529
228	Ga0439452_000012	3300042010	Bacteria	412478
229	Ga0439452_000023	3300042010	Bacteria	232427
230	Ga0439452_005798	3300042010	Bacteria	3942
231	Ga0439456_007791	3300042013	Bacteria	2204
232	Ga0439463_032091	3300042016	Bacteria	1327
233	Ga0450907_000030	3300042146	Bacteria	68375
234	Ga0439464_0028025	3300042439	Bacteria	1568
235	Ga0450893_0000721	3300042532	Bacteria	4824
236	Ga0451577_0006848	3300042876	Bacteria	11288
237	Ga0451577_0066937	3300042876	Bacteria	3203
238	Ga0453683_0003054	3300044673	Bacteria	12533
239	Ga0466966_0167943	3300044684	Bacteria	1334
240	Ga0466961_0145734	3300044693	Bacteria	1481
241	Ga0453684_0032029	3300044712	Bacteria	7371
242	Ga0466959_0114343	3300045049	Bacteria	1923
243	Ga0451576_0000487	3300045051	Bacteria	87753
244	Ga0451576_0011532	3300045051	Bacteria	10029
245	Ga0451576_0035817	3300045051	Bacteria	5263
246	Ga0495627_001403	3300046453	Bacteria	14254
247	Ga0495591_000763	3300046458	Bacteria	23259
248	Ga0495591_013497	3300046458	Bacteria	2983
249	Ga0495650_0000199	3300046471	Bacteria	130411
250	Ga0495650_0000204	3300046471	Bacteria	129303
251	Ga0495650_0034753	3300046471	Bacteria	2227
252	Ga0495605_0081541	3300046474	Bacteria	1512
253	Ga0495584_0007011	3300046491	Bacteria	5886
254	Ga0495606_0002305	3300046507	Bacteria	22488
255	Ga0495643_0012006	3300046522	Bacteria	5242
256	Ga0495643_0066194	3300046522	Bacteria	1906
257	Ga0495648_0002122	3300046524	Bacteria	18682
258	Ga0495648_0006999	3300046524	Bacteria	9088
259	Ga0495654_0000164	3300046530	Bacteria	65742
260	Ga0495654_0041084	3300046530	Bacteria	2302
261	Ga0495609_0058811	3300046538	Bacteria	1700
262	Ga0495625_0024045	3300046660	Bacteria	4644
263	Ga0495671_0003984	3300046692	Bacteria	8929
264	Ga0495649_0089711	3300046694	Bacteria	1639
265	Ga0495589_0000274	3300046794	Bacteria	42043
266	Ga0495589_0015703	3300046794	Bacteria	3892
267	Ga0495660_0000045	3300046810	Bacteria	150303
268	Ga0495660_0000048	3300046810	Bacteria	145350
269	Ga0495672_0000002	3300047320	Bacteria	740116
270	Ga0495672_0000083	3300047320	Bacteria	158118
271	Ga0495683_0027665	3300047323	Bacteria	2899
272	Ga0495687_019672	3300047443	Bacteria	3306
273	Ga0495679_002253	3300047446	Bacteria	9983
274	Ga0495673_0000984	3300047469	Bacteria	25529
275	Ga0496101_0000119	3300048904	Bacteria	77119
276	Ga0496102_0021045	3300048905	Bacteria	5767
277	Ga0496103_0030619	3300048906	Bacteria	3276
278	Ga0496103_0035485	3300048906	Bacteria	3053
279	Ga0496104_0001115	3300048907	Bacteria	22963
280	Ga0496104_0058671	3300048907	Bacteria	3643
281	Ga0496105_0003574	3300048908	Bacteria	11535
282	Ga0496105_0068676	3300048908	Bacteria	2928
283	Ga0496105_0089902	3300048908	Bacteria	2537
284	Ga0496105_0090120	3300048908	Bacteria	2533
285	Ga0496106_0014234	3300048909	Bacteria	5875
286	Ga0496107_0028524	3300048910	Bacteria	3967
287	Ga0496110_0048124	3300048913	Bacteria	3737
288	Ga0496116_0000058	3300048919	Bacteria	279767
289	Ga0496116_0000521	3300048919	Bacteria	51818
290	Ga0496116_0000739	3300048919	Bacteria	41626
291	Ga0496116_0007283	3300048919	Bacteria	9854
292	Ga0496116_0010783	3300048919	Bacteria	7627
293	Ga0496116_0023548	3300048919	Bacteria	4583
294	Ga0496117_0000450	3300048920	Bacteria	68428
295	Ga0496117_0000470	3300048920	Bacteria	66974
296	Ga0496117_0001133	3300048920	Bacteria	40208
297	Ga0496117_0001270	3300048920	Bacteria	37430
298	Ga0496117_0002029	3300048920	Bacteria	26833
299	Ga0496117_0011036	3300048920	Bacteria	8135
300	Ga0496117_0029090	3300048920	Bacteria	4266
301	Ga0496117_0120016	3300048920	Bacteria	1617
302	Ga0496117_0124151	3300048920	Bacteria	1579
303	Ga0496117_0237614	3300048920	Bacteria	1002
304	Ga0496118_0000490	3300048921	Bacteria	65592
305	Ga0496118_0002301	3300048921	Bacteria	25935
306	Ga0496118_0003957	3300048921	Bacteria	18111
307	Ga0496118_0004618	3300048921	Bacteria	16173
308	Ga0496118_0010354	3300048921	Bacteria	9239
309	Ga0496118_0010600	3300048921	Bacteria	9103
310	Ga0496118_0014091	3300048921	Bacteria	7502
311	Ga0496118_0042064	3300048921	Bacteria	3609
312	Ga0496118_0070993	3300048921	Bacteria	2510
313	Ga0496119_0000105	3300048922	Bacteria	119993
314	Ga0496119_0000219	3300048922	Bacteria	81203
315	Ga0496119_0000490	3300048922	Bacteria	53979
316	Ga0496119_0000706	3300048922	Bacteria	44781
317	Ga0496119_0000809	3300048922	Bacteria	41835
318	Ga0496119_0006097	3300048922	Bacteria	11294
319	Ga0496119_0008481	3300048922	Bacteria	9019
320	Ga0496120_0000108	3300048923	Bacteria	138566
321	Ga0496120_0000301	3300048923	Bacteria	82406
322	Ga0496120_0000476	3300048923	Bacteria	62924
323	Ga0496120_0000813	3300048923	Bacteria	44710
324	Ga0496120_0000834	3300048923	Bacteria	43973
325	Ga0496120_0002481	3300048923	Bacteria	18567
326	Ga0496120_0002528	3300048923	Bacteria	18270
327	Ga0496120_0075973	3300048923	Bacteria	1832
328	Ga0496121_0000074	3300048924	Bacteria	243022
329	Ga0496122_0000607	3300048925	Bacteria	73586
330	Ga0496122_0002360	3300048925	Bacteria	27157
331	Ga0496122_0069387	3300048925	Bacteria	2524
332	Ga0496122_0073484	3300048925	Bacteria	2424
333	Ga0496123_0000451	3300048926	Bacteria	73603
334	Ga0496123_0002061	3300048926	Bacteria	25933
335	Ga0496123_0005805	3300048926	Bacteria	12254
336	Ga0496123_0093954	3300048926	Bacteria	1769
337	Ga0496124_0000583	3300048927	Bacteria	61571
338	Ga0496124_0000783	3300048927	Bacteria	51875
339	Ga0496124_0011200	3300048927	Bacteria	8990
340	Ga0496124_0012675	3300048927	Bacteria	8291
341	Ga0496124_0014970	3300048927	Bacteria	7467
342	Ga0496124_0016173	3300048927	Bacteria	7113
343	Ga0496124_0028053	3300048927	Bacteria	5039
344	Ga0496124_0112660	3300048927	Bacteria	2187
345	Ga0496125_0000016	3300048928	Bacteria	512512
346	Ga0496125_0000563	3300048928	Bacteria	63847
347	Ga0496125_0002298	3300048928	Bacteria	25235
348	Ga0496125_0009976	3300048928	Bacteria	9654
349	Ga0496126_0000648	3300048929	Bacteria	64533
350	Ga0496126_0044290	3300048929	Bacteria	4099
351	Ga0496126_0056746	3300048929	Bacteria	3538
352	Ga0496126_0093056	3300048929	Bacteria	2647
353	Ga0496126_0157902	3300048929	Bacteria	1940
354	Ga0495678_000354	3300049459	Bacteria	47217
355	Ga0495682_0000001	3300049460	Bacteria	1559116
356	Ga0501031_0022249	3300049568	Bacteria	4131
357	Ga0501032_0002509	3300049569	Bacteria	14338
358	Ga0501033_0001349	3300049570	Bacteria	21856
359	Ga0501033_0149121	3300049570	Bacteria	1688
360	Ga0501034_0071302	3300049571	Bacteria	3484
361	Ga0501036_0072359	3300049572	Bacteria	2914
362	Ga0501036_0294458	3300049572	Bacteria	1358
363	Ga0501037_0000934	3300049573	Bacteria	21711
364	Ga0501038_0279426	3300049574	Bacteria	1315
365	Ga0501041_0097369	3300049577	Bacteria	1819
366	Ga0501043_0000265	3300049579	Bacteria	47653
367	Ga0501047_0030561	3300049581	Bacteria	5192
368	Ga0501047_0063139	3300049581	Bacteria	3573
369	Ga0501047_0403850	3300049581	Bacteria	1199
370	Ga0501067_0011579	3300049583	Bacteria	4886
371	Ga0501069_0000088	3300049585	Bacteria	44197
372	Ga0501069_0072222	3300049585	Bacteria	1935
373	Ga0501069_0216758	3300049585	Bacteria	1112
374	Ga0501070_0001479	3300049586	Bacteria	21034
375	Ga0501070_0033989	3300049586	Bacteria	4265
376	Ga0501071_0005876	3300049587	Bacteria	7933
377	Ga0501073_0009054	3300049589	Bacteria	7350
378	Ga0501074_0000006	3300049590	Bacteria	112293
379	Ga0501074_0165477	3300049590	Bacteria	1579
380	Ga0501075_0111809	3300049591	Bacteria	2077
381	Ga0501077_0084773	3300049593	Bacteria	2008
382	Ga0501079_0072699	3300049741	Bacteria	2658
383	Ga0501079_0242231	3300049741	Bacteria	1409
384	Ga0501080_0000354	3300049742	Bacteria	35302
385	Ga0501080_0220218	3300049742	Bacteria	1737
386	Ga0501081_0013294	3300049743	Bacteria	5415
387	Ga0501081_0185917	3300049743	Bacteria	1504
388	Ga0501083_0001759	3300049744	Bacteria	14784
389	Ga0501035_0000011	3300049822	Bacteria	305794
390	Ga0501035_0141737	3300049822	Bacteria	2089
391	Ga0501044_0000333	3300049823	Bacteria	59546
392	Ga0501044_0028003	3300049823	Bacteria	5947
393	nmdc:mga00v17_1545_c1	3300050491	Bacteria	7021
394	nmdc:mga00v17_30347_c1	3300050491	Bacteria	3180
395	nmdc:mga0yw44_44784_c1	3300050492	Bacteria	2649
396	nmdc:mga09592_28004_c1	3300050508	Bacteria	4678
397	nmdc:mga06r32_12011_c1	3300050510	Bacteria	7805
398	nmdc:mga06r32_4406_c1	3300050510	Bacteria	12592
399	Ga0500569_006712	3300053109	Bacteria	2543
400	Ga0500595_003571	3300053119	Bacteria	7225
401	Ga0500621_000003	3300053126	Bacteria	596975
402	Ga0500559_0020474	3300053136	Bacteria	2797
403	Ga0501084_0038056	3300054114	Bacteria	4021
404	Ga0501084_0322683	3300054114	Bacteria	1304
405	Ga0501084_0397277	3300054114	Bacteria	1165
406	Ga0501082_0009871	3300060353	Bacteria	8225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300054114	Ga0501084_0397277	Ga0501084_0397277_38_913	291
2	iso_pu_bacteria	2889016732	2889018057	308
3	3300049581	Ga0501047_0403850	Ga0501047_0403850_10_948	311
4	3300048920	Ga0496117_0002029	Ga0496117_0002029_25851_26795	314
5	3300048920	Ga0496117_0124151	Ga0496117_0124151_42_986	314
6	3300048920	Ga0496117_0237614	Ga0496117_0237614_42_986	314
7	3300044673	Ga0453683_0003054	Ga0453683_0003054_2607_3593	316
8	3300045051	Ga0451576_0011532	Ga0451576_0011532_25_1011	316
9	iso_pu_bacteria	2906354277	2906354709	316
10	3300009093	Ga0105240_10019390	Ga0105240_100193908	318
11	3300025913	Ga0207695_10192207	Ga0207695_101922072	318
12	3300005548	Ga0070665_100000449	Ga0070665_1000004499	323
13	3300028379	Ga0268266_10000110	Ga0268266_1000011021	323
14	3300049574	Ga0501038_0279426	Ga0501038_0279426_37_1011	323
15	3300053119	Ga0500595_003571	Ga0500595_003571_291_1370	323
16	3300009551	Ga0105238_10112872	Ga0105238_101128722	324
17	3300028379	Ga0268266_10036956	Ga0268266_100369563	324
18	3300005548	Ga0070665_100136994	Ga0070665_1001369943	325
19	3300025273	Ga0209673_1033129	Ga0209673_10331292	325
20	3300028379	Ga0268266_10389130	Ga0268266_103891302	325
21	3300046660	Ga0495625_0024045	Ga0495625_0024045_3372_4436	326
22	3300005340	Ga0070689_100176343	Ga0070689_1001763431	327
23	3300005341	Ga0070691_10014257	Ga0070691_100142572	327
24	3300005406	Ga0070703_10002437	Ga0070703_100024373	327
25	3300005438	Ga0070701_10022828	Ga0070701_100228282	327
26	3300005440	Ga0070705_100000099	Ga0070705_1000000993	327
27	3300005441	Ga0070700_100001390	Ga0070700_10000139010	327
28	3300005444	Ga0070694_100016461	Ga0070694_1000164614	327
29	3300005445	Ga0070708_100029816	Ga0070708_1000298163	327
30	3300005457	Ga0070662_100033556	Ga0070662_1000335562	327
31	3300005458	Ga0070681_10074931	Ga0070681_100749312	327
32	3300005471	Ga0070698_100353996	Ga0070698_1003539962	327
33	3300005518	Ga0070699_100015987	Ga0070699_1000159873	327
34	3300005545	Ga0070695_100000415	Ga0070695_10000041520	327
35	3300005546	Ga0070696_100000612	Ga0070696_10000061221	327
36	3300005547	Ga0070693_100037933	Ga0070693_1000379333	327
37	3300005549	Ga0070704_100002687	Ga0070704_1000026878	327
38	3300005577	Ga0068857_100014837	Ga0068857_1000148373	327
39	3300005618	Ga0068864_100020441	Ga0068864_1000204414	327
40	3300005841	Ga0068863_100331962	Ga0068863_1003319622	327
41	3300005843	Ga0068860_100009348	Ga0068860_1000093488	327
42	3300005844	Ga0068862_100001149	Ga0068862_1000011493	327
43	3300009553	Ga0105249_10033094	Ga0105249_100330943	327
44	3300025912	Ga0207707_10050167	Ga0207707_100501672	327
45	3300025917	Ga0207660_10032045	Ga0207660_100320452	327
46	3300025933	Ga0207706_10042594	Ga0207706_100425943	327
47	3300025961	Ga0207712_10010558	Ga0207712_100105585	327
48	3300026067	Ga0207678_10017231	Ga0207678_100172314	327
49	3300026075	Ga0207708_10036522	Ga0207708_100365222	327
50	3300026095	Ga0207676_10008399	Ga0207676_100083997	327
51	3300026116	Ga0207674_10002390	Ga0207674_1000239022	327
52	3300028381	Ga0268264_10001287	Ga0268264_100012873	327
53	3300048905	Ga0496102_0021045	Ga0496102_0021045_2644_3726	327
54	3300048906	Ga0496103_0030619	Ga0496103_0030619_187_1269	327
55	3300048909	Ga0496106_0014234	Ga0496106_0014234_1916_2998	327
56	3300048910	Ga0496107_0028524	Ga0496107_0028524_430_1512	327
57	3300003792	Ga0055540_1006571	Ga0055540_10065712	328
58	3300003794	Ga0055531_10001041	Ga0055531_100010412	328
59	3300025303	Ga0209051_1001488	Ga0209051_100148811	328
60	3300025304	Ga0209257_1000022	Ga0209257_100002290	328
61	3300049585	Ga0501069_0216758	Ga0501069_0216758_33_1025	330
62	3300049591	Ga0501075_0111809	Ga0501075_0111809_223_1215	330
63	3300054114	Ga0501084_0322683	Ga0501084_0322683_302_1294	330
64	3300039438	Ga0436360_0707506	Ga0436360_0707506_1005_2057	331
65	3300049570	Ga0501033_0149121	Ga0501033_0149121_676_1674	331
66	3300049741	Ga0501079_0072699	Ga0501079_0072699_1533_2531	331
67	3300009093	Ga0105240_10062804	Ga0105240_100628046	332
68	3300048929	Ga0496126_0044290	Ga0496126_0044290_1464_2534	332
69	3300045049	Ga0466959_0114343	Ga0466959_0114343_125_1216	333
70	3300048921	Ga0496118_0003957	Ga0496118_0003957_12642_13643	333
71	3300028794	Ga0307515_10025749	Ga0307515_100257495	334
72	3300028800	Ga0265338_10004126	Ga0265338_1000412610	334
73	3300045051	Ga0451576_0035817	Ga0451576_0035817_2401_3465	334
74	3300031901	Ga0307406_10108482	Ga0307406_101084821	335
75	iso_pu_bacteria	2643221607	2644050598	335
76	iso_pu_bacteria	2643221636	2644205072	335
77	iso_pu_bacteria	2643221686	2644483516	335
78	iso_pu_bacteria	2643221689	2644499723	335
79	3300025297	Ga0209758_1061476	Ga0209758_10614761	336
80	3300028794	Ga0307515_10000788	Ga0307515_1000078826	336
81	3300031456	Ga0307513_10086474	Ga0307513_100864743	336
82	3300003203	JGI25406J46586_10000723	JGI25406J46586_1000072318	337
83	3300005985	Ga0081539_10001256	Ga0081539_1000125618	337
84	3300032005	Ga0307411_10153188	Ga0307411_101531882	337
85	3300042876	Ga0451577_0006848	Ga0451577_0006848_7498_8580	337
86	3300044684	Ga0466966_0167943	Ga0466966_0167943_172_1263	337
87	3300044693	Ga0466961_0145734	Ga0466961_0145734_120_1211	337
88	3300044712	Ga0453684_0032029	Ga0453684_0032029_5311_6393	337
89	3300048919	Ga0496116_0010783	Ga0496116_0010783_2950_3972	337
90	3300048922	Ga0496119_0008481	Ga0496119_0008481_360_1382	337
91	3300048923	Ga0496120_0000476	Ga0496120_0000476_33010_34032	337
92	3300048927	Ga0496124_0014970	Ga0496124_0014970_5773_6795	337
93	iso_pu_bacteria	2865014394	2865018711	338
94	3300009011	Ga0105251_10000251	Ga0105251_100002516	339
95	3300009092	Ga0105250_10000070	Ga0105250_1000007070	339
96	3300009148	Ga0105243_10057691	Ga0105243_100576912	339
97	3300013105	Ga0157369_10283711	Ga0157369_102837111	339
98	3300037466	Ga0395898_0025810	Ga0395898_0025810_1205_2293	339
99	3300038443	Ga0395901_0028242	Ga0395901_0028242_4288_5376	339
100	3300048927	Ga0496124_0112660	Ga0496124_0112660_1031_2053	339
101	3300048929	Ga0496126_0056746	Ga0496126_0056746_473_1495	339
102	3300030521	Ga0307511_10008029	Ga0307511_100080295	340
103	iso_pu_bacteria	2854601825	2854603344	340
104	3300009551	Ga0105238_10018446	Ga0105238_100184465	341
105	3300025924	Ga0207694_10001920	Ga0207694_1000192013	341
106	iso_pu_bacteria	2904504865	2904509482	341
107	iso_pu_bacteria	2939573065	2939574634	341
108	3300005578	Ga0068854_100133003	Ga0068854_1001330032	342
109	3300042006	Ga0439432_010110	Ga0439432_010110_2231_3268	342
110	iso_pu_bacteria	2842775625	2842778530	342
111	3300037418	Ga0395900_0302137	Ga0395900_0302137_300_1388	343
112	3300037471	Ga0395905_0082749	Ga0395905_0082749_778_1866	343
113	iso_pu_bacteria	2511231025	2511380455	343
114	iso_pu_bacteria	2511231035	2511435565	343
115	iso_pu_bacteria	2585427591	2585829007	343
116	iso_pu_bacteria	2585427592	2585833778	343
117	iso_pu_bacteria	2599185299	2599925167	343
118	iso_pu_bacteria	2608642108	2608671367	343
119	iso_pu_bacteria	2648501693	2650897270	343
120	iso_pu_bacteria	2684622997	2686356240	343
121	iso_pu_bacteria	2808606414	2809126593	343
122	iso_pu_bacteria	2844528606	2844531903	343
123	iso_pu_bacteria	2847797336	2847801902	343
124	iso_pu_bacteria	2876601092	2876603395	343
125	iso_pu_bacteria	2908669403	2908674561	343
126	iso_pu_bacteria	2939602548	2939605094	343
127	iso_pu_bacteria	2945951305	2945954784	343
128	iso_pu_bacteria	2978975091	2978977273	343
129	iso_pu_bacteria	2984494565	2984498666	343
130	iso_pu_bacteria	2990261002	2990264129	343
131	iso_pu_bacteria	8016733728	8016737736	343
132	iso_pu_bacteria	8019499862	8019503562	343
133	3300005563	Ga0068855_100073715	Ga0068855_1000737152	344
134	3300037418	Ga0395900_0127511	Ga0395900_0127511_635_1708	344
135	3300038443	Ga0395901_0125526	Ga0395901_0125526_208_1281	344
136	3300041997	Ga0439431_0021593	Ga0439431_0021593_287_1387	344
137	3300053109	Ga0500569_006712	Ga0500569_006712_1151_2272	344
138	3300053136	Ga0500559_0020474	Ga0500559_0020474_1489_2568	344
139	iso_pu_bacteria	2513237159	2513996882	344
140	iso_pu_bacteria	2582581283	2585166270	344
141	iso_pu_bacteria	2582581306	2585267522	344
142	iso_pu_bacteria	2582581865	2585386584	344
143	iso_pu_bacteria	2582581866	2585393178	344
144	iso_pu_bacteria	2842521101	2842522879	344
145	3300001989	JGI24739J22299_10000016	JGI24739J22299_1000001613	345
146	3300003856	Ga0058692_1000145	Ga0058692_10001459	345
147	3300003856	Ga0058692_1000179	Ga0058692_100017928	345
148	3300003856	Ga0058692_1002280	Ga0058692_10022805	345
149	3300005457	Ga0070662_100001198	Ga0070662_10000119810	345
150	3300006847	Ga0075431_100173382	Ga0075431_1001733822	345
151	3300006880	Ga0075429_100052172	Ga0075429_1000521722	345
152	3300009011	Ga0105251_10000533	Ga0105251_100005331	345
153	3300009011	Ga0105251_10018008	Ga0105251_100180083	345
154	3300009011	Ga0105251_10036107	Ga0105251_100361072	345
155	3300009011	Ga0105251_10048751	Ga0105251_100487512	345
156	3300009036	Ga0105244_10000551	Ga0105244_1000055120	345
157	3300009036	Ga0105244_10005549	Ga0105244_100055492	345
158	3300009036	Ga0105244_10005895	Ga0105244_100058958	345
159	3300009036	Ga0105244_10067329	Ga0105244_100673291	345
160	3300009092	Ga0105250_10007980	Ga0105250_100079804	345
161	3300009545	Ga0105237_10012940	Ga0105237_100129407	345
162	3300011119	Ga0105246_10008080	Ga0105246_100080805	345
163	3300011119	Ga0105246_10027557	Ga0105246_100275572	345
164	3300013100	Ga0157373_10000114	Ga0157373_1000011442	345
165	3300013102	Ga0157371_10000554	Ga0157371_1000055413	345
166	3300013102	Ga0157371_10000577	Ga0157371_1000057734	345
167	3300013104	Ga0157370_10000444	Ga0157370_1000044415	345
168	3300013307	Ga0157372_10016801	Ga0157372_100168017	345
169	3300013307	Ga0157372_10151690	Ga0157372_101516903	345
170	3300014497	Ga0182008_10013615	Ga0182008_100136153	345
171	3300015261	Ga0182006_1028672	Ga0182006_10286723	345
172	3300015262	Ga0182007_10007880	Ga0182007_100078803	345
173	3300025233	Ga0209437_100092	Ga0209437_100092180	345
174	3300025711	Ga0207696_1000003	Ga0207696_1000003577	345
175	3300025711	Ga0207696_1000146	Ga0207696_100014654	345
176	3300025711	Ga0207696_1000404	Ga0207696_10004043	345
177	3300025728	Ga0207655_1000111	Ga0207655_100011133	345
178	3300025728	Ga0207655_1002700	Ga0207655_10027009	345
179	3300025728	Ga0207655_1004584	Ga0207655_10045843	345
180	3300025728	Ga0207655_1004934	Ga0207655_10049345	345
181	3300025728	Ga0207655_1018316	Ga0207655_10183162	345
182	3300025735	Ga0207713_1000045	Ga0207713_1000045177	345
183	3300025735	Ga0207713_1014147	Ga0207713_10141472	345
184	3300025735	Ga0207713_1075954	Ga0207713_10759541	345
185	3300025735	Ga0207713_1080881	Ga0207713_10808811	345
186	3300027312	Ga0209371_1000063	Ga0209371_100006335	345
187	3300027312	Ga0209371_1000068	Ga0209371_100006834	345
188	3300027312	Ga0209371_1000617	Ga0209371_10006172	345
189	3300027312	Ga0209371_1001510	Ga0209371_10015108	345
190	3300027312	Ga0209371_1002324	Ga0209371_10023247	345
191	3300028379	Ga0268266_10049425	Ga0268266_100494252	345
192	3300030500	Ga0268256_1000060	Ga0268256_1000060149	345
193	3300030500	Ga0268256_1000064	Ga0268256_1000064157	345
194	3300030500	Ga0268256_1000386	Ga0268256_10003869	345
195	3300030500	Ga0268256_1017498	Ga0268256_10174982	345
196	3300041407	Ga0439447_002527	Ga0439447_002527_1006_2058	345
197	3300041411	Ga0439466_0000008	Ga0439466_0000008_208056_209108	345
198	3300042007	Ga0439449_0051093	Ga0439449_0051093_143_1195	345
199	3300042010	Ga0439452_000023	Ga0439452_000023_35628_36680	345
200	3300042010	Ga0439452_005798	Ga0439452_005798_2550_3602	345
201	3300042016	Ga0439463_032091	Ga0439463_032091_256_1308	345
202	3300042146	Ga0450907_000030	Ga0450907_000030_37769_38821	345
203	3300042439	Ga0439464_0028025	Ga0439464_0028025_109_1161	345
204	3300042876	Ga0451577_0066937	Ga0451577_0066937_154_1221	345
205	3300045051	Ga0451576_0000487	Ga0451576_0000487_62131_63198	345
206	3300046458	Ga0495591_013497	Ga0495591_013497_591_1643	345
207	3300046522	Ga0495643_0012006	Ga0495643_0012006_2845_3897	345
208	3300046524	Ga0495648_0002122	Ga0495648_0002122_8787_9839	345
209	3300047320	Ga0495672_0000083	Ga0495672_0000083_119191_120243	345
210	3300047446	Ga0495679_002253	Ga0495679_002253_8666_9718	345
211	3300048904	Ga0496101_0000119	Ga0496101_0000119_39585_40637	345
212	3300048908	Ga0496105_0003574	Ga0496105_0003574_1344_2396	345
213	3300048908	Ga0496105_0068676	Ga0496105_0068676_221_1273	345
214	3300048913	Ga0496110_0048124	Ga0496110_0048124_160_1212	345
215	3300048919	Ga0496116_0000521	Ga0496116_0000521_15098_16150	345
216	3300048919	Ga0496116_0007283	Ga0496116_0007283_3205_4257	345
217	3300048919	Ga0496116_0023548	Ga0496116_0023548_1855_2913	345
218	3300048920	Ga0496117_0000470	Ga0496117_0000470_29010_30068	345
219	3300048920	Ga0496117_0001133	Ga0496117_0001133_22461_23513	345
220	3300048920	Ga0496117_0001270	Ga0496117_0001270_21637_22689	345
221	3300048920	Ga0496117_0029090	Ga0496117_0029090_3170_4222	345
222	3300048921	Ga0496118_0000490	Ga0496118_0000490_36907_37965	345
223	3300048921	Ga0496118_0002301	Ga0496118_0002301_9287_10339	345
224	3300048921	Ga0496118_0014091	Ga0496118_0014091_1103_2155	345
225	3300048921	Ga0496118_0070993	Ga0496118_0070993_713_1765	345
226	3300048922	Ga0496119_0000219	Ga0496119_0000219_33154_34197	345
227	3300048922	Ga0496119_0000490	Ga0496119_0000490_15298_16350	345
228	3300048922	Ga0496119_0000706	Ga0496119_0000706_37703_38755	345
229	3300048923	Ga0496120_0000108	Ga0496120_0000108_37878_38930	345
230	3300048923	Ga0496120_0000301	Ga0496120_0000301_33154_34197	345
231	3300048923	Ga0496120_0000813	Ga0496120_0000813_6029_7081	345
232	3300048923	Ga0496120_0002481	Ga0496120_0002481_15662_16714	345
233	3300048924	Ga0496121_0000074	Ga0496121_0000074_37825_38877	345
234	3300048925	Ga0496122_0002360	Ga0496122_0002360_18039_19091	345
235	3300048925	Ga0496122_0069387	Ga0496122_0069387_764_1810	345
236	3300048926	Ga0496123_0002061	Ga0496123_0002061_11791_12849	345
237	3300048926	Ga0496123_0005805	Ga0496123_0005805_7175_8227	345
238	3300048926	Ga0496123_0093954	Ga0496123_0093954_506_1552	345
239	3300048927	Ga0496124_0011200	Ga0496124_0011200_1372_2424	345
240	3300048927	Ga0496124_0012675	Ga0496124_0012675_1211_2263	345
241	3300048927	Ga0496124_0016173	Ga0496124_0016173_5589_6635	345
242	3300048927	Ga0496124_0028053	Ga0496124_0028053_1618_2670	345
243	3300048928	Ga0496125_0000016	Ga0496125_0000016_218125_219171	345
244	3300048928	Ga0496125_0002298	Ga0496125_0002298_15155_16207	345
245	3300050491	nmdc:mga00v17_1545_c1	nmdc:mga00v17_1545_c1_2022_3080	345
246	3300050508	nmdc:mga09592_28004_c1	nmdc:mga09592_28004_c1_1208_2287	345
247	3300050510	nmdc:mga06r32_12011_c1	nmdc:mga06r32_12011_c1_661_1740	345
248	iso_pu_bacteria	2506520007	2506576161	345
249	iso_pu_bacteria	2506520008	2506581299	345
250	iso_pu_bacteria	2508501071	2508850130	345
251	iso_pu_bacteria	2537561728	2538425106	345
252	iso_pu_bacteria	2599185169	2599409756	345
253	iso_pu_bacteria	2600255254	2601521750	345
254	iso_pu_bacteria	2600255255	2601526775	345
255	iso_pu_bacteria	2600255280	2601613605	345
256	iso_pu_bacteria	2600255281	2601618328	345
257	iso_pu_bacteria	2600255287	2601643045	345
258	iso_pu_bacteria	2600255288	2601647915	345
259	iso_pu_bacteria	2600255289	2601651753	345
260	iso_pu_bacteria	2600255290	2601657080	345
261	iso_pu_bacteria	2600255291	2601662866	345
262	iso_pu_bacteria	2600255298	2601695825	345
263	iso_pu_bacteria	2600255299	2601700499	345
264	iso_pu_bacteria	2600255300	2601704877	345
265	iso_pu_bacteria	2600255301	2601709906	345
266	iso_pu_bacteria	2600255302	2601714918	345
267	iso_pu_bacteria	2600255303	2601720850	345
268	iso_pu_bacteria	2600255304	2601725324	345
269	iso_pu_bacteria	2600255305	2601729866	345
270	iso_pu_bacteria	2600255306	2601734883	345
271	iso_pu_bacteria	2600255307	2601739568	345
272	iso_pu_bacteria	2600255309	2601750057	345
273	iso_pu_bacteria	2600255392	2602017310	345
274	iso_pu_bacteria	2602042052	2603660241	345
275	iso_pu_bacteria	2602042053	2603665516	345
276	iso_pu_bacteria	2602042103	2603837245	345
277	iso_pu_bacteria	2602042104	2603842321	345
278	iso_pu_bacteria	2602042105	2603847394	345
279	iso_pu_bacteria	2602042106	2603852465	345
280	iso_pu_bacteria	2602042109	2603864332	345
281	iso_pu_bacteria	2602042110	2603870519	345
282	iso_pu_bacteria	2602042111	2603875457	345
283	iso_pu_bacteria	2603880178	2606047709	345
284	iso_pu_bacteria	2603880184	2606069947	345
285	iso_pu_bacteria	2603880202	2606145786	345
286	iso_pu_bacteria	2603880211	2606175111	345
287	iso_pu_bacteria	2636415599	2637225694	345
288	iso_pu_bacteria	2654587920	2656277219	345
289	iso_pu_bacteria	2675903046	2676406905	345
290	iso_pu_bacteria	2687453601	2689442592	345
291	iso_pu_bacteria	2706794495	2707100903	345
292	iso_pu_bacteria	2775507074	2777023543	345
293	iso_pu_bacteria	2806310673	2807179020	345
294	iso_pu_bacteria	2842694124	2842695083	345
295	iso_pu_bacteria	2855195626	2855199032	345
296	iso_pu_bacteria	2858466076	2858466797	345
297	iso_pu_bacteria	2869551831	2869552006	345
298	iso_pu_bacteria	2871272651	2871274962	345
299	iso_pu_bacteria	2871282230	2871282482	345
300	iso_pu_bacteria	2888373701	2888375577	345
301	iso_pu_bacteria	2904513164	2904513451	345
302	iso_pu_bacteria	2932406140	2932409050	345
303	iso_pu_bacteria	2939577877	2939581646	345
304	iso_pu_bacteria	2969079654	2969082681	345
305	iso_pu_bacteria	2984559226	2984559755	345
306	iso_pu_bacteria	2984595703	2984597837	345
307	iso_pu_bacteria	640753048	640935680	345
308	3300002737	JGI25162J39368_1000187	JGI25162J39368_100018752	346
309	3300002771	JGI25163J39215_1000498	JGI25163J39215_10004983	346
310	3300002772	JGI25164J39214_1000152	JGI25164J39214_100015212	346
311	3300003323	rootH1_10039424	rootH1_100394247	346
312	3300003751	Ga0055538_1000109	Ga0055538_100010912	346
313	3300003752	Ga0055539_1000158	Ga0055539_100015852	346
314	3300003756	Ga0055533_1000160	Ga0055533_100016052	346
315	3300003759	Ga0055525_1000212	Ga0055525_100021252	346
316	3300003841	Ga0055541_1000104	Ga0055541_100010452	346
317	3300005289	Ga0065704_10000450	Ga0065704_1000045037	346
318	3300005985	Ga0081539_10087343	Ga0081539_100873431	346
319	3300006847	Ga0075431_100031186	Ga0075431_1000311866	346
320	3300009036	Ga0105244_10020337	Ga0105244_100203374	346
321	3300009092	Ga0105250_10000049	Ga0105250_1000004955	346
322	3300009092	Ga0105250_10004810	Ga0105250_100048105	346
323	3300013100	Ga0157373_10007292	Ga0157373_100072925	346
324	3300013102	Ga0157371_10000102	Ga0157371_1000010253	346
325	3300013102	Ga0157371_10002937	Ga0157371_1000293713	346
326	3300025207	Ga0209760_100370	Ga0209760_1003703	346
327	3300025224	Ga0209784_100064	Ga0209784_10006496	346
328	3300025225	Ga0209566_100079	Ga0209566_10007996	346
329	3300025226	Ga0209674_100194	Ga0209674_10019452	346
330	3300025230	Ga0209563_100152	Ga0209563_10015252	346
331	3300025231	Ga0207427_100181	Ga0207427_10018152	346
332	3300025233	Ga0209437_100149	Ga0209437_10014996	346
333	3300025253	Ga0209677_100148	Ga0209677_10014813	346
334	3300025261	Ga0209233_1001869	Ga0209233_10018692	346
335	3300025711	Ga0207696_1000534	Ga0207696_100053424	346
336	3300025728	Ga0207655_1001676	Ga0207655_10016767	346
337	3300037312	Ga0395899_0039264	Ga0395899_0039264_2253_3368	346
338	3300041405	Ga0439438_000014	Ga0439438_000014_35954_37003	346
339	3300042006	Ga0439432_004459	Ga0439432_004459_2066_3115	346
340	3300042013	Ga0439456_007791	Ga0439456_007791_209_1276	346
341	3300042532	Ga0450893_0000721	Ga0450893_0000721_3593_4660	346
342	3300046471	Ga0495650_0000199	Ga0495650_0000199_29288_30355	346
343	3300046471	Ga0495650_0034753	Ga0495650_0034753_637_1686	346
344	3300046538	Ga0495609_0058811	Ga0495609_0058811_115_1182	346
345	3300046810	Ga0495660_0000045	Ga0495660_0000045_55363_56430	346
346	3300048907	Ga0496104_0001115	Ga0496104_0001115_21876_22937	346
347	3300048907	Ga0496104_0058671	Ga0496104_0058671_2377_3441	346
348	3300048908	Ga0496105_0090120	Ga0496105_0090120_145_1209	346
349	3300048919	Ga0496116_0000739	Ga0496116_0000739_29408_30475	346
350	3300048920	Ga0496117_0011036	Ga0496117_0011036_6795_7862	346
351	3300048921	Ga0496118_0010354	Ga0496118_0010354_7899_8966	346
352	3300048921	Ga0496118_0010600	Ga0496118_0010600_7034_8101	346
353	3300048921	Ga0496118_0042064	Ga0496118_0042064_2209_3258	346
354	3300048922	Ga0496119_0000809	Ga0496119_0000809_35047_36111	346
355	3300048922	Ga0496119_0006097	Ga0496119_0006097_8660_9727	346
356	3300048923	Ga0496120_0000834	Ga0496120_0000834_5961_7025	346
357	3300048923	Ga0496120_0002528	Ga0496120_0002528_8553_9620	346
358	3300048925	Ga0496122_0000607	Ga0496122_0000607_29255_30322	346
359	3300048925	Ga0496122_0073484	Ga0496122_0073484_896_1960	346
360	3300048926	Ga0496123_0000451	Ga0496123_0000451_29272_30339	346
361	3300048927	Ga0496124_0000583	Ga0496124_0000583_5369_6436	346
362	3300048928	Ga0496125_0000563	Ga0496125_0000563_55363_56430	346
363	3300048929	Ga0496126_0000648	Ga0496126_0000648_7925_8992	346
364	3300048929	Ga0496126_0157902	Ga0496126_0157902_326_1390	346
365	3300049568	Ga0501031_0022249	Ga0501031_0022249_1297_2382	346
366	3300049569	Ga0501032_0002509	Ga0501032_0002509_9869_10954	346
367	3300049570	Ga0501033_0001349	Ga0501033_0001349_12343_13428	346
368	3300049571	Ga0501034_0071302	Ga0501034_0071302_1700_2800	346
369	3300049572	Ga0501036_0072359	Ga0501036_0072359_385_1470	346
370	3300049572	Ga0501036_0294458	Ga0501036_0294458_163_1248	346
371	3300049573	Ga0501037_0000934	Ga0501037_0000934_1833_2918	346
372	3300049577	Ga0501041_0097369	Ga0501041_0097369_466_1551	346
373	3300049579	Ga0501043_0000265	Ga0501043_0000265_33367_34452	346
374	3300049581	Ga0501047_0030561	Ga0501047_0030561_971_2056	346
375	3300049581	Ga0501047_0063139	Ga0501047_0063139_190_1275	346
376	3300049583	Ga0501067_0011579	Ga0501067_0011579_841_1926	346
377	3300049585	Ga0501069_0000088	Ga0501069_0000088_13083_14168	346
378	3300049585	Ga0501069_0072222	Ga0501069_0072222_491_1576	346
379	3300049586	Ga0501070_0001479	Ga0501070_0001479_13122_14207	346
380	3300049586	Ga0501070_0033989	Ga0501070_0033989_1061_2146	346
381	3300049587	Ga0501071_0005876	Ga0501071_0005876_4158_5243	346
382	3300049589	Ga0501073_0009054	Ga0501073_0009054_2768_3853	346
383	3300049590	Ga0501074_0000006	Ga0501074_0000006_7764_8849	346
384	3300049593	Ga0501077_0084773	Ga0501077_0084773_338_1423	346
385	3300049741	Ga0501079_0242231	Ga0501079_0242231_221_1303	346
386	3300049742	Ga0501080_0000354	Ga0501080_0000354_22707_23792	346
387	3300049742	Ga0501080_0220218	Ga0501080_0220218_83_1168	346
388	3300049743	Ga0501081_0013294	Ga0501081_0013294_1129_2214	346
389	3300049743	Ga0501081_0185917	Ga0501081_0185917_109_1191	346
390	3300049744	Ga0501083_0001759	Ga0501083_0001759_3373_4458	346
391	3300049822	Ga0501035_0000011	Ga0501035_0000011_291509_292594	346
392	3300049822	Ga0501035_0141737	Ga0501035_0141737_684_1769	346
393	3300049823	Ga0501044_0000333	Ga0501044_0000333_13122_14207	346
394	3300049823	Ga0501044_0028003	Ga0501044_0028003_3990_5075	346
395	3300050510	nmdc:mga06r32_4406_c1	nmdc:mga06r32_4406_c1_573_1655	346
396	3300054114	Ga0501084_0038056	Ga0501084_0038056_189_1274	346
397	3300060353	Ga0501082_0009871	Ga0501082_0009871_6117_7202	346
398	iso_pu_bacteria	2554235234	2555262575	346
399	iso_pu_bacteria	2599185156	2599331691	346
400	iso_pu_bacteria	2600255256	2601535824	346
401	iso_pu_bacteria	2600255257	2601540592	346
402	iso_pu_bacteria	2600255310	2601759217	346
403	iso_pu_bacteria	2600255311	2601765119	346
404	iso_pu_bacteria	2602042046	2603640070	346
405	iso_pu_bacteria	2643221637	2644210100	346
406	iso_pu_bacteria	2667528173	2671110354	346
407	iso_pu_bacteria	2791354903	2791924146	346
408	iso_pu_bacteria	2811995292	2813726306	346
409	iso_pu_bacteria	2814123068	2814693690	346
410	iso_pu_bacteria	2842922631	2842924095	346
411	iso_pu_bacteria	2904474040	2904478773	346
412	iso_pu_bacteria	2919108558	2919112200	346
413	iso_pu_bacteria	2919150387	2919154881	346
414	iso_pu_bacteria	2927143783	2927148465	346
415	iso_pu_bacteria	2971820967	2971824034	346
416	3300005272	Ga0065703_1019815	Ga0065703_10198151	347
417	3300005336	Ga0070680_100011594	Ga0070680_1000115943	347
418	3300005337	Ga0070682_100008453	Ga0070682_1000084537	347
419	3300005366	Ga0070659_100102322	Ga0070659_1001023222	347
420	3300005458	Ga0070681_10004974	Ga0070681_100049746	347
421	3300005459	Ga0068867_100115897	Ga0068867_1001158972	347
422	3300005530	Ga0070679_100019729	Ga0070679_1000197292	347
423	3300005539	Ga0068853_100006640	Ga0068853_1000066408	347
424	3300005547	Ga0070693_100046188	Ga0070693_1000461883	347
425	3300005563	Ga0068855_100079146	Ga0068855_1000791463	347
426	3300005983	Ga0081540_1015352	Ga0081540_10153523	347
427	3300006038	Ga0075365_10032328	Ga0075365_100323283	347
428	3300006051	Ga0075364_10035976	Ga0075364_100359764	347
429	3300006946	Ga0079104_1001489	Ga0079104_10014894	347
430	3300006946	Ga0079104_1007364	Ga0079104_10073643	347
431	3300009011	Ga0105251_10000386	Ga0105251_100003868	347
432	3300009011	Ga0105251_10001214	Ga0105251_1000121417	347
433	3300009011	Ga0105251_10001714	Ga0105251_100017148	347
434	3300009011	Ga0105251_10001849	Ga0105251_1000184913	347
435	3300009036	Ga0105244_10000566	Ga0105244_1000056617	347
436	3300009092	Ga0105250_10019352	Ga0105250_100193522	347
437	3300009101	Ga0105247_10000462	Ga0105247_1000046230	347
438	3300009174	Ga0105241_10000010	Ga0105241_10000010198	347
439	3300009174	Ga0105241_10002458	Ga0105241_1000245810	347
440	3300010375	Ga0105239_10428361	Ga0105239_104283612	347
441	3300013100	Ga0157373_10015780	Ga0157373_100157802	347
442	3300013100	Ga0157373_10032858	Ga0157373_100328584	347
443	3300013104	Ga0157370_10153869	Ga0157370_101538692	347
444	3300013307	Ga0157372_10013953	Ga0157372_1001395310	347
445	3300014497	Ga0182008_10001384	Ga0182008_100013846	347
446	3300017792	Ga0163161_10000006	Ga0163161_1000000672	347
447	3300025303	Ga0209051_1017416	Ga0209051_10174162	347
448	3300025711	Ga0207696_1000038	Ga0207696_100003887	347
449	3300025711	Ga0207696_1000046	Ga0207696_100004674	347
450	3300025728	Ga0207655_1000208	Ga0207655_100020871	347
451	3300025735	Ga0207713_1000002	Ga0207713_1000002203	347
452	3300025735	Ga0207713_1000035	Ga0207713_100003545	347
453	3300025735	Ga0207713_1000056	Ga0207713_100005674	347
454	3300025735	Ga0207713_1000075	Ga0207713_1000075113	347
455	3300025735	Ga0207713_1000613	Ga0207713_100061311	347
456	3300025900	Ga0207710_10000024	Ga0207710_10000024219	347
457	3300025911	Ga0207654_10000010	Ga0207654_10000010199	347
458	3300025917	Ga0207660_10115366	Ga0207660_101153661	347
459	3300025932	Ga0207690_10048628	Ga0207690_100486282	347
460	3300025933	Ga0207706_10087682	Ga0207706_100876822	347
461	3300026089	Ga0207648_10100254	Ga0207648_101002542	347
462	3300026116	Ga0207674_10172146	Ga0207674_101721462	347
463	3300027111	Ga0209281_1000139	Ga0209281_100013983	347
464	3300027312	Ga0209371_1001252	Ga0209371_100125212	347
465	3300030500	Ga0268256_1001070	Ga0268256_100107010	347
466	3300031911	Ga0307412_10109536	Ga0307412_101095362	347
467	3300046453	Ga0495627_001403	Ga0495627_001403_3655_4713	347
468	3300046522	Ga0495643_0066194	Ga0495643_0066194_46_1134	347
469	3300046530	Ga0495654_0041084	Ga0495654_0041084_284_1342	347
470	3300046794	Ga0495589_0000274	Ga0495589_0000274_31739_32797	347
471	3300047443	Ga0495687_019672	Ga0495687_019672_1318_2406	347
472	3300048906	Ga0496103_0035485	Ga0496103_0035485_485_1543	347
473	3300048919	Ga0496116_0000058	Ga0496116_0000058_203170_204228	347
474	3300048920	Ga0496117_0000450	Ga0496117_0000450_36540_37598	347
475	3300048920	Ga0496117_0120016	Ga0496117_0120016_16_1074	347
476	3300048921	Ga0496118_0004618	Ga0496118_0004618_7891_8949	347
477	3300048923	Ga0496120_0075973	Ga0496120_0075973_167_1225	347
478	3300049590	Ga0501074_0165477	Ga0501074_0165477_478_1563	347
479	3300050491	nmdc:mga00v17_30347_c1	nmdc:mga00v17_30347_c1_1134_2222	347
480	3300050492	nmdc:mga0yw44_44784_c1	nmdc:mga0yw44_44784_c1_1347_2435	347
481	iso_pu_bacteria	2558860983	2561466019	347
482	iso_pu_bacteria	2775507049	2776912717	347
483	iso_pu_bacteria	2842333319	2842336503	347
484	iso_pu_bacteria	2852103415	2852104318	347
485	iso_pu_bacteria	2888350351	2888355300	347
486	iso_pu_bacteria	2889010040	2889010277	347
487	iso_pu_bacteria	2922130491	2922138399	347
488	iso_pu_bacteria	2922185730	2922191343	347
489	iso_pu_bacteria	2924762789	2924766264	347
490	iso_pu_bacteria	2937822353	2937825174	347
491	iso_pu_bacteria	2937843397	2937845265	347
492	iso_pu_bacteria	2958100919	2958102751	347
493	iso_pu_bacteria	2958115193	2958116522	347
494	iso_pu_bacteria	2965119406	2965124496	347
495	iso_pu_bacteria	2977971508	2977975987	347
496	iso_pu_bacteria	2979710463	2979715085	347
497	iso_pu_bacteria	2987666974	2987670811	347
498	3300005434	Ga0070709_10035506	Ga0070709_100355062	348
499	3300006173	Ga0070716_100090654	Ga0070716_1000906542	348
500	3300006946	Ga0079104_1000204	Ga0079104_100020447	348
501	3300025939	Ga0207665_10009713	Ga0207665_100097134	348
502	3300027111	Ga0209281_1000181	Ga0209281_100018121	348
503	3300031251	Ga0265327_10031935	Ga0265327_100319354	348
504	3300046458	Ga0495591_000763	Ga0495591_000763_17907_18995	348
505	3300046471	Ga0495650_0000204	Ga0495650_0000204_93876_94991	348
506	3300046474	Ga0495605_0081541	Ga0495605_0081541_301_1389	348
507	3300046491	Ga0495584_0007011	Ga0495584_0007011_4278_5366	348
508	3300046507	Ga0495606_0002305	Ga0495606_0002305_14334_15422	348
509	3300046524	Ga0495648_0006999	Ga0495648_0006999_1657_2745	348
510	3300046530	Ga0495654_0000164	Ga0495654_0000164_1048_2163	348
511	3300046692	Ga0495671_0003984	Ga0495671_0003984_3159_4247	348
512	3300046694	Ga0495649_0089711	Ga0495649_0089711_102_1217	348
513	3300046794	Ga0495589_0015703	Ga0495589_0015703_887_1975	348
514	3300046810	Ga0495660_0000048	Ga0495660_0000048_21090_22205	348
515	3300047320	Ga0495672_0000002	Ga0495672_0000002_609835_610950	348
516	3300047323	Ga0495683_0027665	Ga0495683_0027665_1624_2712	348
517	3300047469	Ga0495673_0000984	Ga0495673_0000984_2055_3143	348
518	3300049459	Ga0495678_000354	Ga0495678_000354_16926_18014	348
519	3300049460	Ga0495682_0000001	Ga0495682_0000001_1223515_1224630	348
520	3300053126	Ga0500621_000003	Ga0500621_000003_213097_214185	348
521	iso_pu_bacteria	2547132181	2547696843	348
522	iso_pu_bacteria	2561511199	2562465059	348
523	iso_pu_bacteria	2671180115	2671585647	348
524	iso_pu_bacteria	2738541317	2738946610	348
525	iso_pu_bacteria	2791355010	2792310954	348
526	iso_pu_bacteria	2913308742	2913311028	348
527	iso_pu_bacteria	2935625433	2935628645	348
528	iso_pu_bacteria	2939617950	2939620949	348
529	iso_pu_bacteria	2974435778	2974436139	348
530	iso_pu_bacteria	8019504834	8019507094	348
531	2010549000	RicEn_C2005	RicEn_36990	350
532	3300002773	JGI25152J39213_1001503	JGI25152J39213_10015034	350
533	3300013105	Ga0157369_10006441	Ga0157369_1000644113	350
534	3300013307	Ga0157372_10000062	Ga0157372_1000006262	350
535	3300025258	Ga0209129_1000021	Ga0209129_1000021106	350
536	3300027312	Ga0209371_1000027	Ga0209371_1000027326	350
537	3300027312	Ga0209371_1000029	Ga0209371_100002998	350
538	3300027312	Ga0209371_1000260	Ga0209371_100026040	350
539	3300027312	Ga0209371_1006227	Ga0209371_10062272	350
540	3300030500	Ga0268256_1000032	Ga0268256_1000032297	350
541	3300030500	Ga0268256_1000207	Ga0268256_100020728	350
542	3300030500	Ga0268256_1025567	Ga0268256_10255671	350
543	3300042010	Ga0439452_000012	Ga0439452_000012_86635_87693	350
544	3300048908	Ga0496105_0089902	Ga0496105_0089902_43_1101	350
545	3300048922	Ga0496119_0000105	Ga0496119_0000105_83366_84424	350
546	3300048927	Ga0496124_0000783	Ga0496124_0000783_36562_37620	350
547	3300048928	Ga0496125_0009976	Ga0496125_0009976_4424_5482	350
548	3300048929	Ga0496126_0093056	Ga0496126_0093056_673_1731	350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05145

AbrB

Transition state regulatory protein AbrB

98

407

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5xat-assembly1.cif.gz_D	structural insights into the elevator-like mechanism of the sodium/citrate symporter cits	0.5297	12	343
5xar-assembly1.cif.gz_B	structural insights into the elevator-like mechanism of the sodium/citrate symporter cits	0.5287	12	343
5xar-assembly2.cif.gz_D	structural insights into the elevator-like mechanism of the sodium/citrate symporter cits	0.5195	12	343
5xat-assembly2.cif.gz_B	structural insights into the elevator-like mechanism of the sodium/citrate symporter cits	0.5172	35	344
5a1s-assembly2.cif.gz_A	crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica.	0.5113	35	345

ID	Description	Score	Start	End	Superfamily
af_Q2FXR6_31_348_1.20.1530.20	Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold;	0.7016	33	343	1.20.1530.20
af_Q2FXR6_31_348_1.20.1530.20	Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold;	0.687	33	343	1.20.1530.20
af_Q9FLW1_79_442_1.20.1530.20	Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold;	0.6353	34	346	1.20.1530.20
af_Q9FLW1_79_442_1.20.1530.20	Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold;	0.5777	34	346	1.20.1530.20
af_P0AER8_2_366_1.20.1530.20	Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold;	0.5485	5	350	1.20.1530.20

ID	Description	Score	Start	End	GO Terms
AF-A0A0H3GS74-F1-model_v4	Transport protein	0.952	80	346	GO:0010468 GO:0016020
AF-A0A084IH97-F1-model_v4	Membrane protein AbrB	0.9483	7	349	GO:0010468 GO:0016020
AF-A0A0N1A472-F1-model_v4	deleted	0.947	3	348
AF-A0A6A7MAB6-F1-model_v4	AbrB family transcriptional regulator	0.9436	56	349	GO:0010468 GO:0016020
AF-A0A402Q2Y0-F1-model_v4	AbrB family transcriptional regulator	0.9407	5	348	GO:0010468 GO:0016020

Feature Viewer

pLDDT	pTM	Quality
84.6	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F462217

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF05145

AbrB

Transition state regulatory protein AbrB

98

407

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map